


| Basic Information | |
|---|---|
| Family ID | F101186 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.25 % |
| % of genes near scaffold ends (potentially truncated) | 17.65 % |
| % of genes from short scaffolds (< 2000 bps) | 73.53 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.353 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (27.451 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (35.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.09% β-sheet: 0.00% Coil/Unstructured: 27.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01022 | HTH_5 | 3.92 |
| PF00583 | Acetyltransf_1 | 2.94 |
| PF01361 | Tautomerase | 2.94 |
| PF00582 | Usp | 1.96 |
| PF05016 | ParE_toxin | 1.96 |
| PF01546 | Peptidase_M20 | 1.96 |
| PF00441 | Acyl-CoA_dh_1 | 1.96 |
| PF01370 | Epimerase | 1.96 |
| PF01925 | TauE | 0.98 |
| PF00072 | Response_reg | 0.98 |
| PF00861 | Ribosomal_L18p | 0.98 |
| PF10543 | ORF6N | 0.98 |
| PF02635 | DrsE | 0.98 |
| PF13847 | Methyltransf_31 | 0.98 |
| PF13635 | DUF4143 | 0.98 |
| PF00581 | Rhodanese | 0.98 |
| PF13211 | DUF4019 | 0.98 |
| PF00903 | Glyoxalase | 0.98 |
| PF01040 | UbiA | 0.98 |
| PF13518 | HTH_28 | 0.98 |
| PF14384 | BrnA_antitoxin | 0.98 |
| PF09626 | DHC | 0.98 |
| PF00872 | Transposase_mut | 0.98 |
| PF01850 | PIN | 0.98 |
| PF00109 | ketoacyl-synt | 0.98 |
| PF00215 | OMPdecase | 0.98 |
| PF11794 | HpaB_N | 0.98 |
| PF05228 | CHASE4 | 0.98 |
| PF01077 | NIR_SIR | 0.98 |
| PF13181 | TPR_8 | 0.98 |
| PF13899 | Thioredoxin_7 | 0.98 |
| PF13751 | DDE_Tnp_1_6 | 0.98 |
| PF00037 | Fer4 | 0.98 |
| PF12681 | Glyoxalase_2 | 0.98 |
| PF11903 | ParD_like | 0.98 |
| PF01613 | Flavin_Reduct | 0.98 |
| PF13649 | Methyltransf_25 | 0.98 |
| PF04116 | FA_hydroxylase | 0.98 |
| PF08734 | GYD | 0.98 |
| PF00815 | Histidinol_dh | 0.98 |
| PF10056 | DUF2293 | 0.98 |
| PF02899 | Phage_int_SAM_1 | 0.98 |
| PF13185 | GAF_2 | 0.98 |
| PF02361 | CbiQ | 0.98 |
| PF13173 | AAA_14 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.94 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.96 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.98 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0619 | ECF-type transporter transmembrane protein EcfT | Coenzyme transport and metabolism [H] | 0.98 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.98 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.98 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.98 |
| COG3322 | Extracellular (periplasmic) sensor domain CHASE (specificity unknown) | Signal transduction mechanisms [T] | 0.98 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.98 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.98 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.98 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.35 % |
| Unclassified | root | N/A | 17.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2100351011|ASMM170b_GM97KZC01CB50U | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 513 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1018197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1717 | Open in IMG/M |
| 3300003830|Ga0051980_10089993 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300003988|Ga0055475_10000126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10489 | Open in IMG/M |
| 3300004026|Ga0055443_10258923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea daltonii | 559 | Open in IMG/M |
| 3300005145|Ga0068713_1000046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 209433 | Open in IMG/M |
| 3300005588|Ga0070728_10014848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6157 | Open in IMG/M |
| 3300005588|Ga0070728_10106636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
| 3300005588|Ga0070728_10176704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1211 | Open in IMG/M |
| 3300005589|Ga0070729_10042625 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300005589|Ga0070729_10071613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2187 | Open in IMG/M |
| 3300005590|Ga0070727_10108411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1592 | Open in IMG/M |
| 3300005600|Ga0070726_10018433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 4355 | Open in IMG/M |
| 3300005600|Ga0070726_10101958 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300005601|Ga0070722_10602547 | Not Available | 500 | Open in IMG/M |
