


| Basic Information | |
|---|---|
| Taxon OID | 3300003102 Open in IMG/M |
| Scaffold ID | Ga0052256_101385 Open in IMG/M |
| Source Dataset Name | Soil and Ice psychrophilic microbial communities from Leh Laddakh, India - psychrophilic sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Bureau of Agriculturally Important Microorganisms, Indian Council of Agricultural Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Unclassified → Soil And Ice Psychrophilic → Soil And Ice Psychrophilic Microbial Communities From Leh Laddakh, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | India: Khardoong La sub glacial region at Leh Laddakh | |||||||
| Coordinates | Lat. (o) | 34.1453972 | Long. (o) | 77.5676139 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003192 | Metagenome / Metatranscriptome | 502 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052256_1013851 | F003192 | AGGAG | MSTTPPSDPPPSQQPGGYDRPGGGGPNVNLNLAALMPTPGNAELVVYILATILIAIIALVADQVDSGAFVTAFTVLTFGYLLSRGIAKASRVLER* |
| ⦗Top⦘ |