


| Basic Information | |
|---|---|
| Family ID | F103501 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITVI |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.22 % |
| % of genes near scaffold ends (potentially truncated) | 17.82 % |
| % of genes from short scaffolds (< 2000 bps) | 84.16 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.208 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (39.604 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.149 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.574 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.05% β-sheet: 37.84% Coil/Unstructured: 58.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 1.98 |
| PF05731 | TROVE | 1.98 |
| PF04454 | Linocin_M18 | 0.99 |
| PF07282 | OrfB_Zn_ribbon | 0.99 |
| PF01555 | N6_N4_Mtase | 0.99 |
| PF10686 | YAcAr | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.99 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.99 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.21 % |
| All Organisms | root | All Organisms | 20.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 39.60% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 18.81% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 9.90% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 7.92% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 6.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 2.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.98% |
| Solid Waste From Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor | 1.98% |
| Biogas Fermenter | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter | 1.98% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 1.98% |
| Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor | 1.98% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 1.98% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.99% |
| Mixed Substrate Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111018 | Mesophilic bioreactor microbial communities at Bielefeld, Germany | Engineered | Open in IMG/M |
| 3300001975 | Biogas fermenter microbial communities from the University of Hamburg, Germany | Engineered | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002164 | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 | Engineered | Open in IMG/M |
| 3300002166 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 | Engineered | Open in IMG/M |
| 3300002167 | Biogas fermentation microbial communities from Germany - Plant 4 DNA2 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002377 | Biogas fermentation microbial communities from Germany - Plant 2 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002392 | Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002406 | Biogas fermentation microbial communities from Germany - Plant 1 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300003306 | Biogas fermentation microbial communities from Germany - Plant 1 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300005835 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads | Engineered | Open in IMG/M |
| 3300006225 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy | Engineered | Open in IMG/M |
| 3300006387 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006395 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006598 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006600 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300020072 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027510 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028627 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met | Engineered | Open in IMG/M |
| 3300028727 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Arg1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029775 | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B | Engineered | Open in IMG/M |