| 3300005609|Ga0070724_10038405 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300005609|Ga0070724_10166268 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005609|Ga0070724_10252687 | Not Available | 769 | Open in IMG/M |
| 3300005612|Ga0070723_10046502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1707 | Open in IMG/M |
| 3300005920|Ga0070725_10039119 | Not Available | 2101 | Open in IMG/M |
| 3300006467|Ga0099972_10043459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3287 | Open in IMG/M |
| 3300006467|Ga0099972_10609658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 590 | Open in IMG/M |
| 3300006467|Ga0099972_10618359 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300006467|Ga0099972_10811530 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300006467|Ga0099972_13109088 | Not Available | 796 | Open in IMG/M |
| 3300007896|Ga0111484_1109343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 536 | Open in IMG/M |
| 3300008062|Ga0114372_1005287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 958 | Open in IMG/M |
| 3300009033|Ga0102956_1294568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 559 | Open in IMG/M |
| 3300009034|Ga0115863_1017923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9741 | Open in IMG/M |
| 3300009035|Ga0102958_1385765 | Not Available | 502 | Open in IMG/M |
| 3300009060|Ga0102962_1209978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 558 | Open in IMG/M |
| 3300009105|Ga0117905_1032313 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300009135|Ga0118736_10010124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2083 | Open in IMG/M |
| 3300009150|Ga0114921_10206438 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300009320|Ga0117909_1074143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3970 | Open in IMG/M |
| 3300009320|Ga0117909_1277653 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009488|Ga0114925_11243656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 548 | Open in IMG/M |
| 3300009506|Ga0118657_10079256 | All Organisms → cellular organisms → Bacteria | 4897 | Open in IMG/M |
| 3300009509|Ga0123573_10161434 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300009788|Ga0114923_10435417 | Not Available | 970 | Open in IMG/M |
| 3300010392|Ga0118731_103666614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 830 | Open in IMG/M |
| 3300010392|Ga0118731_106123265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 1126 | Open in IMG/M |
| 3300010392|Ga0118731_106191743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1857 | Open in IMG/M |
| 3300010392|Ga0118731_109551525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1571 | Open in IMG/M |
| 3300010392|Ga0118731_110642178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 510 | Open in IMG/M |
| 3300010392|Ga0118731_110832027 | Not Available | 863 | Open in IMG/M |
| 3300010392|Ga0118731_115264230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1194 | Open in IMG/M |
| 3300010430|Ga0118733_100789951 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300010430|Ga0118733_101181195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1528 | Open in IMG/M |
| 3300010430|Ga0118733_106616435 | Not Available | 604 | Open in IMG/M |
| 3300013098|Ga0164320_10152640 | Not Available | 1040 | Open in IMG/M |
| 3300013098|Ga0164320_10436024 | Not Available | 656 | Open in IMG/M |
| 3300014903|Ga0164321_10154695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300014903|Ga0164321_10215061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 881 | Open in IMG/M |
| 3300022201|Ga0224503_10284458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 547 | Open in IMG/M |
| 3300022220|Ga0224513_10446613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 525 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10088948 | Not Available | 725 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10000792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5882 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10142968 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10010660 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10358502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 627 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10088220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1005 | Open in IMG/M |
