| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003102 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111452 | Gp0097801 | Ga0052256 |
| Sample Name | Soil and Ice psychrophilic microbial communities from Leh Laddakh, India - psychrophilic sample |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Bureau of Agriculturally Important Microorganisms, Indian Council of Agricultural Research |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3997411 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil And Ice Psychrophilic Microbial Communities From Leh Laddakh, India |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Sand → Unclassified → Soil And Ice Psychrophilic → Soil And Ice Psychrophilic Microbial Communities From Leh Laddakh, India |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → glacial feature → sand |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | India: Khardoong La sub glacial region at Leh Laddakh | |||||||
| Coordinates | Lat. (o) | 34.1453972 | Long. (o) | 77.5676139 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003192 | Metagenome / Metatranscriptome | 502 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052256_101385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 507 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052256_101385 | Ga0052256_1013851 | F003192 | MSTTPPSDPPPSQQPGGYDRPGGGGPNVNLNLAALMPTPGNAELVVYILATILIAIIALVADQVDSGAFVTAFTVLTFGYLLSRGIAKASRVLER* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |