


| Basic Information | |
|---|---|
| Taxon OID | 3300007029 Open in IMG/M |
| Scaffold ID | Ga0102677_101771 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water viral communities from A?ana, Logro?o,Spain - Vir_A?ana_3_PRE |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1790 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | A?ana, ?lva, Pais Vasco, Spain | |||||||
| Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096721 | Metagenome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102677_1017713 | F096721 | N/A | MVGSIFAYIEDGIPEQALFDLTIIAQNAKDFEAGMSALVELGDIINDHYSEREPDYGPYDEIEDSIWGNEGDDFDPPEDWFTDGGPFGPDEDL* |
| ⦗Top⦘ |