| 3300024429|Ga0209991_10018120 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10022603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2251 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10332578 | Not Available | 713 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10117112 | All Organisms → cellular organisms → Bacteria → PVC group | 985 | Open in IMG/M |
| 3300025016|Ga0210014_1205149 | Not Available | 552 | Open in IMG/M |
| 3300025129|Ga0210027_1259116 | Not Available | 614 | Open in IMG/M |
| 3300025565|Ga0210110_1004653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3826 | Open in IMG/M |
| 3300025841|Ga0210028_1107221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium CG07_land_8_20_14_0_80_52_14 | 1030 | Open in IMG/M |
| 3300025844|Ga0210036_1287238 | Not Available | 527 | Open in IMG/M |
| 3300027536|Ga0209163_1000562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 64826 | Open in IMG/M |
| 3300027758|Ga0209379_10072855 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300027758|Ga0209379_10080794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1189 | Open in IMG/M |
| 3300027758|Ga0209379_10158985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG9 | 792 | Open in IMG/M |
| 3300027790|Ga0209273_10015392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3884 | Open in IMG/M |
| 3300027820|Ga0209578_10160830 | All Organisms → cellular organisms → Bacteria → PVC group | 1085 | Open in IMG/M |
| 3300027820|Ga0209578_10557611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG9 | 510 | Open in IMG/M |
| 3300027828|Ga0209692_10145565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300027845|Ga0209271_10013342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 3270 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10042577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1876 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10580245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 550 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10034471 | Not Available | 2424 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10263000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 934 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10528156 | Not Available | 633 | Open in IMG/M |
| 3300027917|Ga0209536_100071582 | All Organisms → cellular organisms → Bacteria | 4466 | Open in IMG/M |
| 3300027917|Ga0209536_100493051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1529 | Open in IMG/M |
| 3300027967|Ga0209272_10107272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 999 | Open in IMG/M |
| 3300027978|Ga0209165_10124742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 900 | Open in IMG/M |
| 3300027980|Ga0209475_10207589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 876 | Open in IMG/M |
| 3300028599|Ga0265309_10424498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 875 | Open in IMG/M |
| 3300028600|Ga0265303_10121318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1940 | Open in IMG/M |
| 3300031275|Ga0307437_1018013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2932 | Open in IMG/M |
| 3300032173|Ga0315268_10140906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2287 | Open in IMG/M |
| 3300032231|Ga0316187_10170846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1688 | Open in IMG/M |
| 3300032251|Ga0316198_10666096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 559 | Open in IMG/M |
| 3300032252|Ga0316196_10417449 | Not Available | 574 | Open in IMG/M |
| 3300032258|Ga0316191_10767143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 699 | Open in IMG/M |
| 3300032258|Ga0316191_11109898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 572 | Open in IMG/M |
