


| Basic Information | |
|---|---|
| Family ID | F003495 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 483 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Number of Associated Samples | 382 |
| Number of Associated Scaffolds | 483 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 6.21 % |
| % of genes near scaffold ends (potentially truncated) | 49.07 % |
| % of genes from short scaffolds (< 2000 bps) | 98.14 % |
| Associated GOLD sequencing projects | 358 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (98.551 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (27.743 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.482 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (69.151 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 483 Family Scaffolds |
|---|---|---|
| PF00115 | COX1 | 2.69 |
| PF00510 | COX3 | 2.48 |
| PF00033 | Cytochrome_B | 1.66 |
| PF13631 | Cytochrom_B_N_2 | 0.62 |
| PF00032 | Cytochrom_B_C | 0.41 |
| PF00124 | Photo_RC | 0.21 |
| PF01929 | Ribosomal_L14e | 0.21 |
| PF01157 | Ribosomal_L21e | 0.21 |
| PF01199 | Ribosomal_L34e | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 483 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 2.48 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 2.07 |
| COG2139 | Ribosomal protein L21E | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG2163 | Ribosomal protein L14E/L6E/L27E | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG2174 | Ribosomal protein L34E | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.76 % |
| Unclassified | root | N/A | 1.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2043231002|Landsort10m_GCH9ZVC02H6UFR | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 502 | Open in IMG/M |
| 2043231002|Landsort10m_GCH9ZVC02HZY1X | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 502 | Open in IMG/M |
| 3300000053|Draft_c072511 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 769 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10122282 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1020 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10167256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 538 | Open in IMG/M |
| 3300001199|J055_10243038 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 640 | Open in IMG/M |
| 3300001681|Abe_10154512 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1101 | Open in IMG/M |
| 3300002154|JGI24538J26636_10011315 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2218 | Open in IMG/M |
| 3300002154|JGI24538J26636_10112243 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 649 | Open in IMG/M |
| 3300003540|FS896DNA_10401696 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 557 | Open in IMG/M |
| 3300003682|Ga0008456_1002824 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 741 | Open in IMG/M |
| 3300003733|Ga0008273_1020510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 507 | Open in IMG/M |
| 3300003754|Ga0005853_1004069 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 570 | Open in IMG/M |
| 3300003799|Ga0007821_10133 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 751 | Open in IMG/M |
| 3300004642|Ga0066612_1018514 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 902 | Open in IMG/M |
| 3300004790|Ga0007758_10140538 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 553 | Open in IMG/M |
| 3300004790|Ga0007758_10142299 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 781 | Open in IMG/M |
| 3300004792|Ga0007761_10117336 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 542 | Open in IMG/M |
| 3300004793|Ga0007760_10050604 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 929 | Open in IMG/M |
| 3300004796|Ga0007763_10061922 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 622 | Open in IMG/M |
| 3300004836|Ga0007759_11523054 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 643 | Open in IMG/M |
| 3300005416|Ga0068880_1048049 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1618 | Open in IMG/M |
| 3300005417|Ga0068884_1088287 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1852 | Open in IMG/M |
| 3300005551|Ga0066843_10094916 | All Organisms → cellular organisms → Eukaryota → Sar | 862 | Open in IMG/M |
| 3300005585|Ga0049084_10068453 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1306 | Open in IMG/M |
| 3300005913|Ga0075108_10261755 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 582 | Open in IMG/M |
| 3300005920|Ga0070725_10435263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 586 | Open in IMG/M |
| 3300006003|Ga0073912_1006779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1015 | Open in IMG/M |
| 3300006103|Ga0007813_1070367 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 696 | Open in IMG/M |
| 3300006125|Ga0007825_1092628 | All Organisms → cellular organisms → Eukaryota → Sar | 607 | Open in IMG/M |
| 3300006126|Ga0007855_1056394 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 831 | Open in IMG/M |
| 3300006374|Ga0075512_1326842 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 651 | Open in IMG/M |
| 3300006383|Ga0075504_1035219 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 747 | Open in IMG/M |
| 3300006396|Ga0075493_1065139 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 701 | Open in IMG/M |
| 3300006613|Ga0101494_1274534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 617 | Open in IMG/M |
| 3300006641|Ga0075471_10211377 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1007 | Open in IMG/M |
| 3300006699|Ga0031696_1210801 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 665 | Open in IMG/M |
| 3300006870|Ga0075479_10124733 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1059 | Open in IMG/M |
| 3300007165|Ga0079302_1100734 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 605 | Open in IMG/M |
| 3300007213|Ga0079255_1256405 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 708 | Open in IMG/M |
| 3300007236|Ga0075463_10098108 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 945 | Open in IMG/M |
| 3300007513|Ga0105019_1040725 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2884 | Open in IMG/M |
| 3300007513|Ga0105019_1214697 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 932 | Open in IMG/M |
| 3300007513|Ga0105019_1264605 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 761 | Open in IMG/M |
| 3300007519|Ga0105055_10115355 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2779 | Open in IMG/M |
| 3300007548|Ga0102877_1203671 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 557 | Open in IMG/M |
| 3300007553|Ga0102819_1075181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 571 | Open in IMG/M |
| 3300007558|Ga0102822_1080700 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 766 | Open in IMG/M |
| 3300007623|Ga0102948_1046294 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1394 | Open in IMG/M |
| 3300007623|Ga0102948_1119844 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 807 | Open in IMG/M |
| 3300007665|Ga0102908_1047842 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 828 | Open in IMG/M |
| 3300007718|Ga0102852_1029083 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1022 | Open in IMG/M |
| 3300007860|Ga0105735_1045355 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 857 | Open in IMG/M |
| 3300007864|Ga0105749_1071946 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 729 | Open in IMG/M |
| 3300007953|Ga0105738_1044404 | Not Available | 708 | Open in IMG/M |
| 3300007958|Ga0105743_1020078 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 661 | Open in IMG/M |
| 3300007981|Ga0102904_1060212 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 869 | Open in IMG/M |
| 3300007992|Ga0105748_10356556 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 627 | Open in IMG/M |
| 3300008013|Ga0099809_10012618 | Not Available | 1014 | Open in IMG/M |
| 3300008107|Ga0114340_1255127 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 533 | Open in IMG/M |
| 3300008258|Ga0114840_1044702 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1203 | Open in IMG/M |
| 3300008261|Ga0114336_1192252 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 865 | Open in IMG/M |
| 3300008261|Ga0114336_1229442 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 757 | Open in IMG/M |
| 3300008262|Ga0114337_1186702 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 859 | Open in IMG/M |
| 3300008510|Ga0110928_1043621 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1315 | Open in IMG/M |
| 3300008791|Ga0103696_1035972 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 542 | Open in IMG/M |
| 3300008803|Ga0103770_1013769 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 923 | Open in IMG/M |
| 3300008832|Ga0103951_10174166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1021 | Open in IMG/M |
| 3300008832|Ga0103951_10192063 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 986 | Open in IMG/M |
| 3300008832|Ga0103951_10227779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 925 | Open in IMG/M |
| 3300008832|Ga0103951_10263134 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 874 | Open in IMG/M |
| 3300008834|Ga0103882_10017608 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 847 | Open in IMG/M |
| 3300008834|Ga0103882_10018920 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 832 | Open in IMG/M |
| 3300008834|Ga0103882_10034551 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 706 | Open in IMG/M |
| 3300008834|Ga0103882_10045169 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 652 | Open in IMG/M |
| 3300008834|Ga0103882_10060082 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 596 | Open in IMG/M |
| 3300008835|Ga0103883_1040425 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 602 | Open in IMG/M |
| 3300008928|Ga0103711_10059994 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 556 | Open in IMG/M |
| 3300008930|Ga0103733_1020569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 999 | Open in IMG/M |
| 3300008932|Ga0103735_1033938 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 731 | Open in IMG/M |
| 3300008933|Ga0103736_1006534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1290 | Open in IMG/M |
| 3300008934|Ga0103737_1009402 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1120 | Open in IMG/M |
| 3300008934|Ga0103737_1021965 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 801 | Open in IMG/M |
| 3300008934|Ga0103737_1039030 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 610 | Open in IMG/M |
| 3300008937|Ga0103740_1007560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1099 | Open in IMG/M |
| 3300008954|Ga0115650_1168071 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1408 | Open in IMG/M |
| 3300008998|Ga0103502_10140335 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 873 | Open in IMG/M |
| 3300009003|Ga0102813_1118389 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 838 | Open in IMG/M |
| 3300009009|Ga0105105_10186972 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1066 | Open in IMG/M |
| 3300009028|Ga0103708_100039810 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 990 | Open in IMG/M |
| 3300009054|Ga0102826_1179799 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 505 | Open in IMG/M |
| 3300009055|Ga0102905_1018413 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1319 | Open in IMG/M |
| 3300009059|Ga0102830_1168667 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 642 | Open in IMG/M |
| 3300009068|Ga0114973_10431559 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 687 | Open in IMG/M |
| 3300009076|Ga0115550_1310553 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 505 | Open in IMG/M |
| 3300009080|Ga0102815_10085394 | All Organisms → cellular organisms → Eukaryota → Sar | 1725 | Open in IMG/M |
| 3300009085|Ga0105103_10578516 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 637 | Open in IMG/M |
| 3300009086|Ga0102812_10541651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 637 | Open in IMG/M |
| 3300009103|Ga0117901_1263126 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 861 | Open in IMG/M |
| 3300009149|Ga0114918_10402641 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 745 | Open in IMG/M |
| 3300009166|Ga0105100_10729858 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 612 | Open in IMG/M |
| 3300009169|Ga0105097_10116749 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1462 | Open in IMG/M |
| 3300009172|Ga0114995_10048729 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2425 | Open in IMG/M |
| 3300009187|Ga0114972_10385153 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 811 | Open in IMG/M |
| 3300009216|Ga0103842_1008114 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 846 | Open in IMG/M |
| 3300009216|Ga0103842_1047256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 528 | Open in IMG/M |
| 3300009221|Ga0103849_1051525 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 580 | Open in IMG/M |
| 3300009235|Ga0103857_10050304 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 791 | Open in IMG/M |
| 3300009247|Ga0103861_10031050 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 770 | Open in IMG/M |
| 3300009254|Ga0103867_1028579 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 589 | Open in IMG/M |
| 3300009265|Ga0103873_1017603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1132 | Open in IMG/M |
| 3300009265|Ga0103873_1021281 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1072 | Open in IMG/M |
| 3300009268|Ga0103874_1000460 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1288 | Open in IMG/M |
| 3300009268|Ga0103874_1003367 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 918 | Open in IMG/M |
| 3300009268|Ga0103874_1007831 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 769 | Open in IMG/M |
| 3300009268|Ga0103874_1028280 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 554 | Open in IMG/M |
| 3300009269|Ga0103876_1047528 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 605 | Open in IMG/M |
| 3300009274|Ga0103878_1004492 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1062 | Open in IMG/M |
| 3300009274|Ga0103878_1010583 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 847 | Open in IMG/M |
| 3300009276|Ga0103879_10001307 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1050 | Open in IMG/M |
| 3300009276|Ga0103879_10006893 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 793 | Open in IMG/M |
| 3300009276|Ga0103879_10035320 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 572 | Open in IMG/M |
| 3300009279|Ga0103880_10002428 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1230 | Open in IMG/M |
| 3300009279|Ga0103880_10005013 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1062 | Open in IMG/M |
| 3300009331|Ga0103824_103001 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 978 | Open in IMG/M |
| 3300009338|Ga0103826_106861 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 807 | Open in IMG/M |
| 3300009340|Ga0103838_1002310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae | 792 | Open in IMG/M |
| 3300009341|Ga0103836_1006528 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 617 | Open in IMG/M |
| 3300009348|Ga0103786_1003772 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1051 | Open in IMG/M |
| 3300009357|Ga0103827_1003187 | All Organisms → cellular organisms → Eukaryota | 840 | Open in IMG/M |
| 3300009385|Ga0103852_1012774 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 776 | Open in IMG/M |
| 3300009387|Ga0103871_1013571 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 644 | Open in IMG/M |
