NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103750_1013706

Scaffold Ga0103750_1013706


Overview

Basic Information
Taxon OID3300009206 Open in IMG/M
Scaffold IDGa0103750_1013706 Open in IMG/M
Source Dataset NameMicrobial communities of wastewater sludge from Singapore - Sludge11_b2_February
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)888
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.2Long. (o)103.45Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000606Metagenome / Metatranscriptome993Y

Sequences

Protein IDFamilyRBSSequence
Ga0103750_10137061F000606N/AMKAALALIFFACVAGSMAADARNEMIQQLIQQGQVLAQGVFGQLQQQILALAQQAVGQLSTLFGSFGRFDFNAVLDQFKPLVNQLINQALGGVLGSLSGLIGGRASFDFGAIFNGLFQELSKPLTEMGQHILNQGLAAVLGSFGSRGFADLFAGLQQQIGTAVSAAQGALTGALSNLASLGSSILDASKPHWEQLQEQLIGHGLNALGSISETIGNLHGTITGGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.