| 3300032260|Ga0316192_10080647 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300032263|Ga0316195_10457820 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300033429|Ga0316193_11412114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 552 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 27.45% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 11.76% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 8.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.90% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 3.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.92% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.92% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 3.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.92% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.96% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.96% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.96% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.98% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.98% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.98% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.98% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.98% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.98% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.98% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.98% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300003830 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300005145 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG | Engineered | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300008062 | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7 | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
| 3300009105 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009320 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025016 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-19 (SPAdes) | Environmental | Open in IMG/M |
| 3300025129 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025841 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 (SPAdes) | Environmental | Open in IMG/M |
| 3300025844 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 (SPAdes) | Environmental | Open in IMG/M |
| 3300027536 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027980 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASMM170b_07290370 | 2100351011 | Coastal Water And Sediment | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| TDF_OR_ARG05_123mDRAFT_10181974 | 3300000242 | Marine | MLSENQRKIFGDFHESVEAERILDEKTSHMIKVAAAMAFGCYP* |
| Ga0051980_100899932 | 3300003830 | Groundwater | MLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYP* |
| Ga0055475_100001264 | 3300003988 | Natural And Restored Wetlands | MLSENQREIFADFHRSVEAEGVLDEKTSHMIKLAVAMALGCYP* |
| Ga0055443_102589231 | 3300004026 | Natural And Restored Wetlands | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMVFGCYP* |
| Ga0068713_1000046174 | 3300005145 | Enrichment Culture | MLSENQRKLFSEFHKSIEAEGILDEKTSHLIKVAAAMAIGCYP* |
| Ga0070728_1001484810 | 3300005588 | Marine Sediment | MLSENQREIFADFHKSVDAEGTLDEKTSHMIKVAAAMAFGCYP* |
| Ga0070728_101066363 | 3300005588 | Marine Sediment | MISENQRRLFADFHKSVEAEGILDEKTSHLIKVALAMAFGCYP* |
| Ga0070728_101767042 | 3300005588 | Marine Sediment | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0070729_100426253 | 3300005589 | Marine Sediment | MLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYP* |
| Ga0070729_100716131 | 3300005589 | Marine Sediment | MLSENQRKLFADFHKSVDAEGILDEKMSHLIKVAAAMAFGCYP* |
| Ga0070727_101084112 | 3300005590 | Marine Sediment | MLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP* |
| Ga0070726_100184332 | 3300005600 | Marine Sediment | MLSENQRKIFAEFHKSVEVEKALDEKTSHLIKVAAAMAFGCYP* |
| Ga0070726_101019583 | 3300005600 | Marine Sediment | MLSENQRELFADFYKSVEAEGILDEKTSHLIKIAAAMAFGCYP* |
| Ga0070722_106025471 | 3300005601 | Marine Sediment | MLSENQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP*MEHL |
| Ga0070724_100384053 | 3300005609 | Marine Sediment | MLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGCYP* |
| Ga0070724_101662683 | 3300005609 | Marine Sediment | MLSENQRNIFADFHKSVEVEGALDEKTSHMIKVAAAMAFGC |
| Ga0070724_102526871 | 3300005609 | Marine Sediment | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAA |
| Ga0070723_100465022 | 3300005612 | Marine Sediment | MLSENQRKIFADFHESIEAEGILDEKTSHMIKVAAAMAFACYP* |
| Ga0070725_100391192 | 3300005920 | Marine Sediment | MLSENQRKIFADFHQSVEVEGILDEKMSHMIKVAAAMAFGCYP* |
| Ga0099972_100434593 | 3300006467 | Marine | MLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIAFGCYP* |