| 3300009402|Ga0103742_1032157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 676 | Open in IMG/M |
| 3300009404|Ga0103853_1016994 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 718 | Open in IMG/M |
| 3300009432|Ga0115005_10270683 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1333 | Open in IMG/M |
| 3300009432|Ga0115005_11192187 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 619 | Open in IMG/M |
| 3300009432|Ga0115005_11277308 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 598 | Open in IMG/M |
| 3300009435|Ga0115546_1104575 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1026 | Open in IMG/M |
| 3300009436|Ga0115008_10291365 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1159 | Open in IMG/M |
| 3300009436|Ga0115008_10424613 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 945 | Open in IMG/M |
| 3300009436|Ga0115008_10959944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 635 | Open in IMG/M |
| 3300009436|Ga0115008_11080405 | All Organisms → cellular organisms → Eukaryota → Sar | 603 | Open in IMG/M |
| 3300009436|Ga0115008_11317304 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 552 | Open in IMG/M |
| 3300009436|Ga0115008_11476081 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 525 | Open in IMG/M |
| 3300009436|Ga0115008_11611202 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 504 | Open in IMG/M |
| 3300009438|Ga0115559_1301801 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 562 | Open in IMG/M |
| 3300009441|Ga0115007_10336296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 982 | Open in IMG/M |
| 3300009441|Ga0115007_10531413 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 778 | Open in IMG/M |
| 3300009447|Ga0115560_1073384 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1453 | Open in IMG/M |
| 3300009450|Ga0127391_1054178 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 783 | Open in IMG/M |
| 3300009496|Ga0115570_10100044 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1418 | Open in IMG/M |
| 3300009496|Ga0115570_10293882 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 706 | Open in IMG/M |
| 3300009507|Ga0115572_10361215 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 816 | Open in IMG/M |
| 3300009507|Ga0115572_10477709 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 692 | Open in IMG/M |
| 3300009512|Ga0115003_10217862 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1143 | Open in IMG/M |
| 3300009512|Ga0115003_10409647 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 797 | Open in IMG/M |
| 3300009526|Ga0115004_10356301 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 867 | Open in IMG/M |
| 3300009543|Ga0115099_10741871 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 605 | Open in IMG/M |
| 3300009543|Ga0115099_10888430 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1343 | Open in IMG/M |
| 3300009544|Ga0115006_11395258 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 631 | Open in IMG/M |
| 3300009544|Ga0115006_11445368 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 621 | Open in IMG/M |
| 3300009544|Ga0115006_11669008 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 580 | Open in IMG/M |
| 3300009550|Ga0115013_10398639 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 876 | Open in IMG/M |
| 3300009550|Ga0115013_10627619 | Not Available | 720 | Open in IMG/M |
| 3300009550|Ga0115013_10832246 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 641 | Open in IMG/M |
| 3300009593|Ga0115011_10238656 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1359 | Open in IMG/M |
| 3300009593|Ga0115011_10314250 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1195 | Open in IMG/M |
| 3300009593|Ga0115011_11593638 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 581 | Open in IMG/M |
| 3300009593|Ga0115011_11710498 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 564 | Open in IMG/M |
| 3300009593|Ga0115011_11757071 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 558 | Open in IMG/M |
| 3300009599|Ga0115103_1222078 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 743 | Open in IMG/M |
| 3300009606|Ga0115102_10957891 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1836 | Open in IMG/M |
| 3300009608|Ga0115100_10804510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 522 | Open in IMG/M |
| 3300009627|Ga0116109_1150198 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 536 | Open in IMG/M |
| 3300009677|Ga0115104_11305601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 577 | Open in IMG/M |
| 3300009679|Ga0115105_10024105 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 766 | Open in IMG/M |
| 3300009679|Ga0115105_10502460 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 521 | Open in IMG/M |
| 3300009679|Ga0115105_11368783 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 523 | Open in IMG/M |
| 3300009730|Ga0123359_159879 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 526 | Open in IMG/M |
| 3300009747|Ga0123363_1041509 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 599 | Open in IMG/M |
| 3300009753|Ga0123360_1060929 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 502 | Open in IMG/M |
| 3300009753|Ga0123360_1131694 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 670 | Open in IMG/M |
| 3300009754|Ga0123364_1106206 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 680 | Open in IMG/M |
| 3300009757|Ga0123367_1208529 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 586 | Open in IMG/M |
| 3300009785|Ga0115001_10838280 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 553 | Open in IMG/M |
| 3300009790|Ga0115012_10747885 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 788 | Open in IMG/M |
| 3300009790|Ga0115012_10953198 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 706 | Open in IMG/M |
| 3300009790|Ga0115012_10987010 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 695 | Open in IMG/M |
| 3300009843|Ga0132176_102688 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 780 | Open in IMG/M |
| 3300009863|Ga0132187_103976 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 687 | Open in IMG/M |
| 3300010293|Ga0116204_1190425 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 669 | Open in IMG/M |
| 3300010306|Ga0129322_1088925 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 604 | Open in IMG/M |
| 3300010306|Ga0129322_1103472 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 511 | Open in IMG/M |
| 3300010309|Ga0102890_1060606 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 753 | Open in IMG/M |
| 3300010334|Ga0136644_10259534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1017 | Open in IMG/M |
| 3300010354|Ga0129333_10942381 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 728 | Open in IMG/M |
| 3300010404|Ga0129323_1081897 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 919 | Open in IMG/M |
| 3300010883|Ga0133547_10758601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1912 | Open in IMG/M |
| 3300010883|Ga0133547_11747603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1153 | Open in IMG/M |
| 3300010981|Ga0138316_11389712 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 579 | Open in IMG/M |
| 3300010985|Ga0138326_10898163 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 739 | Open in IMG/M |
| 3300010987|Ga0138324_10220347 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 884 | Open in IMG/M |
| 3300011118|Ga0114922_10218849 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1603 | Open in IMG/M |
| 3300011262|Ga0151668_1069551 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 568 | Open in IMG/M |
| 3300012408|Ga0138265_1101294 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1063 | Open in IMG/M |
| 3300012413|Ga0138258_1582420 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 630 | Open in IMG/M |
| 3300012419|Ga0138260_10133014 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 740 | Open in IMG/M |
| 3300012523|Ga0129350_1085862 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 516 | Open in IMG/M |
| 3300012525|Ga0129353_1944530 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 548 | Open in IMG/M |
| 3300012687|Ga0157543_1163414 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 544 | Open in IMG/M |
| 3300012699|Ga0157593_1170296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 922 | Open in IMG/M |
| 3300012710|Ga0157550_1124163 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 573 | Open in IMG/M |
| 3300012718|Ga0157557_1010406 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 669 | Open in IMG/M |
| 3300012728|Ga0157552_1167301 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 555 | Open in IMG/M |
| 3300012741|Ga0157529_155518 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 776 | Open in IMG/M |
| 3300012746|Ga0157556_177820 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 850 | Open in IMG/M |
| 3300012752|Ga0157629_1086291 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 759 | Open in IMG/M |
| 3300012761|Ga0138288_1001516 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 598 | Open in IMG/M |
| 3300012766|Ga0138282_1077556 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1353 | Open in IMG/M |
| 3300012775|Ga0138280_1046157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 650 | Open in IMG/M |
| 3300012935|Ga0138257_1358690 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 544 | Open in IMG/M |
| 3300012950|Ga0163108_11092493 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 515 | Open in IMG/M |
| 3300012953|Ga0163179_10814788 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 801 | Open in IMG/M |
| 3300012953|Ga0163179_11029925 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 719 | Open in IMG/M |
| 3300012954|Ga0163111_10211196 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1681 | Open in IMG/M |
| 3300012954|Ga0163111_10526778 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1093 | Open in IMG/M |
| 3300012954|Ga0163111_10635239 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1001 | Open in IMG/M |
| 3300013010|Ga0129327_10219875 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 963 | Open in IMG/M |
| 3300013014|Ga0164295_10793407 | Not Available | 733 | Open in IMG/M |
| 3300016688|Ga0180039_1151180 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 706 | Open in IMG/M |
| 3300016692|Ga0180040_1121640 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 809 | Open in IMG/M |
| 3300016720|Ga0186461_109120 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 507 | Open in IMG/M |
| 3300017329|Ga0186525_1012965 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1115 | Open in IMG/M |
| 3300017495|Ga0186459_1047560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 748 | Open in IMG/M |
| 3300017725|Ga0181398_1127973 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 605 | Open in IMG/M |
| 3300017753|Ga0181407_1028066 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1526 | Open in IMG/M |
| 3300017963|Ga0180437_10730308 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 717 | Open in IMG/M |
| 3300017990|Ga0180436_10701271 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 757 | Open in IMG/M |
| 3300018498|Ga0193224_10284 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 750 | Open in IMG/M |
| 3300018515|Ga0192960_102543 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 851 | Open in IMG/M |
| 3300018526|Ga0193100_101243 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 860 | Open in IMG/M |
| 3300018526|Ga0193100_101451 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 824 | Open in IMG/M |
| 3300018563|Ga0188861_1001247 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 661 | Open in IMG/M |
| 3300018567|Ga0188858_106192 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 645 | Open in IMG/M |
| 3300018583|Ga0193223_1008044 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 711 | Open in IMG/M |
| 3300018583|Ga0193223_1010038 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 657 | Open in IMG/M |
| 3300018588|Ga0193141_1015319 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 589 | Open in IMG/M |
| 3300018592|Ga0193113_1018428 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 737 | Open in IMG/M |
| 3300018603|Ga0192881_1024141 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 571 | Open in IMG/M |
| 3300018604|Ga0193447_1009248 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 840 | Open in IMG/M |
| 3300018604|Ga0193447_1023578 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 558 | Open in IMG/M |
| 3300018616|Ga0193064_1022599 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 579 | Open in IMG/M |
| 3300018648|Ga0193445_1031800 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 684 | Open in IMG/M |
| 3300018662|Ga0192848_1020055 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 771 | Open in IMG/M |
| 3300018673|Ga0193229_1003434 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1123 | Open in IMG/M |
| 3300018674|Ga0193166_1017579 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 620 | Open in IMG/M |
| 3300018676|Ga0193137_1064074 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 527 | Open in IMG/M |
| 3300018683|Ga0192952_1002333 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1202 | Open in IMG/M |
| 3300018683|Ga0192952_1012039 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 770 | Open in IMG/M |
| 3300018692|Ga0192944_1048290 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 609 | Open in IMG/M |
| 3300018699|Ga0193195_1042441 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 547 | Open in IMG/M |
| 3300018711|Ga0193069_1024774 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 685 | Open in IMG/M |
| 3300018711|Ga0193069_1052528 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300018713|Ga0192887_1030605 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 708 | Open in IMG/M |
| 3300018719|Ga0193596_1060349 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 544 | Open in IMG/M |
| 3300018723|Ga0193038_1067667 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 547 | Open in IMG/M |
| 3300018725|Ga0193517_1075526 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 538 | Open in IMG/M |
| 3300018741|Ga0193534_1026035 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 910 | Open in IMG/M |
| 3300018769|Ga0193478_1034305 | All Organisms → cellular organisms → Eukaryota → Sar | 813 | Open in IMG/M |
| 3300018769|Ga0193478_1069030 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 564 | Open in IMG/M |
| 3300018777|Ga0192839_1047559 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 671 | Open in IMG/M |
| 3300018810|Ga0193422_1084408 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 538 | Open in IMG/M |
| 3300018813|Ga0192872_1054410 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 712 | Open in IMG/M |
| 3300018820|Ga0193172_1091727 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 506 | Open in IMG/M |
| 3300018832|Ga0194240_1031843 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 532 | Open in IMG/M |
| 3300018835|Ga0193226_1056372 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 916 | Open in IMG/M |
| 3300018844|Ga0193312_1028356 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 748 | Open in IMG/M |
| 3300018844|Ga0193312_1049270 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 608 | Open in IMG/M |
| 3300018844|Ga0193312_1059029 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 564 | Open in IMG/M |
| 3300018845|Ga0193042_1099019 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 770 | Open in IMG/M |
| 3300018846|Ga0193253_1010462 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1852 | Open in IMG/M |