| 3300029822 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Meso_12661232 | 2209111018 | Solid Waste From Bioreactor | MTKNIILEGVVLTMTNMICRCVDEDFIENIISDFEDKKVLVTITEI |
| Meso_8218701 | 2209111018 | Solid Waste From Bioreactor | MIKNIILEGVVTYDDKFDLWRVDDEAIETTISDFENRRVVVTITVI |
| Draft_108218701 | 3300001975 | Biogas Fermenter | MIKNIILEGVVTYDDKFDLWRVDDEAIETTISDFENRRVVVTITVI* |
| Draft_112661232 | 3300001975 | Biogas Fermenter | MTKNIILEGVVLTMTNMICRCVDEDFIENIISDFEDKKVLVTITEI* |
| JGI24707J26582_100353983 | 3300002163 | Biogas Fermentantion | VDYMVKYVILEGVVYYDDKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| JGI24707J26582_100626752 | 3300002163 | Biogas Fermentantion | MVKNIILEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVVVTITEI* |
| JGI24707J26582_101295413 | 3300002163 | Biogas Fermentantion | LEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITVI* |
| JGI24708J26588_100326892 | 3300002164 | Biogas Fermentantion | MTKNIILEGVVSFDAKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| JGI24708J26588_101273712 | 3300002164 | Biogas Fermentantion | MVKNIILEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITVI* |
| JGI24713J26584_100484113 | 3300002166 | Biogas Fermentantion | MIKNIVIEGIVTYDDNFDLWRVDDEAIETTISNFENRKVVVTITVI* |
| JGI24714J26587_100541372 | 3300002167 | Biogas Fermentantion | MIKNIVLEGVVSFDDEYDLWCVGEDFIENIISDFEDKKVVVTITVI* |
| JGI24714J26587_101203311 | 3300002167 | Biogas Fermentantion | MTKSIILEGVVYYDAKYDLWCVGEDFIENIISDFEDKKVLVTITEI* |
| JGI24712J26585_100981932 | 3300002168 | Biogas Fermentantion | MVKNIILEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVSITEI* |
| JGI24711J26586_101036762 | 3300002170 | Biogas Fermentantion | MAKIIVLEGDVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITEI* |
| JGI24711J26586_101250862 | 3300002170 | Biogas Fermentantion | MVYMIKNIVLEGVVSYDNEYDLWCVDEDFIENIISDFEDKKVVVTITVI* |
| JGI24709J26583_100969441 | 3300002173 | Biogas Fermentantion | MVYMIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVVVTITVI* |
| JGI24710J26742_102104532 | 3300002174 | Biogas Fermentantion | MAKNIILEGVVSYDDEYDLWCVDEDSIENIISDFEDKKVLVTITEI* |
| JGI24500J29687_100189012 | 3300002377 | Biogas Fermentantion | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVVVTIT |
| JGI24503J29689_100182293 | 3300002392 | Biogas Fermentantion | MVKNIILEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITEI* |
| JGI24499J29688_10114872 | 3300002406 | Biogas Fermentantion | MVKNIILEGVVSFDAKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| Ga0004534J46558_10175322 | 3300003306 | Biogas Fermentantion | MVKNIILEGVVSYDDKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| Ga0078910_1024613 | 3300005835 | Biogas Reactor | MVKNIILEGVVFFDDKYDLWCVGEDYIEDIISDFEDKKVLVTITEI* |
| Ga0078910_1082292 | 3300005835 | Biogas Reactor | MVKNIILEGVVFFDAKYDLWCVGEDYIEDIISDFEDKKVLVTITEI* |
| Ga0082206_1019235 | 3300006225 | Mixed Substrate Biogas Reactor | MVKNIILEGVVFFDVKYDLWCVGEDYIEDIISDFEDKXVLVTITEI* |
| Ga0079069_13002061 | 3300006387 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITVI* |
| Ga0079066_15316211 | 3300006395 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITV |
| Ga0079098_10051388 | 3300006598 | Anaerobic Digestor Sludge | MVKNIILEGVVSYDDEYDLWCVGEDFIENIISDFENKKVLVTITVI* |
| Ga0079065_14507212 | 3300006600 | Anaerobic Digestor Sludge | MVKIIILEGVVTYDDKYDLWCVGEDYIENIISDFEDKKVLVTITVI* |
| Ga0079223_109731711 | 3300006801 | Agricultural Soil | YMIKNIALEGVVSYDDEYNQWCVDEDFIETTISDFENRRVVVTITEI* |
| Ga0075464_102017992 | 3300006805 | Aqueous | MIKNIVLEGVVSYDDEYDLWCVDEDYIENIISDFEDKKVLVTITVI* |
| Ga0075464_106121872 | 3300006805 | Aqueous | MIKNIVLEGDVSYVDDYDLWCVDEDFIENTISDFEGK |
