


| Basic Information | |
|---|---|
| Taxon OID | 2236876022 Open in IMG/M |
| Scaffold ID | DCM3_p0013975 Open in IMG/M |
| Source Dataset Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - DCM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 534 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Bras del Port | |||||||
| Coordinates | Lat. (o) | 38.1875529 | Long. (o) | -0.6338098 | Alt. (m) | Depth (m) | 3010 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046986 | Metagenome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DCM3_00139751 | F046986 | N/A | KMSARFNISIRTGHDDYKRAMQLLREEQQGTREELLNQLQALRLATVQRALKRGHYQTVATLLGDMGRVIGEAAPEQLALQVPTLDIRIENENQSQ |
| ⦗Top⦘ |