| 3300018854|Ga0193214_1035944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 967 | Open in IMG/M |
| 3300018855|Ga0193475_1066797 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 579 | Open in IMG/M |
| 3300018869|Ga0193165_10053637 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 643 | Open in IMG/M |
| 3300018875|Ga0193608_1143731 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 502 | Open in IMG/M |
| 3300018880|Ga0193337_1036784 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 611 | Open in IMG/M |
| 3300018881|Ga0192908_10026993 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 622 | Open in IMG/M |
| 3300018882|Ga0193471_1107412 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 520 | Open in IMG/M |
| 3300018901|Ga0193203_10117580 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 894 | Open in IMG/M |
| 3300018904|Ga0192874_10007972 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1540 | Open in IMG/M |
| 3300018912|Ga0193176_10235868 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 521 | Open in IMG/M |
| 3300018928|Ga0193260_10061999 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 809 | Open in IMG/M |
| 3300018930|Ga0192955_10161644 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 576 | Open in IMG/M |
| 3300018934|Ga0193552_10205658 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 556 | Open in IMG/M |
| 3300018942|Ga0193426_10018531 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1288 | Open in IMG/M |
| 3300018960|Ga0192930_10073877 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1364 | Open in IMG/M |
| 3300018966|Ga0193293_10084993 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 597 | Open in IMG/M |
| 3300018966|Ga0193293_10100950 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 561 | Open in IMG/M |
| 3300018968|Ga0192894_10127268 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 801 | Open in IMG/M |
| 3300018968|Ga0192894_10270662 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 569 | Open in IMG/M |
| 3300018968|Ga0192894_10342645 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300018969|Ga0193143_10082370 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 926 | Open in IMG/M |
| 3300018969|Ga0193143_10178296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 620 | Open in IMG/M |
| 3300018979|Ga0193540_10068953 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 937 | Open in IMG/M |
| 3300018979|Ga0193540_10083895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 866 | Open in IMG/M |
| 3300018979|Ga0193540_10083897 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 866 | Open in IMG/M |
| 3300018979|Ga0193540_10151025 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 650 | Open in IMG/M |
| 3300018979|Ga0193540_10167418 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 613 | Open in IMG/M |
| 3300018979|Ga0193540_10183159 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 581 | Open in IMG/M |
| 3300018979|Ga0193540_10208658 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 535 | Open in IMG/M |
| 3300018981|Ga0192968_10103128 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 760 | Open in IMG/M |
| 3300018986|Ga0193554_10083035 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1032 | Open in IMG/M |
| 3300018986|Ga0193554_10116881 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 919 | Open in IMG/M |
| 3300018986|Ga0193554_10184069 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 769 | Open in IMG/M |
| 3300018989|Ga0193030_10136857 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 784 | Open in IMG/M |
| 3300018989|Ga0193030_10229458 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 610 | Open in IMG/M |
| 3300018991|Ga0192932_10205702 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 761 | Open in IMG/M |
| 3300018995|Ga0193430_10019522 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1297 | Open in IMG/M |
| 3300018996|Ga0192916_10177638 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 628 | Open in IMG/M |
| 3300018998|Ga0193444_10023616 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1383 | Open in IMG/M |
| 3300018998|Ga0193444_10137158 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 648 | Open in IMG/M |
| 3300018998|Ga0193444_10170280 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 573 | Open in IMG/M |
| 3300019000|Ga0192953_10052185 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 885 | Open in IMG/M |
| 3300019000|Ga0192953_10092397 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 720 | Open in IMG/M |
| 3300019001|Ga0193034_10192166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 510 | Open in IMG/M |
| 3300019003|Ga0193033_10228430 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 510 | Open in IMG/M |
| 3300019007|Ga0193196_10230479 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 799 | Open in IMG/M |
| 3300019009|Ga0192880_10162585 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 556 | Open in IMG/M |
| 3300019010|Ga0193044_10092211 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1001 | Open in IMG/M |
| 3300019010|Ga0193044_10172583 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 697 | Open in IMG/M |
| 3300019010|Ga0193044_10175742 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 689 | Open in IMG/M |
| 3300019010|Ga0193044_10231577 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 575 | Open in IMG/M |
| 3300019012|Ga0193043_10096305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1315 | Open in IMG/M |
| 3300019012|Ga0193043_10289330 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 599 | Open in IMG/M |
| 3300019020|Ga0193538_10068884 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1304 | Open in IMG/M |
| 3300019022|Ga0192951_10071636 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1060 | Open in IMG/M |
| 3300019022|Ga0192951_10325133 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 582 | Open in IMG/M |
| 3300019024|Ga0193535_10079706 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1049 | Open in IMG/M |
| 3300019032|Ga0192869_10400797 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 596 | Open in IMG/M |
| 3300019037|Ga0192886_10111743 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 814 | Open in IMG/M |
| 3300019039|Ga0193123_10362778 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 567 | Open in IMG/M |
| 3300019039|Ga0193123_10448540 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 504 | Open in IMG/M |
| 3300019045|Ga0193336_10163360 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 848 | Open in IMG/M |
| 3300019048|Ga0192981_10039196 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1638 | Open in IMG/M |
| 3300019048|Ga0192981_10343446 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 545 | Open in IMG/M |
| 3300019048|Ga0192981_10361920 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 524 | Open in IMG/M |
| 3300019049|Ga0193082_10292591 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 840 | Open in IMG/M |
| 3300019051|Ga0192826_10311168 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 574 | Open in IMG/M |
| 3300019055|Ga0193208_10704406 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 521 | Open in IMG/M |
| 3300019055|Ga0193208_10739874 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 505 | Open in IMG/M |
| 3300019088|Ga0193129_1017539 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 575 | Open in IMG/M |
| 3300019097|Ga0193153_1023988 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 631 | Open in IMG/M |
| 3300019099|Ga0193102_1029666 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 523 | Open in IMG/M |
| 3300019123|Ga0192980_1081221 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 592 | Open in IMG/M |
| 3300019126|Ga0193144_1001021 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1756 | Open in IMG/M |
| 3300019133|Ga0193089_1064527 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 887 | Open in IMG/M |
| 3300019136|Ga0193112_1051792 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 968 | Open in IMG/M |
| 3300019139|Ga0193047_1031129 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 946 | Open in IMG/M |
| 3300019143|Ga0192856_1052379 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 585 | Open in IMG/M |
| 3300019147|Ga0193453_1011139 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1599 | Open in IMG/M |
| 3300019198|Ga0180033_173371 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 627 | Open in IMG/M |
| 3300019744|Ga0193998_1039633 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 667 | Open in IMG/M |
| 3300020078|Ga0206352_10078210 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 505 | Open in IMG/M |
| 3300020162|Ga0211735_10363638 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 599 | Open in IMG/M |
| 3300020165|Ga0206125_10291499 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 612 | Open in IMG/M |
| 3300020165|Ga0206125_10336441 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 558 | Open in IMG/M |
| 3300020436|Ga0211708_10420822 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 548 | Open in IMG/M |
| 3300020464|Ga0211694_10506817 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 527 | Open in IMG/M |
| 3300020551|Ga0208360_1024028 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 807 | Open in IMG/M |
| 3300020595|Ga0206126_10429820 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 577 | Open in IMG/M |
| 3300020695|Ga0214190_1026248 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 624 | Open in IMG/M |
| 3300021291|Ga0206694_1023467 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 626 | Open in IMG/M |
| 3300021342|Ga0206691_1412082 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 504 | Open in IMG/M |
| 3300021359|Ga0206689_10847088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 657 | Open in IMG/M |
| 3300021889|Ga0063089_1051526 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 570 | Open in IMG/M |
| 3300021889|Ga0063089_1071433 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 501 | Open in IMG/M |
| 3300021913|Ga0063104_1104042 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 563 | Open in IMG/M |
| 3300022369|Ga0210310_1022726 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 643 | Open in IMG/M |
| 3300022374|Ga0210311_1018502 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 840 | Open in IMG/M |
| 3300023174|Ga0214921_10440682 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 646 | Open in IMG/M |
| 3300023184|Ga0214919_10726545 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 557 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10257946 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 565 | Open in IMG/M |
| 3300023566|Ga0228679_1025620 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 615 | Open in IMG/M |
| 3300023699|Ga0228695_1055402 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 562 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10247103 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 648 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10162569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 920 | Open in IMG/M |
| 3300024236|Ga0228655_1077405 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 728 | Open in IMG/M |
| 3300024239|Ga0247724_1039381 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 693 | Open in IMG/M |
| (restricted) 3300024299|Ga0233448_1103962 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 767 | Open in IMG/M |
| 3300025330|Ga0208615_102765 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 740 | Open in IMG/M |
| 3300025367|Ga0208108_1004933 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1564 | Open in IMG/M |
| 3300025401|Ga0207955_1049007 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 687 | Open in IMG/M |
| 3300025723|Ga0208741_10087490 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 705 | Open in IMG/M |
| 3300025742|Ga0255248_1021601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 742 | Open in IMG/M |
| 3300025776|Ga0208699_1035616 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 588 | Open in IMG/M |
| 3300025788|Ga0208873_1076802 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 508 | Open in IMG/M |
| 3300025810|Ga0208543_1007266 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2856 | Open in IMG/M |
| 3300025822|Ga0209714_1133119 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 651 | Open in IMG/M |
| 3300025840|Ga0208917_1215269 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 633 | Open in IMG/M |
| 3300026123|Ga0209955_1020864 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1501 | Open in IMG/M |
| 3300026398|Ga0247606_1042177 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300026406|Ga0247565_1037148 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 682 | Open in IMG/M |
| 3300026420|Ga0247581_1069798 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 560 | Open in IMG/M |
| 3300026423|Ga0247580_1044561 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 963 | Open in IMG/M |
| 3300026566|Ga0256334_1141587 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 546 | Open in IMG/M |
| 3300027649|Ga0208960_1098013 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 799 | Open in IMG/M |
| 3300027707|Ga0209443_1213247 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 673 | Open in IMG/M |
| 3300027788|Ga0209711_10348958 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 623 | Open in IMG/M |
| 3300027797|Ga0209107_10350888 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 682 | Open in IMG/M |
| 3300027810|Ga0209302_10152992 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1128 | Open in IMG/M |
| 3300027810|Ga0209302_10396729 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 624 | Open in IMG/M |
| 3300027832|Ga0209491_10085818 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 3030 | Open in IMG/M |
| 3300027833|Ga0209092_10067315 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2176 | Open in IMG/M |
| 3300027833|Ga0209092_10144246 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1378 | Open in IMG/M |
| 3300027833|Ga0209092_10146593 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1365 | Open in IMG/M |
| 3300027833|Ga0209092_10173199 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1231 | Open in IMG/M |
| 3300027833|Ga0209092_10469586 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 648 | Open in IMG/M |
| 3300027833|Ga0209092_10538832 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 592 | Open in IMG/M |
| 3300027859|Ga0209503_10037918 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2181 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10390805 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 665 | Open in IMG/M |
| 3300027883|Ga0209713_10131262 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1703 | Open in IMG/M |
| 3300027906|Ga0209404_10762560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 655 | Open in IMG/M |
| 3300027972|Ga0209079_10008306 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 3496 | Open in IMG/M |
| 3300028008|Ga0228674_1161432 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 740 | Open in IMG/M |
| 3300028106|Ga0247596_1104240 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 642 | Open in IMG/M |
| 3300028134|Ga0256411_1231714 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 574 | Open in IMG/M |
| 3300028273|Ga0228640_1071646 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 676 | Open in IMG/M |
| 3300028282|Ga0256413_1294271 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 572 | Open in IMG/M |