| Ga0079224_1009514642 | 3300009095 | Agricultural Soil | MVYMIKNIVLEGVVSYDDEYDLWCVDEDSIENIISDFEDKKVVVTITVI* |
| Ga0079224_1037558272 | 3300009095 | Agricultural Soil | MVKNIILEGVVSFDAKYDLWCVGEDYIEDIISDFEDKKVLVTITEI* |
| Ga0123327_11182592 | 3300009607 | Anaerobic Biogas Reactor | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFDGKKVVVTITVI* |
| Ga0123326_11425151 | 3300009647 | Anaerobic Biogas Reactor | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITVI* |
| Ga0123330_12393661 | 3300009652 | Anaerobic Biogas Reactor | VDYMIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITVI* |
| Ga0116146_11482672 | 3300009664 | Anaerobic Digestor Sludge | VDYMIKNIVIEGIVTYDDEFDLWRVDDEAIETTISDFENRKVAVTITVI* |
| Ga0116182_10962691 | 3300009666 | Anaerobic Digestor Sludge | MIKNIVLEGDVSYDDDYDLWCVGEDFIENTISDFEGKKVLVTITVI* |
| Ga0116147_10603765 | 3300009667 | Anaerobic Digestor Sludge | MIKNIVIEGIVTYDDEFDLWRVDDEAIETTISDFENRKVAVTITVI* |
| Ga0116147_12965302 | 3300009667 | Anaerobic Digestor Sludge | MITEITVEGLVTYNEEYDSWRVDIDSIENIISDFEGRKVVVTITEI* |
| Ga0116148_11839922 | 3300009669 | Anaerobic Digestor Sludge | VDYMIKNIVLEGVVSYDDEYDLWCVGEDFIENTISEFEGKKVVVTITVI* |
| Ga0116183_10392653 | 3300009670 | Anaerobic Digestor Sludge | MIKNIVLEGDVSYDDDYDLWCVGEDFIENIISDFEDKKVLVTITVI* |
| Ga0116173_11278832 | 3300009674 | Anaerobic Digestor Sludge | VDYMIKNIILEGIVSYDVEYDLWCVDEDFIENIISDFEGKKVVVTITVI* |
| Ga0116173_11605783 | 3300009674 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVDEDFIENTISDFEDKKVLVTITVI* |
| Ga0116149_13266772 | 3300009675 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVGEDFIENIISDFEDKKVVVTITVI* |
| Ga0123335_13205082 | 3300009680 | Anaerobic Biogas Reactor | MVYMIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFDGKKVVVTITVI* |
| Ga0116174_101456044 | 3300009681 | Anaerobic Digestor Sludge | TKSIILEGVVYFDAKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| Ga0116174_105680371 | 3300009681 | Anaerobic Digestor Sludge | MIKNIILEGIVSYDVEYDLWCVDEDFIENIISDFEGKKVVVTITVI* |
| Ga0116144_100255928 | 3300009687 | Anaerobic Digestor Sludge | VDYMIKNIVIEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITVI* |
| Ga0116176_106464871 | 3300009688 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFDGKKVVVTITVI* |
| Ga0116177_104158802 | 3300009696 | Anaerobic Digestor Sludge | VDYMIKNIVLEGVVSYDDEYDLWCVDEDFIENIISDFEDKKVLVTITVI* |
| Ga0116145_10426582 | 3300009704 | Anaerobic Digestor Sludge | MITEITIEGLVTYDDEFDLWRVDDEAIETTISDFENRKVAVTITVI* |
| Ga0116160_11012733 | 3300009715 | Anaerobic Digestor Sludge | MVKSIILEGVVSYDNKYDLWCVDEDFIENIISDFEDKKVLVTITEI* |
| Ga0116161_11696923 | 3300009767 | Anaerobic Digestor Sludge | DVVYMVKSIILEGVVSYDNKYDLWCVDEDFIENIISDFEDKKVLVTITEI* |
| Ga0116156_100376389 | 3300009780 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDYIENIISDFEDKKVLVTITVI* |
| Ga0116250_105719941 | 3300010340 | Anaerobic Digestor Sludge | MVYMIKNIVLEGVVSYDDEYDLWCVDEDSIENIISDFEDKKVVVTIT |
| Ga0116239_105170793 | 3300010346 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDFIENTISEFEGKKVVVTITVI* |
| Ga0116239_106973212 | 3300010346 | Anaerobic Digestor Sludge | MVKIIILEGVVSFDAKYDLWCVGEDYIENIISDFEDKKVVVTITVI* |
| Ga0116239_110268551 | 3300010346 | Anaerobic Digestor Sludge | MVKIIILEGVVTYDDKYDLWCVGEDYIENIISDFEGKKVVVTITVI* |
| Ga0116238_101417332 | 3300010347 | Anaerobic Digestor Sludge | MVKIIVIEGIVTYDDEFDLWRVDDEAIETTISDFENRKVAVTITVI* |
| Ga0116236_104478122 | 3300010353 | Anaerobic Digestor Sludge | MVKSIILEGVVSFDAKYDLWCVGEDFIEGIISDFEDKKVLVTITEI* |
| Ga0116242_102432655 | 3300010355 | Anaerobic Digestor Sludge | IVLEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITVI* |
| Ga0116251_102179341 | 3300010365 | Anaerobic Digestor Sludge | MIKNIVLEGDVSYDDDYDLWCVDEDFIENIISDFEGKK |
