


| Basic Information | |
|---|---|
| Family ID | F105319 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SEDILAEYIARLESEIGVTINQSALNQVVSGGAGDGAN |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF04715 | Anth_synt_I_N | 95.00 |
| PF07883 | Cupin_2 | 3.00 |
| PF00005 | ABC_tran | 1.00 |
| PF01642 | MM_CoA_mutase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 190.00 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.00 % |
| Unclassified | root | N/A | 38.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT02HA1V4 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300000732|JGI12023J11887_1005234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
| 3300000890|JGI11643J12802_10997543 | Not Available | 527 | Open in IMG/M |
| 3300001305|C688J14111_10036903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1465 | Open in IMG/M |
| 3300002155|JGI24033J26618_1015362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 945 | Open in IMG/M |
| 3300004463|Ga0063356_105090219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 565 | Open in IMG/M |
| 3300005166|Ga0066674_10031375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2350 | Open in IMG/M |
| 3300005167|Ga0066672_10932311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 535 | Open in IMG/M |
| 3300005332|Ga0066388_100031915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4975 | Open in IMG/M |
| 3300005332|Ga0066388_106707192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300005334|Ga0068869_100089786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2308 | Open in IMG/M |
| 3300005552|Ga0066701_10128575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300005552|Ga0066701_10443082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300005562|Ga0058697_10401098 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005719|Ga0068861_100027184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4165 | Open in IMG/M |
| 3300005764|Ga0066903_101153127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1434 | Open in IMG/M |
| 3300005937|Ga0081455_10458001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300006034|Ga0066656_10637190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300006353|Ga0075370_10650868 | Not Available | 639 | Open in IMG/M |
| 3300006577|Ga0074050_11882805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1260 | Open in IMG/M |
| 3300006794|Ga0066658_10590807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300006800|Ga0066660_10230274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300006844|Ga0075428_102316063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300006953|Ga0074063_13974708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300009148|Ga0105243_10543364 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1109 | Open in IMG/M |
| 3300009148|Ga0105243_12950537 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009162|Ga0075423_10712706 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300010043|Ga0126380_10516936 | Not Available | 920 | Open in IMG/M |
| 3300010321|Ga0134067_10452510 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010358|Ga0126370_10702172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300010359|Ga0126376_12163430 | Not Available | 601 | Open in IMG/M |
| 3300010361|Ga0126378_12609436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010361|Ga0126378_12712570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300010373|Ga0134128_11350757 | Not Available | 785 | Open in IMG/M |
| 3300011271|Ga0137393_10950510 | Not Available | 733 | Open in IMG/M |
| 3300012203|Ga0137399_11599053 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012204|Ga0137374_10979132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300012902|Ga0157291_10110152 | Not Available | 764 | Open in IMG/M |
| 3300012927|Ga0137416_11799790 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012929|Ga0137404_12038404 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012955|Ga0164298_11629366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300012977|Ga0134087_10185482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300012988|Ga0164306_10463005 | Not Available | 967 | Open in IMG/M |
| 3300015200|Ga0173480_10662517 | Not Available | 649 | Open in IMG/M |
| 3300015264|Ga0137403_11000839 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 683 | Open in IMG/M |
| 3300016270|Ga0182036_11761634 | Not Available | 524 | Open in IMG/M |
| 3300016341|Ga0182035_11078437 | Not Available | 714 | Open in IMG/M |
| 3300018429|Ga0190272_11518448 | Not Available | 682 | Open in IMG/M |
| 3300022886|Ga0247746_1145563 | Not Available | 602 | Open in IMG/M |
| 3300024288|Ga0179589_10274860 | Not Available | 753 | Open in IMG/M |
| 3300025898|Ga0207692_10997546 | Not Available | 553 | Open in IMG/M |
| 3300025928|Ga0207700_10451422 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1133 | Open in IMG/M |
| 3300025929|Ga0207664_10238383 | Not Available | 1583 | Open in IMG/M |
| 3300026309|Ga0209055_1063950 | Not Available | 1550 | Open in IMG/M |
| 3300026325|Ga0209152_10296767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300026334|Ga0209377_1103771 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300026551|Ga0209648_10732434 | Not Available | 540 | Open in IMG/M |
| 3300026552|Ga0209577_10153616 | Not Available | 1808 | Open in IMG/M |
| 3300027684|Ga0209626_1094562 | Not Available | 772 | Open in IMG/M |
| 3300027738|Ga0208989_10166235 | Not Available | 738 | Open in IMG/M |
| 3300027866|Ga0209813_10161235 | Not Available | 809 | Open in IMG/M |
| 3300028597|Ga0247820_11014121 | Not Available | 593 | Open in IMG/M |
| 3300028717|Ga0307298_10011614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2204 | Open in IMG/M |
| 3300028720|Ga0307317_10150762 | Not Available | 780 | Open in IMG/M |
| 3300028768|Ga0307280_10051042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300028782|Ga0307306_10048017 | Not Available | 1056 | Open in IMG/M |
| 3300028793|Ga0307299_10335459 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300028811|Ga0307292_10315276 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031544|Ga0318534_10083559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1817 | Open in IMG/M |
| 3300031549|Ga0318571_10032982 | Not Available | 1452 | Open in IMG/M |
| 3300031564|Ga0318573_10190442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1086 | Open in IMG/M |
| 3300031564|Ga0318573_10679713 | Not Available | 553 | Open in IMG/M |
| 3300031572|Ga0318515_10359334 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031668|Ga0318542_10643838 | Not Available | 553 | Open in IMG/M |
| 3300031681|Ga0318572_10032876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2710 | Open in IMG/M |
| 3300031713|Ga0318496_10349720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300031724|Ga0318500_10110834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1258 | Open in IMG/M |
| 3300031724|Ga0318500_10283772 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031740|Ga0307468_100107211 | Not Available | 1679 | Open in IMG/M |
| 3300031754|Ga0307475_11365806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031777|Ga0318543_10128610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1104 | Open in IMG/M |
| 3300031821|Ga0318567_10651142 | Not Available | 598 | Open in IMG/M |
| 3300031845|Ga0318511_10468152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031859|Ga0318527_10046989 | Not Available | 1669 | Open in IMG/M |
| 3300031879|Ga0306919_10324160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1173 | Open in IMG/M |
| 3300031880|Ga0318544_10334982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
| 3300031893|Ga0318536_10062176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1824 | Open in IMG/M |
| 3300031941|Ga0310912_11352547 | Not Available | 539 | Open in IMG/M |
| 3300031942|Ga0310916_10182808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1747 | Open in IMG/M |
| 3300031942|Ga0310916_10266510 | Not Available | 1446 | Open in IMG/M |
| 3300031947|Ga0310909_10938790 | Not Available | 709 | Open in IMG/M |
| 3300032009|Ga0318563_10089438 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300032009|Ga0318563_10396013 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300032041|Ga0318549_10020706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2485 | Open in IMG/M |
| 3300032075|Ga0310890_11562286 | Not Available | 545 | Open in IMG/M |
| 3300032091|Ga0318577_10305996 | Not Available | 760 | Open in IMG/M |
| 3300033289|Ga0310914_11106055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 693 | Open in IMG/M |
| 3300033289|Ga0310914_11543417 | Not Available | 567 | Open in IMG/M |
| 3300033290|Ga0318519_10677535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300033290|Ga0318519_10816975 | Not Available | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.00% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_02784650 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | TVETLNRGLSEAILAEYIARLESDIGLTINQSALNQVVSGGAGDGTN |
| JGI12023J11887_10052342 | 3300000732 | Forest Soil | VDSLNRSLSEDMLGEYIARLESEVGVTINQNTLNQVVSGGAVDSAN* |
| JGI11643J12802_109975431 | 3300000890 | Soil | LLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN* |
| C688J14111_100369031 | 3300001305 | Soil | GLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| JGI24033J26618_10153621 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0063356_1050902192 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LNRGISEDLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN* |
| Ga0066674_100313753 | 3300005166 | Soil | GLSEDILAEYIAWLERDIGFTINQSALNQVVSGGAGDGTN* |
| Ga0066672_109323111 | 3300005167 | Soil | AQSADSKRMIDALNRALADDIAAEYVGQLESDIGVNINQSALNQVISGGAADLN* |
| Ga0066388_1000319155 | 3300005332 | Tropical Forest Soil | EDTKRLVETLNRGLSEDVFSEYVARLENETGVTINQAALNQVITGGAATDEN* |
| Ga0066388_1067071921 | 3300005332 | Tropical Forest Soil | DVLNRGISEDLLAQYIANLQKDVGVTINQSALSQVVSGGAGTE* |
| Ga0068869_1000897861 | 3300005334 | Miscanthus Rhizosphere | RTVDTLNRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0066701_101285751 | 3300005552 | Soil | AVQTLNRGLSEDILAEYIAWLERDIGFTINQSALNQVVSGGAGDGTN* |
| Ga0066701_104430821 | 3300005552 | Soil | SEDILAEYIARLESEIGVTINQSALNQVVSGGAGDGAN* |
| Ga0058697_104010981 | 3300005562 | Agave | LETLNRGLSEDILTEYMAWLESDIGVTINQSALNQVVSGGAGDGTN* |
| Ga0068861_1000271841 | 3300005719 | Switchgrass Rhizosphere | LLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0066903_1011531271 | 3300005764 | Tropical Forest Soil | SEALLAEYIAKLESDIGVTINQSALNQVIGGGSGDGLN* |
| Ga0081455_104580012 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RTMETLNRGLSEAVLAEYIAKLESDIGVNINQSALNQVIGGGSGDGLN* |
| Ga0066656_106371902 | 3300006034 | Soil | AKRTVETLNRGLSEAILAEYIARLESEIGLTINQSALNQVVSGGAGDGAN* |
| Ga0075370_106508682 | 3300006353 | Populus Endosphere | LSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0074050_118828051 | 3300006577 | Soil | LNRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0066658_105908071 | 3300006794 | Soil | DILAEYIAWLESDIGVTINQSALNQVVSGGAGDGTN* |
| Ga0066660_102302741 | 3300006800 | Soil | DSADAKRIAETLDRGLSEALYAEYIAYLENEVGVTINQNALNQVVSGGAATE* |
| Ga0075428_1023160631 | 3300006844 | Populus Rhizosphere | NRGLSEALLSEYIAKLESEIGVTINQSALNQVIGGGSGDGLN* |
| Ga0074063_139747082 | 3300006953 | Soil | LSEDLLSEYIARLESEVGVTINQNALNQVVSGGAVDSAN* |
| Ga0105243_105433641 | 3300009148 | Miscanthus Rhizosphere | RGISEDLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN* |
| Ga0105243_129505372 | 3300009148 | Miscanthus Rhizosphere | LSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDGEN* |
| Ga0075423_107127062 | 3300009162 | Populus Rhizosphere | SEDLLTEYVAWLESDIGVTINQSALNQVVGGGAGDGSN* |
| Ga0126380_105169362 | 3300010043 | Tropical Forest Soil | LSEDILAEYIARLQSEIGVTINQSALNQVLGGGAADQ* |
| Ga0134067_104525102 | 3300010321 | Grasslands Soil | LAEYIARLESEIGLTINQSALNQVVSGGAGDGAN* |
| Ga0126370_107021721 | 3300010358 | Tropical Forest Soil | LNRGLSEAILAEYIARLESDIGLTINQSALNQVVSGGAGDGAN* |
| Ga0126376_121634302 | 3300010359 | Tropical Forest Soil | RSLSEDVFGEYVAQLENEVGVTINQSALNQVVTGGAASDEN* |
| Ga0126378_126094362 | 3300010361 | Tropical Forest Soil | RDLDALNRGVSEDILAEYIAHLESEIGVTINQNALNQVVGGGAGEGAD* |
| Ga0126378_127125702 | 3300010361 | Tropical Forest Soil | RDLDALNRGVSEDILAEYIAHLESEIGVTINQNALNQVVGGSAGEGAD* |
| Ga0134128_113507571 | 3300010373 | Terrestrial Soil | MKRTVDALNRGISEDLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN* |
| Ga0137393_109505101 | 3300011271 | Vadose Zone Soil | NDSKRTVEALNRALSEDIAGEYIGRLESEIGVTINQSALNQVISGGAGDVN* |
| Ga0137399_115990532 | 3300012203 | Vadose Zone Soil | SEDILAEYLAWLEREIGVTINQSALNQVISGGAGDGTN* |
| Ga0137374_109791321 | 3300012204 | Vadose Zone Soil | VKKTQEALTRALSEDVFAEYISRLESEIGVTINQSALSQVVSGGTGDPN* |
| Ga0157291_101101522 | 3300012902 | Soil | TVDTLNRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN* |
| Ga0137416_117997902 | 3300012927 | Vadose Zone Soil | QSLNRGLSEDILTEYLAWLEREIGVTINQSALNQVISGGAGDGTN* |
| Ga0137404_120384041 | 3300012929 | Vadose Zone Soil | ETLNRGLSEDIFAEYIAHLESEVGVTINQGALNQVVSGGANTDVN* |
| Ga0164298_116293661 | 3300012955 | Soil | NRGLSDASLAQYIARLESDIGVTINQSALNQVVSGGAGDGEN* |
| Ga0134087_101854822 | 3300012977 | Grasslands Soil | ASEEAKRAAQTFNRGLSEDILAEYIAWLERDIGFTINQSALNQVVSGGAGDGTN* |
| Ga0164306_104630052 | 3300012988 | Soil | DALNRGISEDLLSEYIARLENDVGVTINQSALNQVVSGGAVDSSN* |
| Ga0173480_106625172 | 3300015200 | Soil | RTVDALNRGISEDLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN* |
| Ga0137403_110008392 | 3300015264 | Vadose Zone Soil | DSKRMIEALNRALADDIAGEYVGQLESEIGVNINQSALNQAISRGAGDIN* |
| Ga0182036_117616342 | 3300016270 | Soil | ALSEDVLTQYIAQLGSEMGVTFNQSALNQVISGGADTGDAN |
| Ga0182035_110784371 | 3300016341 | Soil | VLTQYIAQLESEMGVTFNQSALNQVISGGADTGDAD |
| Ga0190272_115184481 | 3300018429 | Soil | RGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0247746_11455631 | 3300022886 | Soil | NRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0179589_102748602 | 3300024288 | Vadose Zone Soil | EDILAEYLAWLEREIGVTINQSALNQVISGGAGDGTN |
| Ga0207692_109975461 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LNRGISEDLLSEYIARLENDVGVTINQSALNQVVSGGAVDSSN |
| Ga0207700_104514222 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LNRGVSEDILAEYIARLESEIGLTINQSALNQVVSGGAGEGAD |
| Ga0207664_102383832 | 3300025929 | Agricultural Soil | EALNRGVSEDILAEYIARLESEIGLTINQSALNQVVSGGAGEGAD |
| Ga0209055_10639501 | 3300026309 | Soil | VSEDILAEYIARLESEIGVTINQSALNQVISGGAGEGAD |
| Ga0209152_102967671 | 3300026325 | Soil | DILAEYIAWLESDIGVTINQSALNQVVSGGAGDGTN |
| Ga0209377_11037712 | 3300026334 | Soil | LEALNRGVSEDILAEYIARLESEIGLTINQSALNQVVSGGAGEGAD |
| Ga0209648_107324342 | 3300026551 | Grasslands Soil | LSEDVLTQYIAQLESEMGVTFNQSALNQVISGGADTGDAD |
| Ga0209577_101536162 | 3300026552 | Soil | DSADAKRIAETLDRGLSEALYAEYIAYLENEVGVTINQNALNQVVSGGAATE |