| 3300028575|Ga0304731_10498343 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 579 | Open in IMG/M |
| 3300030653|Ga0307402_10572165 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 656 | Open in IMG/M |
| 3300030729|Ga0308131_1124163 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 530 | Open in IMG/M |
| 3300030968|Ga0075376_11474489 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 690 | Open in IMG/M |
| 3300031056|Ga0138346_10521215 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 573 | Open in IMG/M |
| 3300031062|Ga0073989_10006759 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 531 | Open in IMG/M |
| 3300031113|Ga0138347_10132211 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 508 | Open in IMG/M |
| 3300031122|Ga0170822_11953964 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 538 | Open in IMG/M |
| 3300031167|Ga0308023_1101651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 526 | Open in IMG/M |
| 3300031231|Ga0170824_113955533 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 895 | Open in IMG/M |
| 3300031522|Ga0307388_10693925 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 680 | Open in IMG/M |
| 3300031523|Ga0307492_10216352 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 687 | Open in IMG/M |
| 3300031559|Ga0308135_1088549 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 556 | Open in IMG/M |
| 3300031571|Ga0308141_1087194 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 560 | Open in IMG/M |
| 3300031621|Ga0302114_10347776 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 567 | Open in IMG/M |
| 3300031626|Ga0302121_10146931 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 677 | Open in IMG/M |
| 3300031717|Ga0307396_10619127 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 520 | Open in IMG/M |
| 3300031725|Ga0307381_10177867 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 738 | Open in IMG/M |
| 3300031734|Ga0307397_10493404 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 571 | Open in IMG/M |
| 3300031739|Ga0307383_10394099 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 680 | Open in IMG/M |
| 3300031739|Ga0307383_10463947 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 628 | Open in IMG/M |
| 3300031742|Ga0307395_10534386 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 513 | Open in IMG/M |
| 3300031774|Ga0315331_10993560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 572 | Open in IMG/M |
| 3300032006|Ga0310344_10679217 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 878 | Open in IMG/M |
| 3300032093|Ga0315902_10592584 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 934 | Open in IMG/M |
| 3300032153|Ga0073946_1044067 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 625 | Open in IMG/M |
| 3300032517|Ga0314688_10487032 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 670 | Open in IMG/M |
| 3300032519|Ga0314676_10831984 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 530 | Open in IMG/M |
| 3300032521|Ga0314680_11019556 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 516 | Open in IMG/M |
| 3300032651|Ga0314685_10315407 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 865 | Open in IMG/M |
| 3300032707|Ga0314687_10211029 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1018 | Open in IMG/M |
| 3300032707|Ga0314687_10477999 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 694 | Open in IMG/M |
| 3300032711|Ga0314681_10648018 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 586 | Open in IMG/M |
| 3300032732|Ga0314711_10640553 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 537 | Open in IMG/M |
| 3300032742|Ga0314710_10271828 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 700 | Open in IMG/M |
| 3300032743|Ga0314707_10136664 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1194 | Open in IMG/M |
| 3300032748|Ga0314713_10511299 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 507 | Open in IMG/M |
| 3300032750|Ga0314708_10283369 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 813 | Open in IMG/M |
| 3300032755|Ga0314709_10808250 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 553 | Open in IMG/M |
| 3300032820|Ga0310342_100266716 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1787 | Open in IMG/M |
| 3300033521|Ga0316616_103772695 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 570 | Open in IMG/M |
| 3300033979|Ga0334978_0319931 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 740 | Open in IMG/M |
| 3300033980|Ga0334981_0199851 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 931 | Open in IMG/M |
| 3300033988|Ga0334909_044004 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 570 | Open in IMG/M |
| 3300034003|Ga0334922_002649 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1673 | Open in IMG/M |
| 3300034019|Ga0334998_0294853 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 965 | Open in IMG/M |
| 3300034019|Ga0334998_0647608 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 569 | Open in IMG/M |
| 3300034021|Ga0335004_0338105 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 875 | Open in IMG/M |
| 3300034024|Ga0334927_048409 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1169 | Open in IMG/M |
| 3300034032|Ga0334954_079380 | Not Available | 547 | Open in IMG/M |
| 3300034032|Ga0334954_086858 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 526 | Open in IMG/M |
| 3300034118|Ga0335053_0773516 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 533 | Open in IMG/M |
| 3300034134|Ga0334928_096915 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 596 | Open in IMG/M |
| 3300034138|Ga0334955_156610 | Not Available | 524 | Open in IMG/M |
| 3300034391|Ga0334917_046710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 776 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 27.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.18% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 4.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.31% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.11% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.69% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.86% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 1.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.24% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.24% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.04% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.04% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.04% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.83% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.83% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.62% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.62% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.62% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.62% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.41% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.41% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.41% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.41% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.41% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.41% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.41% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.41% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.21% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.21% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.21% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.21% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.21% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.21% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.21% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.21% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.21% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.21% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.21% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.21% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.21% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.21% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.21% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.21% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.21% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.21% |
| Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 0.21% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.21% |
| Eutrophic Pond | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond | 0.21% |
| Microbial Mats | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2043231002 | 10 m water depth | Environmental | Open in IMG/M |
| 3300000053 | Coal bed methane well microbial communities from Alberta, Canada | Engineered | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
| 3300001681 | Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA | Environmental | Open in IMG/M |
| 3300002154 | Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Metagenome | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003682 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003733 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003799 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE09Aug07 | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005416 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006003 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_2-Sept-14 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006125 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 | Environmental | Open in IMG/M |
| 3300006126 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 | Environmental | Open in IMG/M |
| 3300006374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006613 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006699 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2156 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007213 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 NT10 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008013 | Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
| 3300008791 | Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLane | Environmental | Open in IMG/M |
| 3300008803 | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NP-2 | Environmental | Open in IMG/M |
| 3300008832 | Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150 | Environmental | Open in IMG/M |
| 3300008834 | Eukaryotic communities of water from the North Atlantic ocean - ACM26 | Environmental | Open in IMG/M |
| 3300008835 | Eukaryotic communities of water from the North Atlantic ocean - ACM44 | Environmental | Open in IMG/M |
| 3300008928 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3 | Environmental | Open in IMG/M |
| 3300008930 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1B | Environmental | Open in IMG/M |
| 3300008932 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2A | Environmental | Open in IMG/M |
| 3300008933 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2B | Environmental | Open in IMG/M |
| 3300008934 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2C | Environmental | Open in IMG/M |
| 3300008937 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3C | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300008998 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009028 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009055 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009216 | Microbial communities of water from the North Atlantic ocean - ACM47 | Environmental | Open in IMG/M |
| 3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
| 3300009265 | Eukaryotic communities of water from the North Atlantic ocean - ACM8 | Environmental | Open in IMG/M |
| 3300009268 | Eukaryotic communities of water from the North Atlantic ocean - ACM43 | Environmental | Open in IMG/M |
| 3300009269 | Eukaryotic communities of water from the North Atlantic ocean - ACM28 | Environmental | Open in IMG/M |
| 3300009274 | Eukaryotic communities of water from the North Atlantic ocean - ACM10 | Environmental | Open in IMG/M |
| 3300009276 | Eukaryotic communities of water from the North Atlantic ocean - ACM57 | Environmental | Open in IMG/M |
| 3300009279 | Eukaryotic communities of water from the North Atlantic ocean - ACM42 | Environmental | Open in IMG/M |
| 3300009331 | Microbial communities of water from the North Atlantic ocean - ACM11 | Environmental | Open in IMG/M |
| 3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
| 3300009340 | Microbial communities of water from the North Atlantic ocean - ACM60 | Environmental | Open in IMG/M |
| 3300009341 | Microbial communities of water from the North Atlantic ocean - ACM17 | Environmental | Open in IMG/M |
| 3300009348 | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_total_RNA | Environmental | Open in IMG/M |
| 3300009357 | Microbial communities of water from the North Atlantic ocean - ACM13 | Environmental | Open in IMG/M |
| 3300009385 | Microbial communities of water from Amazon river, Brazil - RCM5 | Environmental | Open in IMG/M |
| 3300009387 | Microbial communities of water from Amazon river, Brazil - RCM24 | Environmental | Open in IMG/M |
| 3300009402 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4B | Environmental | Open in IMG/M |
| 3300009404 | Microbial communities of water from Amazon river, Brazil - RCM6 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009730 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009747 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009753 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009754 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009843 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009863 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010404 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010985 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8) | Environmental | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012687 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012699 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012718 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012741 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES014 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012746 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES049 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300016688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016720 | Metatranscriptome of marine eukaryotic communities from English Channel in f/20 medium with seawater, no silicate, 18 C, 30 psu salinity and 317 ?mol photons light - Alexandrium tamarense CCMP 1771 (MMETSP0380) | Host-Associated | Open in IMG/M |
| 3300017329 | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium with seawater, no silicate, 19 C, 30 psu salinity and 167 ?mol photons light - Tiarina fusa LIS (MMETSP0472) | Host-Associated | Open in IMG/M |
| 3300017495 | Metatranscriptome of marine eukaryotic communities from English Channel in f/20 medium with seawater, no silicate, 18 C, 30 psu salinity and 325 ?mol photons light - Alexandrium tamarense CCMP 1771 (MMETSP0382) | Host-Associated | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300018498 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_G000000124 (ERX1782113-ERR1711919) | Environmental | Open in IMG/M |
| 3300018515 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231) | Environmental | Open in IMG/M |
| 3300018526 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866) | Environmental | Open in IMG/M |
| 3300018563 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0 | Environmental | Open in IMG/M |
| 3300018567 | Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dT | Environmental | Open in IMG/M |
| 3300018583 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000270 (ERX1782454-ERR1711980) | Environmental | Open in IMG/M |
| 3300018588 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140) | Environmental | Open in IMG/M |
| 3300018592 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047) | Environmental | Open in IMG/M |
| 3300018603 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906) | Environmental | Open in IMG/M |
| 3300018604 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077) | Environmental | Open in IMG/M |
| 3300018616 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877) | Environmental | Open in IMG/M |
| 3300018648 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027) | Environmental | Open in IMG/M |
| 3300018662 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878) | Environmental | Open in IMG/M |
| 3300018673 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189) | Environmental | Open in IMG/M |
| 3300018674 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006) | Environmental | Open in IMG/M |
| 3300018676 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913) | Environmental | Open in IMG/M |
| 3300018683 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204) | Environmental | Open in IMG/M |
| 3300018692 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153) | Environmental | Open in IMG/M |
| 3300018699 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211) | Environmental | Open in IMG/M |
| 3300018711 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099) | Environmental | Open in IMG/M |
| 3300018713 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119) | Environmental | Open in IMG/M |
| 3300018719 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 49.5 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018723 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170) | Environmental | Open in IMG/M |
| 3300018725 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230) | Environmental | Open in IMG/M |
| 3300018741 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275) | Environmental | Open in IMG/M |
| 3300018769 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205) | Environmental | Open in IMG/M |
| 3300018777 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349) | Environmental | Open in IMG/M |
| 3300018810 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380) | Environmental | Open in IMG/M |
| 3300018813 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172) | Environmental | Open in IMG/M |
| 3300018820 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511) | Environmental | Open in IMG/M |
| 3300018832 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031) | Environmental | Open in IMG/M |
| 3300018835 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198) | Environmental | Open in IMG/M |
| 3300018844 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982) | Environmental | Open in IMG/M |
| 3300018845 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122) | Environmental | Open in IMG/M |
| 3300018846 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503) | Environmental | Open in IMG/M |
| 3300018854 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346) | Environmental | Open in IMG/M |
| 3300018855 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903) | Environmental | Open in IMG/M |
| 3300018869 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000200 (ERX1782317-ERR1712030) | Environmental | Open in IMG/M |
| 3300018875 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 49.5 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018880 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124) | Environmental | Open in IMG/M |
| 3300018881 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094) | Environmental | Open in IMG/M |
| 3300018882 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480) | Environmental | Open in IMG/M |
| 3300018901 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126) | Environmental | Open in IMG/M |
| 3300018904 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789433-ERR1719416) | Environmental | Open in IMG/M |
| 3300018912 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243) | Environmental | Open in IMG/M |
| 3300018928 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386) | Environmental | Open in IMG/M |
| 3300018930 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008) | Environmental | Open in IMG/M |
| 3300018934 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183 | Environmental | Open in IMG/M |
| 3300018942 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003) | Environmental | Open in IMG/M |
| 3300018960 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357) | Environmental | Open in IMG/M |
| 3300018966 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845) | Environmental | Open in IMG/M |
| 3300018968 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096) | Environmental | Open in IMG/M |
| 3300018969 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179) | Environmental | Open in IMG/M |
| 3300018979 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037) | Environmental | Open in IMG/M |
| 3300018981 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238) | Environmental | Open in IMG/M |
| 3300018986 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596 | Environmental | Open in IMG/M |
| 3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
| 3300018991 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789359-ERR1719369) | Environmental | Open in IMG/M |
| 3300018995 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902) | Environmental | Open in IMG/M |
| 3300018996 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156) | Environmental | Open in IMG/M |
| 3300018998 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117) | Environmental | Open in IMG/M |
| 3300019000 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129) | Environmental | Open in IMG/M |
| 3300019001 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007) | Environmental | Open in IMG/M |
| 3300019003 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182) | Environmental | Open in IMG/M |
| 3300019007 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012) | Environmental | Open in IMG/M |
| 3300019009 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966) | Environmental | Open in IMG/M |
| 3300019010 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838) | Environmental | Open in IMG/M |
| 3300019012 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129) | Environmental | Open in IMG/M |
| 3300019020 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019024 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237) | Environmental | Open in IMG/M |
| 3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
| 3300019037 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183) | Environmental | Open in IMG/M |
| 3300019039 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019049 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232) | Environmental | Open in IMG/M |
| 3300019051 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227) | Environmental | Open in IMG/M |
| 3300019055 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963) | Environmental | Open in IMG/M |
| 3300019088 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782331-ERR1712049) | Environmental | Open in IMG/M |
| 3300019097 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022) | Environmental | Open in IMG/M |
| 3300019099 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084) | Environmental | Open in IMG/M |
| 3300019123 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195) | Environmental | Open in IMG/M |
| 3300019126 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043) | Environmental | Open in IMG/M |
| 3300019133 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071) | Environmental | Open in IMG/M |
| 3300019136 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004) | Environmental | Open in IMG/M |
| 3300019139 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120) | Environmental | Open in IMG/M |
| 3300019143 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244) | Environmental | Open in IMG/M |
| 3300019147 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973) | Environmental | Open in IMG/M |
| 3300019198 | Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019744 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MG | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300020695 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021889 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021913 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022369 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022374 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023566 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023699 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024299 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_150_MG | Environmental | Open in IMG/M |
| 3300025330 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025367 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025742 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025776 | Marine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes) | Environmental | Open in IMG/M |
| 3300025788 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026123 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026398 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026406 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 13R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026420 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026423 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030653 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030729 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030968 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031056 | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031062 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031113 | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031522 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031523 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3L | Environmental | Open in IMG/M |
| 3300031559 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_937_33.10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031571 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_535_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031717 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031734 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031742 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032153 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_V_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032517 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032519 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032521 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032651 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032707 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032711 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032732 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032742 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032743 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032748 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032750 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032755 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033988 | Soil microbial communities from Mojave Desert, California, United States - 5NOC | Environmental | Open in IMG/M |
| 3300034003 | Biocrust microbial communities from Mojave Desert, California, United States - 18HMC | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034024 | Biocrust microbial communities from Mojave Desert, California, United States - 23HNC | Environmental | Open in IMG/M |
| 3300034032 | Biocrust microbial communities from Mojave Desert, California, United States - 50SNC | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034134 | Biocrust microbial communities from Mojave Desert, California, United States - 24HNC | Environmental | Open in IMG/M |
| 3300034138 | Biocrust microbial communities from Mojave Desert, California, United States - 51SNC | Environmental | Open in IMG/M |
| 3300034391 | Biocrust microbial communities from Mojave Desert, California, United States - 13HMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 10m_1587050 | 2043231002 | Marine | MKENNEKKMKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| 10m_582530 | 2043231002 | Marine | MEEKYFWQDNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Draft_0725111 | 3300000053 | Hydrocarbon Resource Environments | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| DelMOSum2010_101222822 | 3300000101 | Marine | MKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| BS_KBA_SWE02_21mDRAFT_101672561 | 3300000792 | Marine | MKENNEKKMKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| J055_102430382 | 3300001199 | Lotic | MNVHAKMNENNEKNIRNWDEISRLMKAFPKDTAAFDSKRVLAKVSSQGSGR* |
| Abe_101545121 | 3300001681 | Black Smokers Hydrothermal Plume | MKENNENKIQNKHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| JGI24538J26636_100113151 | 3300002154 | Marine | EDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| JGI24538J26636_101122431 | 3300002154 | Marine | MKENNEKKIKNEDEISKLTKAFPKDIAALDKRTVL |
| FS896DNA_104016961 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | SMKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0008456_10028242 | 3300003682 | Seawater | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0008273_10205102 | 3300003733 | Marine | QASMKENREKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0005853_10040691 | 3300003754 | Freshwater And Sediment | QASMKENNEKKIRNCDDISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0007821_101331 | 3300003799 | Freshwater | SMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0066612_10185142 | 3300004642 | Marine | MKDNNENKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0007758_101405381 | 3300004790 | Freshwater Lake | QPSMKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0007758_101422992 | 3300004790 | Freshwater Lake | QPSMKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKDNSQGSGT* |
| Ga0007761_101173361 | 3300004792 | Freshwater Lake | NINENNEKIINNEHEISKLIKALPKDIAALDKRSVLANVNSQGSGT* |
| Ga0007760_100506041 | 3300004793 | Freshwater Lake | MKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0007763_100619221 | 3300004796 | Freshwater Lake | MKENKEKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0007759_115230542 | 3300004836 | Freshwater Lake | MKENNEKKMKYCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0068880_10480492 | 3300005416 | Freshwater Lake | MKENKEKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0068884_10882871 | 3300005417 | Freshwater Lake | MKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0066843_100949162 | 3300005551 | Marine | MKENNEKK*ENNDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0049084_100684533 | 3300005585 | Freshwater Lentic | MKVNNQIINNEHEISKLIKALPKDIAALDKRSVLANVNSQG |
| Ga0075108_102617551 | 3300005913 | Saline Lake | KENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0070725_104352632 | 3300005920 | Marine Sediment | MNVQACMKENNEKIIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0073912_10067792 | 3300006003 | Sand | MKIKQDVTSKEVKVIPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0007813_10703671 | 3300006103 | Freshwater | NCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0007825_10926281 | 3300006125 | Freshwater | NNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0007855_10563941 | 3300006126 | Freshwater | ASMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0075512_13268423 | 3300006374 | Aqueous | MKENNEKKIINCDEISKLIKAFPKDIAALDKRSVFEKVNSEGSGR* |
| Ga0075504_10352191 | 3300006383 | Aqueous | NEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0075493_10651392 | 3300006396 | Aqueous | MGMKENNEKKILNVDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0101494_12745341 | 3300006613 | Diffuse Hydrothermal Flow Volcanic Vent | KINNEHEISKLIKPFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0075471_102113771 | 3300006641 | Aqueous | EKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0031696_12108011 | 3300006699 | Deep Ocean | VQASMKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGI* |
| Ga0075479_101247331 | 3300006870 | Aqueous | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0079302_11007341 | 3300007165 | Deep Subsurface | LKENSCLVTNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR* |
| Ga0079255_12564051 | 3300007213 | Marine | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGQ* |
| Ga0075463_100981081 | 3300007236 | Aqueous | MKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT* |
| Ga0105019_10407253 | 3300007513 | Marine | MKENNEKKIIKEDEICKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0105019_12146971 | 3300007513 | Marine | INCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0105019_12646051 | 3300007513 | Marine | IKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0105055_101153552 | 3300007519 | Freshwater | MKENNEKKMKYCDEISKLIKAFPRDIAALDKRSVLAKVN* |
| Ga0102877_12036711 | 3300007548 | Estuarine | MKEKNEKKIKNCDEISKLMKEFPKDIAALDKRRVLAKVNSQGSGR* |
| Ga0102819_10751812 | 3300007553 | Estuarine | MKENKEKKIKNCDEISKLIKAFPKDIAPLDKRSVLAKVNSQGSGR* |
| Ga0102822_10807001 | 3300007558 | Estuarine | MKKNKEKKIKNCDEISKLIKAFPKDIAPLDKRSVLAKVNSQGSGR* |
| Ga0102948_10462942 | 3300007623 | Water | MKEKNEKKIINCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0102948_11198443 | 3300007623 | Water | MKENNEKKNKNPWDISKLIKAFPKDIAALHKRSVLAKVKSQGSF |
| Ga0102908_10478421 | 3300007665 | Estuarine | MKENNEKKINNEHEISKLIKAFPKDIAALDKRRVLAKVNSQGSGR* |
| Ga0102852_10290832 | 3300007718 | Estuarine | MKENNEKKMKYCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0105735_10453551 | 3300007860 | Estuary Water | MKRKNEKKIKNCDEISKLMKEFPKDIAALDKRRVLAKVNSQGSGT* |
| Ga0105749_10719461 | 3300007864 | Estuary Water | MKENNEKKILDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0105738_10444041 | 3300007953 | Estuary Water | MKINVQASMKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVN |
| Ga0105743_10200781 | 3300007958 | Estuary Water | MKENNEKKILDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0102904_10602121 | 3300007981 | Estuarine | LSTYPKKRNDYCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0105748_103565561 | 3300007992 | Estuary Water | MKENNEKKMKYCDEISKLIKAFPKDIAALDKRSVLAKVN* |
| Ga0099809_100126181 | 3300008013 | Coral | MKENKEKKINNEEPISKLTTAPPKHIAALDKRSVLEKDKSQESGT* |
| Ga0114340_12551271 | 3300008107 | Freshwater, Plankton | LAKKQRDIRNDLEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0114840_10447023 | 3300008258 | Freshwater, Plankton | MILNSLKISKLMKEFPKDIAALDKRRVLAKVNSQGSGR* |
| Ga0114336_11922521 | 3300008261 | Freshwater, Plankton | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR* |
| Ga0114336_12294422 | 3300008261 | Freshwater, Plankton | MKENNEKKMKNCDEISKLIKAFPKDIAALDKRSVLAKVN* |
| Ga0114337_11867021 | 3300008262 | Freshwater, Plankton | CDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR* |
| Ga0110928_10436212 | 3300008510 | Water Bodies | MKENNEKKIKNSDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0103696_10359721 | 3300008791 | Ocean Water | LINVQASMKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0103770_10137692 | 3300008803 | Eutrophic Pond | LVTNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR* |
| Ga0103951_101741661 | 3300008832 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGI* |
| Ga0103951_101920631 | 3300008832 | Marine | DNNENKMKNEDEISKLTKAPHKDTAALDKRRVLAKVSSQGSGR* |
| Ga0103951_102277791 | 3300008832 | Marine | MKENNEKKIKKIQEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103951_102631341 | 3300008832 | Marine | VNAKTNEKRAKNIKNDDEISKLTNAPPNATAAFDNRSVFVKVSSVGSGI* |
| Ga0103882_100176083 | 3300008834 | Surface Ocean Water | MKENNENKIKKEDEISKLTNAPPKDTAALDKRSVLAK |
| Ga0103882_100189201 | 3300008834 | Surface Ocean Water | MKEINEKNIPDEHEISKHTKAPPKDTAALDKRSVLANVNSIGSGT* |
| Ga0103882_100345511 | 3300008834 | Surface Ocean Water | MKEKRQKKITNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103882_100451692 | 3300008834 | Surface Ocean Water | MKENKEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103882_100600821 | 3300008834 | Surface Ocean Water | MKENNEKKINNEHEISKLTKAPPKDTAALDNRSVLAKVNSQGSGT* |
| Ga0103883_10404251 | 3300008835 | Surface Ocean Water | MKENNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103711_100599942 | 3300008928 | Ocean Water | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0103733_10205691 | 3300008930 | Ice Edge, Mcmurdo Sound, Antarctica | MKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103735_10339382 | 3300008932 | Ice Edge, Mcmurdo Sound, Antarctica | MKENKEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0103736_10065344 | 3300008933 | Ice Edge, Mcmurdo Sound, Antarctica | CKLINVQASMKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103737_10094021 | 3300008934 | Ice Edge, Mcmurdo Sound, Antarctica | MNVVASMKDNNEKIFDEHKISLLTKAPPKDTAALDKRSVFAKVNSQGSGT* |
| Ga0103737_10219651 | 3300008934 | Ice Edge, Mcmurdo Sound, Antarctica | MKENNENKIKNEDEISKLIKAFPKDTAALDNRSVLAKVNS |
| Ga0103737_10390301 | 3300008934 | Ice Edge, Mcmurdo Sound, Antarctica | MKEINEKNIPDEHEISKHTKAPPKETAALDKRSVLANVNSIGSGT* |
| Ga0103740_10075602 | 3300008937 | Ice Edge, Mcmurdo Sound, Antarctica | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0115650_11680712 | 3300008954 | Marine | MKENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAK |
| Ga0103502_101403353 | 3300008998 | Marine | VINTEIKNEDETSKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0102813_11183891 | 3300009003 | Estuarine | MKENKEKTSKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0105105_101869721 | 3300009009 | Freshwater Sediment | VKENNVKKIKYEDEISKDIKEFPKDIAALDKRSVLVKVN* |
| Ga0103708_1000398103 | 3300009028 | Ocean Water | MKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0102826_11797991 | 3300009054 | Estuarine | MNSQASMKENNEKKIKYCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0102905_10184133 | 3300009055 | Estuarine | MNSQASMKENNEKKIKYCDEISKLIKAFPKDIAALDNRSVLAKVNS |
| Ga0102830_11686671 | 3300009059 | Estuarine | KKIKNCDEISKLIKAFPKDIAPLDKRSVLAKVNSQGSGR* |
| Ga0114973_104315591 | 3300009068 | Freshwater Lake | MKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0115550_13105531 | 3300009076 | Pelagic Marine | SMKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0102815_100853942 | 3300009080 | Estuarine | MKENKEKKIKNCDEISKLIKAFPRDIAPLDKRSVLAKVNSQGSGR* |
| Ga0105103_105785161 | 3300009085 | Freshwater Sediment | MEENKEKKIKNCDEISKLIKAFPKDIAPLDKRSVLAK |
| Ga0102812_105416511 | 3300009086 | Estuarine | INVQASMKEKNEKKIKNCDEISKLMKEFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0117901_12631261 | 3300009103 | Marine | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGQ* |
| Ga0114918_104026411 | 3300009149 | Deep Subsurface | MKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0105100_107298581 | 3300009166 | Freshwater Sediment | INVQASMKENKEKKIKNCDEISKLIKAFPKDIAPLDKRSVLVKVN* |
| Ga0105097_101167492 | 3300009169 | Freshwater Sediment | MKENNEKKMNNEDEISKLIKAFPKDIAALDKRSVFAKVNSQGSGT* |
| Ga0114995_100487292 | 3300009172 | Marine | MKENNEKKIKNEDEISKLIKAFPKDIAAFDKSNVLAKVNSQGSGQ* |
| Ga0114972_103851531 | 3300009187 | Freshwater Lake | PSMKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0103842_10081141 | 3300009216 | River Water | MKENNEKKINNEHEISKLIKAFPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103842_10472561 | 3300009216 | River Water | MNVQACMKDNNEKIFDEQQISLLTKAPPKDTAALDKRSVL |
| Ga0103849_10515251 | 3300009221 | River Water | MKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKDNSQGSGT* |
| Ga0103857_100503041 | 3300009235 | River Water | MKEKNEKKIRNCDEISKLINEPPKDTAALDRRRVLAKVNSQGSGR* |
| Ga0103861_100310502 | 3300009247 | River Water | MKEKNEKKIRNCDEISKLTKEPPKDTAALDKRRVLAKVNSQGSGR* |
| Ga0103867_10285791 | 3300009254 | River Water | MKENNENEISNCDEISKLTNAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0103873_10176031 | 3300009265 | Surface Ocean Water | MKENNEKNIKKEDEISKLIKAPPKDTAALDKRSVLAKVNSQASGT* |
| Ga0103873_10212812 | 3300009265 | Surface Ocean Water | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSEK* |
| Ga0103874_10004601 | 3300009268 | Surface Ocean Water | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVSSKGSGR* |
| Ga0103874_10033672 | 3300009268 | Surface Ocean Water | MKEKRQKKITNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103874_10078313 | 3300009268 | Surface Ocean Water | MNVQACMKDNNEKIFDEQQISLLTKAPPKDTAALDKRSVLAKANSKGSGRYK |
| Ga0103874_10282801 | 3300009268 | Surface Ocean Water | MKENDEKKIWNCTEISILTKAPPKDTAALDKRSVLANVNSQGSGR* |
| Ga0103876_10475281 | 3300009269 | Surface Ocean Water | MKENNENKTKKEDEISKLTKAPPKDTAALDKRSVLAKVNSHGSGT* |
| Ga0103878_10044922 | 3300009274 | Surface Ocean Water | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLAKVNSKGSGR* |
| Ga0103878_10105831 | 3300009274 | Surface Ocean Water | MKENNEKKIINCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103879_100013073 | 3300009276 | Surface Ocean Water | MKEKYEKKIKNEDEISKLTNAPPRDTAALDKRSVLAKG* |
| Ga0103879_100068931 | 3300009276 | Surface Ocean Water | MKEINEKKIPDEHEISKLTKAPPKDTAALDKRSVLANVNSIGSGR* |
| Ga0103879_100353201 | 3300009276 | Surface Ocean Water | ASMKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103880_100024282 | 3300009279 | Surface Ocean Water | MKENNENKTKKEDEISKLTNAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103880_100050131 | 3300009279 | Surface Ocean Water | MKEKYEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSGR* |
| Ga0103824_1030012 | 3300009331 | River Water | MKENNEKKIKNEDEISIITKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103826_1068611 | 3300009338 | River Water | MKENKEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGI* |
| Ga0103838_10023102 | 3300009340 | River Water | MKENNEKKIKKEDEISKLIKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103836_10065281 | 3300009341 | River Water | MKEINENNIPDEHEISKDTNAPPKDTAALDKRSVLANVNSTGSGI* |
| Ga0103786_10037722 | 3300009348 | Microbial Mats | MKENNEKKIKNGEEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103827_10031872 | 3300009357 | River Water | MKENNENKTKKEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0103852_10127741 | 3300009385 | River Water | VNENNEKNIRNDDEISKLTNAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103871_10135711 | 3300009387 | River Water | MKENNENEISNCDEISKLTNAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0103742_10321571 | 3300009402 | Ice Edge, Mcmurdo Sound, Antarctica | MKENNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0103853_10169941 | 3300009404 | River Water | MKENNEKRTKNSDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0115005_102706832 | 3300009432 | Marine | MKEINEKNILDEHEISKHIKASPKEIAALDKRSVLANVNSIGSGT* |
| Ga0115005_111921872 | 3300009432 | Marine | MKEKEKKKIKNEDEISKLMKAFPKDIAALDKRSVLAKV |
| Ga0115005_112773081 | 3300009432 | Marine | MKEINEKKILDEHEISKLIKASPKDIAALDKRSVLANVNSIGS |
| Ga0115546_11045751 | 3300009435 | Pelagic Marine | NEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0115008_102913652 | 3300009436 | Marine | MKENNEKKIKDEDEISKLTKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0115008_104246131 | 3300009436 | Marine | KNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0115008_109599443 | 3300009436 | Marine | MKENNEKKIINCDEISKLIKAFPKDIAALDKRNVLAKVSSQGSGR* |
| Ga0115008_110804051 | 3300009436 | Marine | EKKIKNENEISKLIKAFPKDIAALDKRSVLAKVNAA* |
| Ga0115008_113173041 | 3300009436 | Marine | NEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0115008_114760812 | 3300009436 | Marine | MKENNEKKNKNEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0115008_116112021 | 3300009436 | Marine | MKENNEKKIINCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0115559_13018011 | 3300009438 | Pelagic Marine | KKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT* |
| Ga0115007_103362961 | 3300009441 | Marine | MKDNNEKKIIICDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0115007_105314131 | 3300009441 | Marine | MKENNEKKILDEDEISKLIKAFPKDIAALDKRSVLA |
| Ga0115560_10733841 | 3300009447 | Pelagic Marine | MKENNEKKIKKEDEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT* |
| Ga0127391_10541783 | 3300009450 | Meromictic Pond | MKENKENKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0115570_101000442 | 3300009496 | Pelagic Marine | LEFFFSGAINMKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT* |
| Ga0115570_102938822 | 3300009496 | Pelagic Marine | LEFFFSGAINMKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0115572_103612151 | 3300009507 | Pelagic Marine | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAK |
| Ga0115572_104777091 | 3300009507 | Pelagic Marine | IKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0115003_102178621 | 3300009512 | Marine | INVQASMKEINEKKILDEHEISKLIKASPKDIAALDKRSVLANVNSIGSGT* |
| Ga0115003_104096471 | 3300009512 | Marine | MKENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0115004_103563011 | 3300009526 | Marine | EDEICKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0115099_107418711 | 3300009543 | Marine | VQPKRKENNENKIKTDNEISKLIKAPPKDTAVLDKRSVFAKVNSHGSGI* |
| Ga0115099_108884302 | 3300009543 | Marine | MKENNEKKIINCEEISKLIKALPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0115006_113952581 | 3300009544 | Marine | MKENNEKQMKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0115006_114453681 | 3300009544 | Marine | MKENNEKKIKNEDEISKLTKAFPKDIAALDKRTVLAKVNSQGSGR* |
| Ga0115006_116690082 | 3300009544 | Marine | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0115013_103986392 | 3300009550 | Marine | MKVINEKNILDEHEISKHIKASPKDIAALDKRSVLANVNSIGSGT* |
| Ga0115013_106276191 | 3300009550 | Marine | MKFHQAKKKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNS |
| Ga0115013_108322462 | 3300009550 | Marine | MKEINENNILDEHEISKDIKASPKDIAALDKRSVLANVNSMGSGT* |
| Ga0115011_102386561 | 3300009593 | Marine | MKEINENNILDEHEISKDINASPKDIAALDKRSVLANVNSMGSGI* |
| Ga0115011_103142502 | 3300009593 | Marine | MKEINEKNILDEHEISKHIKASPKDIAALDKRSVLANVNSIGSGT* |
| Ga0115011_115936381 | 3300009593 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQASGT* |
| Ga0115011_117104981 | 3300009593 | Marine | MKENNEKKKKNEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0115011_117570712 | 3300009593 | Marine | MKENNEKKIRNCEEISKLIKAFPKDIAAFDKSNVLAKVNSQGSGR* |
| Ga0115103_12220781 | 3300009599 | Marine | NNEKKTNNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGA* |
| Ga0115102_109578911 | 3300009606 | Marine | KEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0115100_108045101 | 3300009608 | Marine | ASMKENNEKKIINCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0116109_11501981 | 3300009627 | Peatland | MKEKEEKKMENCDEISKLIKAFPKDIAALDKRRVLVKVNSQGSGR* |
| Ga0115104_113056011 | 3300009677 | Marine | MKENNEKKIENCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0115105_100241052 | 3300009679 | Marine | MKENKEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0115105_105024601 | 3300009679 | Marine | VQASMKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVFAKVNSQGSGT* |
