


| Basic Information | |
|---|---|
| Taxon OID | 3300009105 Open in IMG/M |
| Scaffold ID | Ga0117905_1032313 Open in IMG/M |
| Source Dataset Name | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3053 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 143 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101186 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117905_10323134 | F101186 | GGAGG | MLSENQQSLFADFHKSVEAEGILDAKTSHLIKVAAAMAFGCYP* |
| ⦗Top⦘ |