| Ga0099972_106096581 | 3300006467 | Marine | SVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0099972_106183591 | 3300006467 | Marine | MLSENQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP* |
| Ga0099972_108115301 | 3300006467 | Marine | MLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP* |
| Ga0099972_131090881 | 3300006467 | Marine | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGC |
| Ga0111484_11093432 | 3300007896 | Sediment | MDVFLGKEKSMISENQRKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP* |
| Ga0114372_10052871 | 3300008062 | Marine Sediment | MLSENQRKLFADFHNSVEAEGILDEKTSHMIKVAAAMAFGCYP* |
| Ga0102956_12945681 | 3300009033 | Soil | LSENQRKIFADFHNSVDAEGTLDEKTSHMIKVAAAMAFGCYS* |
| Ga0115863_101792310 | 3300009034 | Sediment, Intertidal | MLSGNQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP* |
| Ga0102958_13857652 | 3300009035 | Soil | MLSENQRKLFADFYKTAEAEGILDEKTSHLIKIAAAMAFACYP* |
| Ga0102962_12099781 | 3300009060 | Soil | MLFENQRKIFADFHKSVEAEGVLDEKTSHLIKVAAAMSLGCYP* |
| Ga0117905_10323134 | 3300009105 | Marine | MLSENQQSLFADFHKSVEAEGILDAKTSHLIKVAAAMAFGCYP* |
| Ga0118736_100101245 | 3300009135 | Marine Sediment | MLSENQRELFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0114921_102064384 | 3300009150 | Deep Subsurface | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0117909_10741434 | 3300009320 | Marine | MLSENQRKLFANFHKSVEAEGILDGKTSHLIKIAAAMAFGCYP* |
| Ga0117909_12776534 | 3300009320 | Marine | MLSENQRKLFADFHKSAEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0114925_112436562 | 3300009488 | Deep Subsurface | MLSENQRKLFTDFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0118657_100792564 | 3300009506 | Mangrove Sediment | MEKSMLSEKQRKIFADFHKSIEAEGALDDKTSHIVKITAAMAFGCYP* |
| Ga0123573_101614345 | 3300009509 | Mangrove Sediment | MLSESQPKLFADFHESVEAEGILDEKTAHMIKVAAAMAFACYP* |
| Ga0114923_104354172 | 3300009788 | Deep Subsurface | MLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCYP* |
| Ga0118731_1036666141 | 3300010392 | Marine | MLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP* |
| Ga0118731_1061232653 | 3300010392 | Marine | MDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP* |
| Ga0118731_1061917431 | 3300010392 | Marine | VLSENQRKIFADFHNSVDAEGTFDEKTSHMIKVAAAMAFGCYP* |
| Ga0118731_1095515251 | 3300010392 | Marine | MLSENQRKIFADFHKSVEAEGFLDQKTSHLIKVAAAMAFGCYP* |
| Ga0118731_1106421781 | 3300010392 | Marine | MLAESQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP* |
| Ga0118731_1108320271 | 3300010392 | Marine | MLSENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP* |
| Ga0118731_1152642303 | 3300010392 | Marine | MLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFG |
| Ga0118733_1007899513 | 3300010430 | Marine Sediment | MDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFCCYP* |
| Ga0118733_1011811954 | 3300010430 | Marine Sediment | MDVFSGKEKSMLSENQREIFAAFHKSVEAEGALDDKTSHMVKIAAAIAFGCYP* |
| Ga0118733_1066164351 | 3300010430 | Marine Sediment | GEEKSMLSENQRKIFADFHESVEAEGILDEKTSHMIKVAAAMAFGCYP* |
| Ga0164320_101526403 | 3300013098 | Marine Sediment | MLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCDP* |
| Ga0164320_104360242 | 3300013098 | Marine Sediment | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKIAAAMAFACYP* |
| Ga0164321_101546953 | 3300014903 | Marine Sediment | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKVASAMAFGCYP* |
| Ga0164321_102150612 | 3300014903 | Marine Sediment | MLSENQRKIFADFHESVEAEGILGEKTSHMIKVAAAMAFGCYP* |
| Ga0224503_102844582 | 3300022201 | Sediment | KSMLSENQRKIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP |
| Ga0224513_104466131 | 3300022220 | Sediment | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMVFGCYP |
| (restricted) Ga0233404_100889481 | 3300022913 | Seawater | MLSENQRKIFGDFHESVEAERILDEKTSHMIKVAAAMAFGCYP |
| (restricted) Ga0233409_100007928 | 3300022938 | Seawater | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0233409_101429682 | 3300022938 | Seawater | MLSENQRKLFADFHKSAEAEGILDEKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0233408_100106604 | 3300023089 | Seawater | MLSENQRKIFADFHKSVEAEGILDEKTAHLIKVAAAMAFGCYP |
| (restricted) Ga0255039_103585021 | 3300024062 | Seawater | MLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0255043_100882203 | 3300024338 | Seawater | MLSENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP |
| Ga0209991_100181202 | 3300024429 | Deep Subsurface | MLSENQRKLFTDFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0255046_100226032 | 3300024519 | Seawater | MLDENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP |
| (restricted) Ga0255046_103325781 | 3300024519 | Seawater | MLSENQRKLFADFHKSVEAEGILDEKTSHLIKIAAAMAFACYP |
| (restricted) Ga0255045_101171121 | 3300024528 | Seawater | MLSENQRKIFAEFHKSVEVERALDEKTSHLIKVAAAMAFGCY |
| Ga0210014_12051492 | 3300025016 | Aquifer | MLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYP |
| Ga0210027_12591161 | 3300025129 | Aquifer | MLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAM |
| Ga0210110_10046535 | 3300025565 | Natural And Restored Wetlands | MLSENQREIFADFHRSVEAEGVLDEKTSHMIKLAVAMALGCYP |
| Ga0210028_11072212 | 3300025841 | Aquifer | MLSENQQRLFAEFHKSIEGEWILDGKTSHLIKVAAAMAFGCYP |
| Ga0210036_12872381 | 3300025844 | Aquifer | MLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYPXMEH |
| Ga0209163_100056222 | 3300027536 | Enrichment Culture | MLSENQRKLFSEFHKSIEAEGILDEKTSHLIKVAAAMAIGCYP |
| Ga0209379_100728552 | 3300027758 | Marine Sediment | MLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGCYP |
| Ga0209379_100807941 | 3300027758 | Marine Sediment | MLSENQREIFADFHKSVDAEGTLDEKTSHMIKVAAAMAFGCYP |
| Ga0209379_101589853 | 3300027758 | Marine Sediment | MLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIAFGCYP |
| Ga0209273_100153922 | 3300027790 | Marine Sediment | MLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYP |
| Ga0209578_101608303 | 3300027820 | Marine Sediment | MDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP |
| Ga0209578_105576111 | 3300027820 | Marine Sediment | MLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIA |
| Ga0209692_101455651 | 3300027828 | Marine Sediment | MISENQRRLFADFHKSVEAEVILDEKTSHLIKVALAMAFGCYP |
| Ga0209271_100133426 | 3300027845 | Marine Sediment | MISENQRRLFADFHKSVEAEGILDEKTSHLIKVALAMAFGCYP |
| (restricted) Ga0233415_100425775 | 3300027861 | Seawater | MLSENQRELFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0255052_105802453 | 3300027865 | Seawater | KEKSVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP |
| (restricted) Ga0255053_100344714 | 3300027868 | Seawater | MLSENQRKIFADFHESVEAEGILDEKTSHMIKVAAAMAFGCYP |
| (restricted) Ga0255055_102630002 | 3300027881 | Seawater | MLSENQRKIFADFHQSVEAEGILGEKTSHMIKVAAAMAFGCYP |
| (restricted) Ga0255055_105281562 | 3300027881 | Seawater | MLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYPXMEHLL |
| Ga0209536_1000715822 | 3300027917 | Marine Sediment | MLSENQRKIFADFHESVEAEEILDKKTSHMIKVAAAMAFGCYP |
| Ga0209536_1004930511 | 3300027917 | Marine Sediment | VLSEIQRKLFADFHNSVEAEGIFDEKTSHLIKVAAAMAFGCYP |
| Ga0209272_101072723 | 3300027967 | Marine Sediment | MLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP |
| Ga0209165_101247422 | 3300027978 | Marine Sediment | MLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP |
| Ga0209475_102075892 | 3300027980 | Marine Sediment | MLSENQRKLFADFHKSVDAEGILDEKMSHLIKVAAAMAFGCYP |
| Ga0265309_104244982 | 3300028599 | Sediment | VLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAATMAFGCYP |
| Ga0265303_101213181 | 3300028600 | Sediment | VLSENQRKIFADFHNSVDAEGTFDEKTSHMIKVAAAMAFGCYP |
| Ga0307437_10180132 | 3300031275 | Salt Marsh | MLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGRYP |
| Ga0315268_101409064 | 3300032173 | Sediment | MLSENQKKKFADFHKSVEVEGVLDEKTSHMIRLAAAMAFGCYP |
| Ga0316187_101708465 | 3300032231 | Worm Burrow | MLSENQRKIFAEFHKSVEVERALDEKTSHLIKVAAAMAFGCYP |
| Ga0316198_106660962 | 3300032251 | Sediment | MLSDNQRKTFADFHKLVENEGILNEKTSHMIKMAAAMAFGCYP |
| Ga0316196_104174491 | 3300032252 | Sediment | VLSENQRKIFADFHNSVDAEGTLDEKTSHMIKVAAAMAFGCYS |
| Ga0316191_107671432 | 3300032258 | Worm Burrow | MLSENQRKIFAEFHKSVEVERAFDEKTSHLIKVAAAMAFGCYP |
| Ga0316191_111098981 | 3300032258 | Worm Burrow | MLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP |
| Ga0316192_100806472 | 3300032260 | Worm Burrow | MLSENQRELFADFYKSVEAEGILDEKTSHLIKIAAAMAFGCYP |
| Ga0316195_104578202 | 3300032263 | Sediment | MLSENQRNLFADFHKSVEAEGILDAKTSHLIKIAAAMAFGCYP |
| Ga0316193_114121141 | 3300033429 | Sediment | RKEKSMLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP |
| ⦗Top⦘ |