


| Basic Information | |
|---|---|
| Taxon OID | 3300003118 Open in IMG/M |
| Scaffold ID | Ga0052233_107483 Open in IMG/M |
| Source Dataset Name | Human gut microbiome from lean and obese individuals in Granada, Spain - Obese sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute of Catalysis, The Higher Council for Scientific Research (CSIC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1327 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Granada, Spain | |||||||
| Coordinates | Lat. (o) | 37.17 | Long. (o) | -3.59 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067844 | Metagenome | 125 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052233_1074831 | F067844 | N/A | MNTLAAETASAWYLILNRKRPTKKVIASYFNMTQFSSHLPRNPDAGNKQVSAGAVVITPQHRFTRAPQGSPKSLGGREEV |
| ⦗Top⦘ |