NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0108968_10423016

Scaffold Ga0108968_10423016


Overview

Basic Information
Taxon OID3300007989 Open in IMG/M
Scaffold IDGa0108968_10423016 Open in IMG/M
Source Dataset NameMicrobial communities of Eelgrass leaves from Netarts Bay, Oregon, USA.Combined Assembly of Gp0128395, Gp0128394
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary → Microbial Communities Of Marine Eelgrass

Source Dataset Sampling Location
Location NameNetarts Bay, Oregon, USA
CoordinatesLat. (o)45.394187Long. (o)-123.939629Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012457Metagenome280Y

Sequences

Protein IDFamilyRBSSequence
Ga0108968_104230161F012457AGGAGMMIKDLEMSKDLDRDALTAVRGGRNSIEQGGVYAPVANVGGGFSFGSPTNIVSAPVNAPSAVLNDNDLQLKLANKTANVLGSLGTEIWQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.