


| Basic Information | |
|---|---|
| Taxon OID | 3300000053 Open in IMG/M |
| Scaffold ID | Draft_c072511 Open in IMG/M |
| Source Dataset Name | Coal bed methane well microbial communities from Alberta, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 769 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 52.119 | Long. (o) | -113.78 | Alt. (m) | Depth (m) | 686 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003495 | Metagenome / Metatranscriptome | 483 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_0725111 | F003495 | N/A | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| ⦗Top⦘ |