| Ga0115105_113687831 | 3300009679 | Marine | NEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0123359_1598792 | 3300009730 | Marine | MKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLAKVNS |
| Ga0123363_10415092 | 3300009747 | Marine | MKENNEKKMKYEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0123360_10609291 | 3300009753 | Marine | KENNEKKIKKEDEISKLIKAPPKDTAALDKRSVFEKVNSEGSGR* |
| Ga0123360_11316941 | 3300009753 | Marine | PASMKENNEKKIKKEDDISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0123364_11062062 | 3300009754 | Marine | MKENNEKKIPDEDEISKLTKAPPKDTAALDKRSVLAKV |
| Ga0123367_12085291 | 3300009757 | Marine | ASMKENNEKKIKNCDEISKLIKAPPKDTAALDKRSVFEKVNSQGSGT* |
| Ga0115001_108382801 | 3300009785 | Marine | MKENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVN |
| Ga0115012_107478851 | 3300009790 | Marine | MKEINENNILDEHEISKDINASPKDIAALDKRSVLANVNSMGSGT* |
| Ga0115012_109531982 | 3300009790 | Marine | MKENNENKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0115012_109870102 | 3300009790 | Marine | EDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0132176_1026881 | 3300009843 | Meromictic Pond | MKENNENKIQKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0132187_1039762 | 3300009863 | Meromictic Pond | MNENKIQKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0116204_11904251 | 3300010293 | Anoxic Lake Water | MAGGFLCYTIENCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0129322_10889251 | 3300010306 | Aqueous | MKENNENKTQKEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0129322_11034721 | 3300010306 | Aqueous | VQPSMKENNEKKMKYEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0102890_10606062 | 3300010309 | Estuarine | MKENNEKKIKNCDEISKLMKEFPKDIAALDKRRVLAKVNSQGSGR* |
| Ga0136644_102595342 | 3300010334 | Freshwater Lake | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVKSQGSGR* |
| Ga0129333_109423811 | 3300010354 | Freshwater To Marine Saline Gradient | MKEKNEKKIENCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0129323_10818971 | 3300010404 | Aqueous | MKENNEKKMRYEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0133547_107586012 | 3300010883 | Marine | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNS |
| Ga0133547_117476031 | 3300010883 | Marine | NEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0138316_113897122 | 3300010981 | Marine | MKENNEKKIKNEHEISKLIKAFPKDTAELDKRSVLAKVNSQGSGT* |
| Ga0138326_108981631 | 3300010985 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQRSGT* |
| Ga0138324_102203471 | 3300010987 | Marine | MKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0114922_102188493 | 3300011118 | Deep Subsurface | MKENNEKKIKNEDVISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0151668_10695511 | 3300011262 | Marine | NVQAKMKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR* |
| Ga0138265_11012941 | 3300012408 | Polar Marine | EKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0138258_15824201 | 3300012413 | Polar Marine | EHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI* |
| Ga0138260_101330141 | 3300012419 | Polar Marine | MKENNEKKIKKEDEISKLIKAFPKDTAALDKRSVLAKVNSQGSGT |
| Ga0129350_10858621 | 3300012523 | Aqueous | KKEDEISKLIKAPPKDTAALDKRSVLAKVNSQGSGT* |
| Ga0129353_19445301 | 3300012525 | Aqueous | SMKEINEKNIPDEHEIAKHTKAPPKDTAALDKRSVLANVNSIGSGT* |
| Ga0157543_11634141 | 3300012687 | Freshwater | MKENNEKKRRNCDEISNLIKAFPKDIAALDKRSVLAKVKS |
| Ga0157593_11702961 | 3300012699 | Freshwater | MKENNEKRTRNSDEVSKLTKAPPKDTAALDKRSVLAKVNSQGSGR* |
| Ga0157550_11241631 | 3300012710 | Freshwater | MRDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0157557_10104062 | 3300012718 | Freshwater | MKENNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVKSQGSGR* |
| Ga0157552_11673011 | 3300012728 | Freshwater | MKENNEKKIRNCDEISKLIKAFPKDTAALDKRSVLAKVVGL* |
| Ga0157529_1555181 | 3300012741 | Freshwater | MKENNEKKMRDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0157556_1778202 | 3300012746 | Freshwater | MKENNEKKIRNCDEISKLIKAFPKDIAALDKRSVLAKVKSQGSGR* |
| Ga0157629_10862911 | 3300012752 | Freshwater | MKENNEKKIKNCDEISKLTKAPPKDTAALDKRIVLAKVNSQGSGR* |
| Ga0138288_10015161 | 3300012761 | Freshwater Lake | NSDEISKLTKAPPKDTAALDKRSVLAKDNSQGSGT* |
| Ga0138282_10775562 | 3300012766 | Freshwater Lake | MRKRDKKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT* |
| Ga0138280_10461571 | 3300012775 | Freshwater Lake | MKENNEKKMKDEDEISKLIKAFPKDIAALEKRSVLANVNSQGSGT* |
| Ga0138257_13586901 | 3300012935 | Polar Marine | QASMKENNEKKIPDEDEISKLTKAPPKDTAALDKKSVLAKFNLQGSGT* |
| Ga0163108_110924932 | 3300012950 | Seawater | MKENNEKKIKKDDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0163179_108147881 | 3300012953 | Seawater | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0163179_110299252 | 3300012953 | Seawater | MKENNEKKMKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGS |
| Ga0163111_102111961 | 3300012954 | Surface Seawater | MKENNEKKIKKEDEISKLIKAFPKDIAALDKRNVLAKVNSQGSGR* |
| Ga0163111_105267782 | 3300012954 | Surface Seawater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVFEKVNSEGSGR* |
| Ga0163111_106352391 | 3300012954 | Surface Seawater | KNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0129327_102198751 | 3300013010 | Freshwater To Marine Saline Gradient | MKENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT* |
| Ga0164295_107934072 | 3300013014 | Freshwater | MKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDN |
| Ga0180039_11511801 | 3300016688 | Freshwater | MKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0180040_11216402 | 3300016692 | Freshwater | MKENNEKKMRDEDEISKLTKAPPKDTAALDKRSVLAKDNSQGSGT |
| Ga0186461_1091201 | 3300016720 | Host-Associated | MKENNEKKNKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQ |
| Ga0186525_10129651 | 3300017329 | Host-Associated | MKENNEKKIKYCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0186459_10475602 | 3300017495 | Host-Associated | MKENNEKKNKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0181398_11279731 | 3300017725 | Seawater | KENNDKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNS |
| Ga0181407_10280661 | 3300017753 | Seawater | MKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGI |
| Ga0180437_107303081 | 3300017963 | Hypersaline Lake Sediment | MKKSDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0180436_107012711 | 3300017990 | Hypersaline Lake Sediment | MKVKHRLLTPPSMKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0193224_102841 | 3300018498 | Marine | MKEKYEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSGR |
| Ga0192960_1025431 | 3300018515 | Marine | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLAKVNSKGSGR |
| Ga0193100_1012433 | 3300018526 | Marine | MKENNEMKIWNCDEISKLTKATPKDTAALDKRSVFAKVNSHGSGR |
| Ga0193100_1014511 | 3300018526 | Marine | MKENNEKNIKNEDENSKLTKAPPKDTAALDKRSVFAKVNSHGSGT |
| Ga0188861_10012473 | 3300018563 | Freshwater Lake | MKENNEKKVKNSKENSKLIKAFPKHIAALDKRSVLAKVNSKGSGR |
| Ga0188858_1061921 | 3300018567 | Freshwater Lake | MKEKYEKKDKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0193223_10080442 | 3300018583 | Marine | MKENNEKKERNSKESSKLTKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0193223_10100381 | 3300018583 | Marine | MKEKYEKKVKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0193141_10153191 | 3300018588 | Marine | MKEMKKKKIKNGDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193113_10184281 | 3300018592 | Marine | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSEK |
| Ga0192881_10241412 | 3300018603 | Marine | LINVQASMKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0193447_10092482 | 3300018604 | Marine | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSGR |
| Ga0193447_10235781 | 3300018604 | Marine | NEKKKKNEDEISKDTKAPPKDTAALDKRSVLPKVNSQGSGT |
| Ga0193064_10225991 | 3300018616 | Marine | KIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0193445_10318002 | 3300018648 | Marine | CKLINVQASMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0192848_10200551 | 3300018662 | Marine | CKLINVQASMKENKEKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193229_10034341 | 3300018673 | Marine | MKENNEKKERNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSGR |
| Ga0193166_10175792 | 3300018674 | Marine | ICKLINVQASMKEINEKKIPDEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193137_10640742 | 3300018676 | Marine | NCDEISKLTKAPPKDTAALDKRSVFEKVNSQGSGR |
| Ga0192952_10023331 | 3300018683 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQRSGT |
| Ga0192952_10120391 | 3300018683 | Marine | NCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0192944_10482901 | 3300018692 | Marine | MKENNEKKIKKEDEISKLIKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0193195_10424412 | 3300018699 | Marine | NVQASMKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVLEKVNSQGSGR |
| Ga0193069_10247741 | 3300018711 | Marine | SMKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193069_10525282 | 3300018711 | Marine | MKENNEKEIKNGDEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0192887_10306051 | 3300018713 | Marine | MKENNEKKIKNCDEISKLIKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193596_10603491 | 3300018719 | Soil | CMKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193038_10676671 | 3300018723 | Marine | SMKENNEKKIKNCDEISKLIKAFPKDTAALDKRSVLAKVNSEGSGR |
| Ga0193517_10755262 | 3300018725 | Marine | MKEINEKNIPDEHEISKHTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0193534_10260352 | 3300018741 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0193478_10343051 | 3300018769 | Marine | MKENNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0193478_10690302 | 3300018769 | Marine | MNEDNEDKIINCNEISKLTNAPPKDTAALDKRSVFEKVNSHGSGR |
| Ga0192839_10475591 | 3300018777 | Marine | QASMKENNEKKIKNCEEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193422_10844081 | 3300018810 | Marine | MKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLANVNSIGSGT |
| Ga0192872_10544101 | 3300018813 | Marine | MKENNEKKVKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0193172_10917272 | 3300018820 | Marine | MKENNEKKVKNSKESSKLTKAPPKQTAALDKRSVLANVISKGSGR |
| Ga0194240_10318431 | 3300018832 | Marine | SMKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVFAKVNSQGSGT |
| Ga0193226_10563722 | 3300018835 | Marine | MKENNEKKIKKIQEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193312_10283563 | 3300018844 | Marine | MKENIEKKKKNEDEISKDTKAPPNDTAALDKRIVLPNDNSQGSGT |
| Ga0193312_10492701 | 3300018844 | Marine | CKLINVQASMKENNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193312_10590291 | 3300018844 | Marine | MKEINEKNIPDEHEISKHTKAPPKDTAALDKRSVLANVNSIGSGR |
| Ga0193042_10990192 | 3300018845 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQRSGI |
| Ga0193253_10104621 | 3300018846 | Marine | MKENNEKKIKNEDEISILIKAFPKDIAAXDKRSVLAKVNSQGSGT |
| Ga0193214_10359442 | 3300018854 | Marine | MKEKYEKKVKNSKENSKLIKAFPKHIAALDKRSVLAKVNSKGSGR |
| Ga0193475_10667971 | 3300018855 | Marine | MKENNENNIVNEEDISKLIKAPPKDTAALDNKSVLAKVNSQGSGT |
| Ga0193165_100536372 | 3300018869 | Marine | MKENNEKKINNCDEISKLTKAPPKDTAALVKRSVLAKVNSQGSGR |
| Ga0193608_11437311 | 3300018875 | Soil | EKEKENGNEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193337_10367841 | 3300018880 | Marine | MKENNEKKIKNEEEISKLTKAPPKDTAALDKRSVLAKVN |
| Ga0192908_100269931 | 3300018881 | Marine | MNENNEKKIKNEDEISKLTKAPPKETAAILKRSVFAKVNSQGSGA |
| Ga0193471_11074122 | 3300018882 | Marine | MKENNEKKDKNSKENSKLIKAFPKHTAALDKRSVLAKVNSKGSGR |
| Ga0193203_101175802 | 3300018901 | Marine | MNANNEKKIKNCHEISKLINAPHKDTAALDKRSVLEKVNSNGDGK |
| Ga0192874_100079721 | 3300018904 | Marine | MKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193176_102358681 | 3300018912 | Marine | MKENNEKKINNCDEISKLTKAPPKDTAALDKRSVLAKV |
| Ga0193260_100619991 | 3300018928 | Marine | MKDNNENKIKNEDEISKLIKAFPKDIAAXDKRSVLAKVNSQGSGT |
| Ga0192955_101616441 | 3300018930 | Marine | KLINVQASMKENKEKKIRSCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193552_102056581 | 3300018934 | Marine | ENNEKNIKNEDENSKLIKAPPKDTAALDKRSVFAKVNSHGSGT |
| Ga0193426_100185311 | 3300018942 | Marine | GTKENNEKKIINEEEISKLTKAPPNATAALDNRSVFAKVSSVGSGT |
| Ga0192930_100738774 | 3300018960 | Marine | MKENNEMKIWNCDEISKLIKAIPKDIAALDKRSVFAKVN |
| Ga0193293_100849931 | 3300018966 | Marine | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVFAKVNSQGSGT |
| Ga0193293_101009501 | 3300018966 | Marine | MKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVFAKVNSHGSGT |
| Ga0192894_101272681 | 3300018968 | Marine | MKENNEKKIKNGDEISKLTKAPPKDTAALDKRSVLAK |
| Ga0192894_102706621 | 3300018968 | Marine | MKENNEKNIKNEDENSKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0192894_103426451 | 3300018968 | Marine | MNEINENNIPDEHEISKETKAPPKDTAALDKRRVLANVNSTGSGI |
| Ga0193143_100823702 | 3300018969 | Marine | MNANNEKKIKNCDEISKLTNAPHKDTAALDKRSVLAKVNSNGDGR |
| Ga0193143_101782961 | 3300018969 | Marine | LLLENEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0193540_100689531 | 3300018979 | Marine | MKENNEKKVKNSKESSKLIKAFPKHIAALDKRSVLANVNSKGSEK |
| Ga0193540_100838951 | 3300018979 | Marine | MKENNEKKIKNEHEISKLTKAPPKDIAALDKRSVLAKVNSQGSGI |
| Ga0193540_100838971 | 3300018979 | Marine | MKENNEKKIKNEHEISKLTKAPPKDIAALDKRSVLAKVNSQGSGT |
| Ga0193540_101510251 | 3300018979 | Marine | MKENNEKKVKNSKESSKLIKAFPKHTAALDKRSVLANVNSKGSEK |
| Ga0193540_101674181 | 3300018979 | Marine | MKENNEKKIKNEDEISKLTKAPPKDTAALVNRSVLAKVNSQGSGT |
| Ga0193540_101831591 | 3300018979 | Marine | MKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSE |
| Ga0193540_102086581 | 3300018979 | Marine | KLINVQASMKENNEKKIIACDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0192968_101031281 | 3300018981 | Marine | MKGKKVKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0193554_100830351 | 3300018986 | Marine | MKENNEKKIKNEHEISKLIKAPPKDTAALDKRSVLAKVNS |
| Ga0193554_101168811 | 3300018986 | Marine | MKENIEKKKKNEDEISKLTKAPPNDTAALDKRIVLPNDNSQGSGR |
| Ga0193554_101840692 | 3300018986 | Marine | MKENNEKKINNDKEISKLTKAPPNDTAALDKRSVLAKVN |
| Ga0193030_101368571 | 3300018989 | Marine | MKENNEKKVKNSKESSKLTKAFPKHTAALDKRSVLANVNSKGSE |
| Ga0193030_102294581 | 3300018989 | Marine | MKENNEKKIKKDDEISKLIKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0192932_102057021 | 3300018991 | Marine | MKENNEKKIWNCDEISKLIKAFPKDIAALDKRSVFAKVNSQGSGR |
| Ga0193430_100195221 | 3300018995 | Marine | MKENNEKKVKNSKENSKLTKAFPKQTAALDKRSVLANVISKGSGR |
| Ga0192916_101776381 | 3300018996 | Marine | MKENNEKKGKNSKESSKLTKAPPKQTAALDKRSVLANVISKGSGR |
| Ga0193444_100236161 | 3300018998 | Marine | ASMKENNEKKIKNCDEISKLIKAFPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193444_101371581 | 3300018998 | Marine | KNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193444_101702801 | 3300018998 | Marine | MKENNEKKINNCDEISKLTNAPPKDTAALDKRSVLAKV |
| Ga0192953_100521851 | 3300019000 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0192953_100923971 | 3300019000 | Marine | MKENKEKKINNCDEISKLIIAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193034_101921662 | 3300019001 | Marine | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI |
| Ga0193033_102284301 | 3300019003 | Marine | KENNENKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0193196_102304791 | 3300019007 | Marine | EKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0192880_101625851 | 3300019009 | Marine | NNEKKIKKEDEISKLIKAFPKDIAALDKRSVFPKVNSQGSGT |
| Ga0193044_100922111 | 3300019010 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0193044_101725831 | 3300019010 | Marine | CKLINVQASMKENKEKKMKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0193044_101757422 | 3300019010 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQRSGI |
| Ga0193044_102315771 | 3300019010 | Marine | MKENKEKKINNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193043_100963053 | 3300019012 | Marine | LICKLINVQACMKENNEKKVKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0193043_102893301 | 3300019012 | Marine | MKENKEKKINNCDEISKLIKAFPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193538_100688841 | 3300019020 | Marine | VQACMKENNEKKVKNSKESSKLTKAPPKHTAALDKRSVLANVNSKGSGR |
| Ga0192951_100716361 | 3300019022 | Marine | MKENNEKKINNEHEISKLIKAFPKDIAALDKRNVLAKVNSQGSGR |
| Ga0192951_103251331 | 3300019022 | Marine | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGI |
| Ga0193535_100797063 | 3300019024 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKV |
| Ga0192869_104007971 | 3300019032 | Marine | KLINVQASMKEINEKNIPDEHEISKHIKAPPKDIAALDKRSVLANVNSNGSGT |
| Ga0192886_101117431 | 3300019037 | Marine | MKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAK |
| Ga0193123_103627782 | 3300019039 | Marine | MKEINEKNIPDEHEISKHTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193123_104485402 | 3300019039 | Marine | MKEINEKNIPDEHEISKHIKAPPKDTAALDKRSVLANVNSQGSGR |
| Ga0193336_101633601 | 3300019045 | Marine | MKENNEKKIQDEDEISKLTKAPPRDTAALDKRSVLAKVNSQG |
| Ga0192981_100391961 | 3300019048 | Marine | MKENNEKKINNEHEISKLIKAFPKDTAALDKRSVLAKVNSQGSG |
| Ga0192981_103434461 | 3300019048 | Marine | MKENNEKKIKKEDEISKETKAPPKDTAALDRRSVFAKVNSQGSGK |
| Ga0192981_103619202 | 3300019048 | Marine | FDEHKISLLTKAPPKDTAALDKRSVFAKVNSQGSGT |
| Ga0193082_102925912 | 3300019049 | Marine | MKENNEEKINNEDEISKLTKAPPKDTAALDKRSVFAKVNSHGSGT |
| Ga0192826_103111681 | 3300019051 | Marine | MKENNEKKILSANEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0193208_107044061 | 3300019055 | Marine | SMKENKEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSHGSGR |
| Ga0193208_107398742 | 3300019055 | Marine | MKENNEKKIKNCDEISKLTKAPPKDTAALDKRSVFAKVNSQGSGR |
| Ga0193129_10175391 | 3300019088 | Marine | MKEMKKKKIKNCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193153_10239882 | 3300019097 | Marine | LINVQASMKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0193102_10296661 | 3300019099 | Marine | KENNEKKIKNCDEISKLTKAPPKDTAALDKRSVFAKVNSHGSGT |
| Ga0192980_10812211 | 3300019123 | Marine | MKENNEKKIKKEDEICKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0193144_10010211 | 3300019126 | Marine | MKENNENKIKKEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0193089_10645271 | 3300019133 | Marine | MKENNEKKIKNEDEISILTKAPPKDTAAXDKRSVLAKVNSQGSGT |
| Ga0193112_10517922 | 3300019136 | Marine | MKENNEKKINNDKEISKLMKAFPNDIAALDKRSVLAKVN |
| Ga0193047_10311291 | 3300019139 | Marine | MKENNEKKIINCEEISKLTKAPPKDTAALDKRSVLAKVNSQ |
| Ga0192856_10523791 | 3300019143 | Marine | VQANMKENNEKKGKNSKESSKLTKAPPKQTAALDKRSVLANVISKGSGR |
| Ga0193453_10111394 | 3300019147 | Marine | MKEKNEKKIRNCDEISKLTKAPPKDTAALDKRSVLAKVNSHGSGI |
| Ga0180033_1733712 | 3300019198 | Estuarine | VQASMKENNEKKIKNCEEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0193998_10396331 | 3300019744 | Sediment | MNSQASMKENNEKKIKYCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0206352_100782101 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | RNEDEISKLTKAPPKDTAALDKRSVLAKVNSEGSGT |
| Ga0211735_103636382 | 3300020162 | Freshwater | MKENNKKKTNNCKEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0206125_102914992 | 3300020165 | Seawater | MKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQG |
| Ga0206125_103364411 | 3300020165 | Seawater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0211708_104208221 | 3300020436 | Marine | NVQANMKENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0211694_105068171 | 3300020464 | Marine | EKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0208360_10240281 | 3300020551 | Freshwater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR |
| Ga0206126_104298201 | 3300020595 | Seawater | MSSSLEFFFSGAINMKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT |
| Ga0214190_10262481 | 3300020695 | Freshwater | MKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT |
| Ga0206694_10234672 | 3300021291 | Seawater | MKENNEKKIENCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSG |
| Ga0206691_14120821 | 3300021342 | Seawater | MKEINEKNIPDEHEISKHIKASPKDTAALDKRSVLAKVNSQGSGA |
| Ga0206689_108470881 | 3300021359 | Seawater | IKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0063089_10515261 | 3300021889 | Marine | INVQASMKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0063089_10714331 | 3300021889 | Marine | KVQACMKEKYEKKDKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0063104_11040421 | 3300021913 | Marine | ASMKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT |
| Ga0210310_10227261 | 3300022369 | Estuarine | TGMKENNEKNIKKEDEISKLIKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0210311_10185021 | 3300022374 | Estuarine | MKDNNENKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0214921_104406821 | 3300023174 | Freshwater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVKSQGSGR |
| Ga0214919_107265452 | 3300023184 | Freshwater | KMKDEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT |
| (restricted) Ga0233410_102579461 | 3300023276 | Seawater | INEDSEDKIINCNEISKLINAFPKDIAALDKRSVFEKVNSHGSGR |
| Ga0228679_10256201 | 3300023566 | Seawater | QAREKENNEKKIRNEDEISKLIKAFPKDIAALDKRSVLAKVNSQESGR |
| Ga0228695_10554021 | 3300023699 | Seawater | KENNEKKIRNEDEISKLTKAPPKDTAALDKRSVLAKVNSQESGR |
| (restricted) Ga0255051_102471031 | 3300024057 | Seawater | KMANCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| (restricted) Ga0255039_101625691 | 3300024062 | Seawater | MKENNEKKMANCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0228655_10774052 | 3300024236 | Seawater | MKENNEKKINNEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT |
| Ga0247724_10393811 | 3300024239 | Deep Subsurface Sediment | MKENKEKKIKNCDEISKLIKAFPKDIAPLDKRSVLAKVNSQGSGR |
| (restricted) Ga0233448_11039621 | 3300024299 | Seawater | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0208615_1027651 | 3300025330 | Freshwater | VQASMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0208108_10049331 | 3300025367 | Freshwater | MKENNEKKIRNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0207955_10490071 | 3300025401 | Freshwater | ENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0208741_100874901 | 3300025723 | Freshwater | MKENNEKKMKDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0255248_10216011 | 3300025742 | Freshwater | MKENNEKKMKYCDEISKLIKAFPKDIAALDKRSVLAKVN |
| Ga0208699_10356161 | 3300025776 | Deep Ocean | KENNEKKIIKEDEICKLIKAFPKDIAALDKRSVLAKVNSQGSGI |
| Ga0208873_10768021 | 3300025788 | Freshwater | KIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0208543_10072661 | 3300025810 | Aqueous | MKENNEKKIKKEDEIPKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0209714_11331191 | 3300025822 | Pelagic Marine | KIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0208917_12152691 | 3300025840 | Aqueous | KKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0209955_10208643 | 3300026123 | Water | MKEKNEKKIINCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0247606_10421771 | 3300026398 | Seawater | MNVQACMKDNNEKIFDEQQISLLTKAPPKDTAALDKRSVLAKVNSQESGR |
| Ga0247565_10371481 | 3300026406 | Seawater | QAIMKENNEKKIKNEDEISILTKAPPKDTAAXDKRSVLAKVNSQGSGT |
| Ga0247581_10697981 | 3300026420 | Seawater | REKENNEKKIRNEDEISKLTKAPPKDTAALDKRSVLEKVNSQESGR |
| Ga0247580_10445611 | 3300026423 | Seawater | VQAIMKENNEKKIKNEDEISILIKAFPKDIAAXDKRSVLAKVNSQGSGT |
| Ga0256334_11415871 | 3300026566 | Freshwater | TSMKEKNEKKIENCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0208960_10980131 | 3300027649 | Freshwater Lentic | MKVNNQIINNEHEISKLIKALPKDIAALDKRSVLANVNSQGSGT |
| Ga0209443_12132472 | 3300027707 | Freshwater Lake | KYNNVISKLIKEFPKFIAAFDKRSVLAKVNXQGSGR |
| Ga0209711_103489581 | 3300027788 | Marine | MKEINEKNILDEHEISKHIKASPKDIAALDKRSVLANVNSIGSGT |
| Ga0209107_103508881 | 3300027797 | Freshwater And Sediment | TNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR |
| Ga0209302_101529922 | 3300027810 | Marine | MKENNEKKIKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGQ |
| Ga0209302_103967291 | 3300027810 | Marine | KKIKNCNEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0209491_100858181 | 3300027832 | Freshwater | MKENNEKKMKYCDEISKLIKAFPRDIAALDKRSVLAKVN |
| Ga0209092_100673152 | 3300027833 | Marine | ENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGI |
| Ga0209092_101442461 | 3300027833 | Marine | KILNCDEISKLINVFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0209092_101465933 | 3300027833 | Marine | MKENNEKKVKNSKENSKLTKAFPKHIAALDKRSVLANVSSKGSGR |
| Ga0209092_101731992 | 3300027833 | Marine | MKENNEKKIWNCDEISKLIKAFPKDIAALDKRSVFAKVKSQESG |
| Ga0209092_104695861 | 3300027833 | Marine | MKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQ |
| Ga0209092_105388322 | 3300027833 | Marine | MKENNEKKNKNEDEISKLIKAFPKDIAALDKRSVLAKDNSQGSGT |
| Ga0209503_100379181 | 3300027859 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQRSGT |
| (restricted) Ga0233415_103908051 | 3300027861 | Seawater | MKENNEKKKKNPWDISKLIKAFPKDIAALDKRSVLAKVNSQGSG |
| Ga0209713_101312622 | 3300027883 | Marine | MKENNEKKIKNEDEISKLTKAFPKDIAALDKRTVLAKVNSQGSGR |
| Ga0209404_107625602 | 3300027906 | Marine | MKENNEKKIKNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGS |
| Ga0209079_100083061 | 3300027972 | Freshwater Sediment | VKENNVKKIKYEDEISKDIKEFPKDIAALDKRSVLVKVN |
| Ga0228674_11614322 | 3300028008 | Seawater | MKENNEKKILDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0247596_11042402 | 3300028106 | Seawater | MNENNEKKIKNEDEISKLTKAPPKETAALLKRSVFAKVNSQGSGA |
| Ga0256411_12317141 | 3300028134 | Seawater | QANMKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0228640_10716462 | 3300028273 | Seawater | VQASIKENNEKKILDEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0256413_12942711 | 3300028282 | Seawater | QASMKENNEKKIKNEDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0304731_104983432 | 3300028575 | Marine | MKENNEKKIKNEHEISKLIKAFPKDTAELDKRSVLAKVNSQGSGT |
| Ga0307402_105721652 | 3300030653 | Marine | QASMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0308131_11241631 | 3300030729 | Marine | NEKKIKNEDEISKLTKAPPRDTAALDKRSVLAKVNSQGSGT |
| Ga0075376_114744891 | 3300030968 | Soil | MKENNENKMINCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGR |
| Ga0138346_105212151 | 3300031056 | Marine | MKENNEKKIKNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGI |
| Ga0073989_100067591 | 3300031062 | Marine | ENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0138347_101322111 | 3300031113 | Marine | QVNMKENNEKKIKNEHEISKLIKAFPKDTAALDKRSVLAKVNSQRSGT |
| Ga0170822_119539641 | 3300031122 | Forest Soil | KNCEEISRLTKAPPKDTAALDSSRVLAKVSSQGSGI |
| Ga0308023_11016512 | 3300031167 | Marine | KKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0170824_1139555332 | 3300031231 | Forest Soil | MKENNEKLIKNCDEISKLTKAPPKDTAALDKRSVLANVNSQGSGR |
| Ga0307388_106939251 | 3300031522 | Marine | VQASMKENNEKKKIKEDEICKLIKAFPKDIAALDKRSILAKVNSQGSGT |
| Ga0307492_102163521 | 3300031523 | Sea-Ice Brine | MKENNEKKILNVDEISKLIKAFPKDIAAFDKRSVLAKVNSQGSGT |
| Ga0308135_10885491 | 3300031559 | Marine | KENNEKKIKNEDEISKLTKAPPRDTAALDKRSVLAKVNSQGSGI |
| Ga0308141_10871942 | 3300031571 | Marine | MKENNEKKIKKEDEISKLIKAPPKDTAALDKRSVLAKVNS |
| Ga0302114_103477761 | 3300031621 | Marine | KINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0302121_101469313 | 3300031626 | Marine | KNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0307396_106191271 | 3300031717 | Marine | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGS |
| Ga0307381_101778672 | 3300031725 | Marine | MKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0307397_104934041 | 3300031734 | Marine | RASMKENNEKKIKNEDEISKLIKAFPKDTAALDKRSVLAKVNSQGSGT |
| Ga0307383_103940992 | 3300031739 | Marine | QPSMKENNEKKIKKEDEIPKLIKAFPKDTAALDKRSVLAKVNSQGSGT |
| Ga0307383_104639471 | 3300031739 | Marine | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVFEKVNSQGS |
| Ga0307395_105343861 | 3300031742 | Marine | NEHEISKLIKAFPKDIAALDNRSVLAKVNSQGSGT |
| Ga0315331_109935602 | 3300031774 | Seawater | LIKKKASMKENNEKKINNEHEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT |
| Ga0310344_106792172 | 3300032006 | Seawater | ENNEKKIKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0315902_105925841 | 3300032093 | Freshwater | NMKENKEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0073946_10440671 | 3300032153 | Marine | MKENNEKKIKKEDEIPKLIKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0314688_104870321 | 3300032517 | Seawater | MKENNENKIKNCDEISKLIKAFPKDIAALDKRSVLAKVN |
| Ga0314676_108319842 | 3300032519 | Seawater | MKENNEKKVKNSKESSKLIKAFPKHTAALDKRSVLAKVNSHGSGI |
| Ga0314680_110195561 | 3300032521 | Seawater | INVQACMKEKYEKKDKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0314685_103154071 | 3300032651 | Seawater | QASMKENNEKKIKNCDEISKLIKAFPKDTAALDKRSVFEKVNSQGSGT |
| Ga0314687_102110291 | 3300032707 | Seawater | NCDEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT |
| Ga0314687_104779991 | 3300032707 | Seawater | CQQTTNTTAIKDNKQKTEKNTQQKSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0314681_106480181 | 3300032711 | Seawater | ASMKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVFEKVNSQGSGR |
| Ga0314711_106405531 | 3300032732 | Seawater | NLQVKENNEKKVKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0314710_102718281 | 3300032742 | Seawater | MKRILKKEDEISKLIKAFPKDTAALDKRSVLAKVNSQGSGT |
| Ga0314707_101366641 | 3300032743 | Seawater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVFEKVNSQGSGR |
| Ga0314713_105112991 | 3300032748 | Seawater | MKENNEKKVKNSKESSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0314708_102833691 | 3300032750 | Seawater | RDRIQGIXRENLQVKENNEKKVKNSKENSKLIKAFPKHIAALDKRSVLANVNSKGSGR |
| Ga0314709_108082502 | 3300032755 | Seawater | MSKLVXKRIMKRKSKKEDEISKLIKAFPKDIAALDKRSVLAKVNSQASGT |
| Ga0310342_1002667162 | 3300032820 | Seawater | MKNENEISNDIKAFPKDIAALDKRSVFVKVNSQGSGT |
| Ga0316616_1037726951 | 3300033521 | Soil | MKEKNEKKIENCDEISKLIKAFPKDIAALDKRSVLAKVNSQ |
| Ga0334978_0319931_526_660 | 3300033979 | Freshwater | LKENSCLVTNCDEISKLIKAFPKDIAALDKRIVLAKVNSQGSGR |
| Ga0334981_0199851_333_467 | 3300033980 | Freshwater | LAKKQRDIRNDLEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334909_044004_154_291 | 3300033988 | Soil | MKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334922_002649_501_665 | 3300034003 | Hypolithic Biocrust | MESSPMMACMKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334998_0294853_427_552 | 3300034019 | Freshwater | MNQIINKKNEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334998_0647608_442_567 | 3300034019 | Freshwater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRSVLAKVNSQG |
| Ga0335004_0338105_748_873 | 3300034021 | Freshwater | MKENNEKKIKNCDEISKLIKAFPKDIAALDKRIVLAKVNSQG |
| Ga0334927_048409_950_1087 | 3300034024 | Hypolithic Biocrust | MKENNEKEKENGNEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334954_079380_1_123 | 3300034032 | Biocrust | MDRSLVNRMKENNEKKMENCDEISKLIKAFPKDIAALDKRS |
| Ga0334954_086858_2_121 | 3300034032 | Biocrust | MKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVNS |
| Ga0335053_0773516_3_137 | 3300034118 | Freshwater | KENKEKKIKNCDEISKLIKACPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334928_096915_3_119 | 3300034134 | Hypolithic Biocrust | EKENGNEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| Ga0334955_156610_384_503 | 3300034138 | Biocrust | MKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVR |
| Ga0334917_046710_638_775 | 3300034391 | Hypolithic Biocrust | RHLERETTCNKETEISKLIKAFPKDIAALDKRSVLAKVNSQGSGR |
| ⦗Top⦘ |