


| Basic Information | |
|---|---|
| Taxon OID | 3300006217 Open in IMG/M |
| Scaffold ID | Ga0081461_1028170 Open in IMG/M |
| Source Dataset Name | Combined Assembly of all intestinal viral_metagenomes from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas Southwestern Medical Center |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4338 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UT Southwestern Medical Center, Dallas, Texas, USA | |||||||
| Coordinates | Lat. (o) | 32.815891 | Long. (o) | -96.846336 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082888 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081461_10281704 | F082888 | AGGAG | MSQIIEVIVENKNYQIEWALSEHFEELEGKKFMLNKMAAEQIEMINNLSNTAKILLSAVAGAVIQHLIDNNCQIDNIFENGYFIVKN* |
| ⦗Top⦘ |