| Ga0209626_10945621 | 3300027684 | Forest Soil | RVVEALNRAVSEEVAAEYIAHLEAENGVSINQNALNQVTGSQAGSSDVD |
| Ga0208989_101662352 | 3300027738 | Forest Soil | VDTLNRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0209813_101612352 | 3300027866 | Populus Endosphere | SEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0247820_110141211 | 3300028597 | Soil | VDALNRGISEDLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN |
| Ga0307298_100116143 | 3300028717 | Soil | LLSEYIARLESEVGVTINQNALNQVVSGGAVDSAN |
| Ga0307317_101507622 | 3300028720 | Soil | GLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0307280_100510421 | 3300028768 | Soil | ILAEYIARLESDIGVTINQSALNQVVSGGAGDGEN |
| Ga0307306_100480172 | 3300028782 | Soil | DTLNRGLSEDLLSEYIARLESEVGVTINQSALNQVVSGGAGDSAN |
| Ga0307299_103354592 | 3300028793 | Soil | LSEDIFAEYIAHLESEVGVTINQGALNQVVSGGANTDVN |
| Ga0307292_103152761 | 3300028811 | Soil | SEDIFAEYIAHLESEVGVTINQGALNQVVSGGANTDVN |
| Ga0318534_100835593 | 3300031544 | Soil | NRGVSEDILAEYIARLESEIGVTINQSALNQVVSGGAGEGAD |
| Ga0318571_100329822 | 3300031549 | Soil | NRSLSEDILAEYIARLESEIGVTINQSALNQVVSGGAGDEAN |
| Ga0318573_101904421 | 3300031564 | Soil | LSDDLLGEYISRLESEVGVTINQSALNQAVGGGSGDDN |
| Ga0318573_106797132 | 3300031564 | Soil | SEDILAEYIAHLESEIGVTINQSALNQVVGGGGGEGAE |
| Ga0318515_103593342 | 3300031572 | Soil | SEDILAEYIARLESEIGVTINQSALNQVVSGGAGEGAD |
| Ga0318542_106438382 | 3300031668 | Soil | SEDILAEYIAHLESEIGVTINQSALNQVVGGGAGEGAE |
| Ga0318572_100328761 | 3300031681 | Soil | SEDILAEYIARLESEIGVTINQSALNQVVSGGAGDEAN |
| Ga0318496_103497201 | 3300031713 | Soil | DALNRGVSEDILAEYIAHLESEIGVTINQNALNQVVGGGAGEGAD |
| Ga0318500_101108341 | 3300031724 | Soil | ILAEYIARLESDIGVTINQSALNQVVGGGAGDGTN |
| Ga0318500_102837722 | 3300031724 | Soil | DILAEYLAHLESEIGVTINQSALNQVVGGGAGEGAD |
| Ga0307468_1001072111 | 3300031740 | Hardwood Forest Soil | MVETLNRGLSDAILAEYIARLESDIGVTINQSALHQVVSGGAGDGEN |
| Ga0307475_113658061 | 3300031754 | Hardwood Forest Soil | RGVSEDILAEYIARLESEIGLTINQSALNQVVSGGAGEGAE |
| Ga0318543_101286102 | 3300031777 | Soil | MVETLNRSLSDDLLGEYVSRLESEVGVTINQSALNQVLGGGAPGEN |
| Ga0318567_106511421 | 3300031821 | Soil | DIFGEYVAKLENEIGVTINQSALNQVVSGGNAGDTN |
| Ga0318511_104681521 | 3300031845 | Soil | LNRGVSEDILAEYIARLESEIGVTINQSALNQVVSGGAGEGAD |
| Ga0318527_100469892 | 3300031859 | Soil | RDLDALNRGVSEDILAEYIAHLESEIGVTINQNALNQVVGGGAGEGAD |
| Ga0306919_103241602 | 3300031879 | Soil | RAVAEDIAGEYISRLEKDVGVTINQSALNQVIGGRAGTEID |
| Ga0318544_103349822 | 3300031880 | Soil | RMVETLNRSLSDDLLGEYVSRLESEVGVTINQSALNQVLGGGAPGEN |
| Ga0318536_100621761 | 3300031893 | Soil | TLNRSLSDDLLGEYVSRLESEVGVTINQSALNQVLGGGAPGEN |
| Ga0310912_113525471 | 3300031941 | Soil | NRGLADDIAGEYVGQLESEIGVNINQSALNQVVSGGAPDIN |
| Ga0310916_101828082 | 3300031942 | Soil | NRSLSDDLLGEYVSRLESEVGVTINQSALNQVLGGGAPGEN |
| Ga0310916_102665101 | 3300031942 | Soil | EDIAGEYISRLEKDVGVTINQSALNQVIGGRAGTEID |
| Ga0310909_109387901 | 3300031947 | Soil | LNRGLADDIAGEYVGQLESEIGVNINQSALNQVVSGGAPDIN |
| Ga0318563_100894382 | 3300032009 | Soil | LNRSLSEDILAEYVTRLESEIGVTINQNALNQVVSGGAGDGAN |
| Ga0318563_103960132 | 3300032009 | Soil | LEALNRGVSEDILAEYIARLESEIGVTINQSALNQVVSGGAGEGAD |
| Ga0318549_100207061 | 3300032041 | Soil | RDLEALNRGVSEDILAEYIARLESEIGVTINQSALNQVVSGGAGEGAD |
| Ga0310890_115622861 | 3300032075 | Soil | DLLSEYIARLENEVGVTINQSALNQVVSGGAVDSSN |
| Ga0318577_103059961 | 3300032091 | Soil | VLTQYIAQLESEMGVTFNHSALNQVISGGADTGDAD |
| Ga0310914_111060552 | 3300033289 | Soil | DDLLGEYITRLESEVGVTINQSALNQAVGGGSGDDNN |
| Ga0310914_115434172 | 3300033289 | Soil | VSEDILAEYIAHLESEIGVTINQNALNQVVGGGAGEGAE |
| Ga0318519_106775351 | 3300033290 | Soil | RGVSEDILAEYIARLESEIGVTINQSALNQVVSSGAGEGAD |
| Ga0318519_108169751 | 3300033290 | Soil | SDDLLGEYVGRLESEIGVTINHSALNQVIGGGIPGDN |
| ⦗Top⦘ |