| Ga0172378_104662331 | 3300014203 | Groundwater | MVKNIILEGIVSYDVEYDLWCVGEDYIENIISDFEDK |
| Ga0172378_105665762 | 3300014203 | Groundwater | VDYMVKNIILVGIVSYDDEYDLWCVGEDYIENIISDFEDKKVV |
| Ga0172378_108837682 | 3300014203 | Groundwater | MVKNIILEGVVYYDVKYDLWCVGEDYIENIISDFEDKKVLVTITEI* |
| Ga0172381_105635454 | 3300014204 | Landfill Leachate | MIKNIVIEGIATYDDEFDLWRVDDEAIETTISDFENRRVVVTITEI* |
| Ga0172380_102326233 | 3300014205 | Landfill Leachate | MIKNIVIEGVVSYDVEYDLWCVDEDFIETTISDFENRKVVVTITVI* |
| Ga0172377_109245802 | 3300014206 | Landfill Leachate | MVKNIILEGVVSYDVEYDLWCVGEDYIENNISDFEDKKVLVTITEI* |
| Ga0172377_109340551 | 3300014206 | Landfill Leachate | MVKNIILEGIVSYDVEYDLWCVDEDFIENNISDYDGKKVVVTITVI* |
| Ga0172377_111324442 | 3300014206 | Landfill Leachate | VDYMVKNIILVGIVSYDDEYDLWCVGEDYIENIISDFEDKKVVVTITEI* |
| Ga0172377_114208362 | 3300014206 | Landfill Leachate | VDYMGKNIILEGVVSYDDEYDLWCVDEDFIENIISDFEDKKVLVTITEI* |
| Ga0172382_101627732 | 3300015214 | Landfill Leachate | MVKNIILVGIVSYDDEYDLWCVGEDYIENIISDFEDKKVVVTITEI* |
| Ga0180031_13065372 | 3300020072 | Anaerobic Biogas Reactor | MIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFDGKKVVVTITVI |
| Ga0208693_10110972 | 3300025618 | Anaerobic Digestor Sludge | MVKNIILEGVVSFDAKYDLWCVGEDYIEDIISDFEDKKVLVTITEI |
| Ga0209719_10215257 | 3300025677 | Anaerobic Digestor Sludge | MVKSIILEGVVSYDNKYDLWCVDEDFIENIISDFEDKKVLVTITEI |
| Ga0209506_11415702 | 3300025686 | Anaerobic Digestor Sludge | MIKNIVIEGIVTYDDEFDLWRVDDEAIETTISDFENRKVAVTITVI |
| Ga0209201_10599262 | 3300025708 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDFIENTISEFEGKKVVVTITVI |
| Ga0208195_11704752 | 3300025713 | Anaerobic Digestor Sludge | MIKNIVLEGDVSYDDDYDLWCVGEDFIENTISDFEGKKVLVTITVI |
| Ga0209606_11281572 | 3300025730 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVGEDFIENIISDFEGKKVVVTITVI |
| Ga0209200_10791181 | 3300025784 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDVEYDLWCVDEDFIENIISDFEDKKVLVTITVI |
| Ga0209605_10921801 | 3300025861 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKK |
| Ga0209311_10560345 | 3300025871 | Anaerobic Digestor Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDYIENIISDFEDKKVLVTITVI |
| Ga0209312_10285532 | 3300026195 | Anaerobic Biogas Reactor | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFDGKKVLVTITVI |
| Ga0209723_10265682 | 3300026311 | Anaerobic Biogas Reactor | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFDGKKVVVTITVI |
| Ga0209537_10102469 | 3300027510 | Biogas Fermentantion | MIKNIVIEGIVTYDDNFDLWRVDDEAIETTISNFENRKVVVTITVI |
| Ga0209537_10204622 | 3300027510 | Biogas Fermentantion | MIKNIVLEGVVSYDDEYDLWCVDEDFIEDIISDFEDKKVLVTITEI |
| (restricted) Ga0255344_11830383 | 3300028564 | Wastewater | ITIEGLVTYNEEFDSWRVDIDSIENIISDFEGRKVVVTITEI |
| (restricted) Ga0255347_13701732 | 3300028593 | Wastewater | MTKSIILEGVVSFDAKYDLWCVGEDYIEGIISDFEDKKVLVTITEI |
| Ga0265295_11626231 | 3300028601 | Landfill Leachate | VVYYDVKYDLWCVGEDYIENIISDFEDKKVLVTITEI |
| Ga0265294_101720445 | 3300028602 | Groundwater | MVKNIILVGIVSYDDEYDLWCVGEDYIENIISDFEDKKVVVTITEI |
| Ga0265294_102141383 | 3300028602 | Groundwater | MVKNIILEGVVYYDVKYDLWCVGEDYIENIISDFEDKKVLVTITEI |
| Ga0265294_102783393 | 3300028602 | Groundwater | MIKNIVLEGDVSYDVEYDLWCVDEDFIENIISDFEGKKVVVTITVI |
| Ga0265294_103043753 | 3300028602 | Groundwater | MIKNIVIEGVVSYDVEYDLWCVDEDFIETTISDFENRKVVVTITVI |
| Ga0265294_104794132 | 3300028602 | Groundwater | MVKYIILEGVVYYDDEYDLWCVGEDYIENIISDFEDKKVLVTITEI |
| Ga0265294_108315672 | 3300028602 | Groundwater | MIKNIVLEGDVSYDDDYDLWRVDEDFIENIISDFNGKKVVVTITEI |
| Ga0265294_108360891 | 3300028602 | Groundwater | MIKNIVLEGVATYDDEFDLWRVDDEAIETTISDFENRRVVVTITEI |
| Ga0302243_11106622 | 3300028627 | Activated Sludge | MIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFEDKKVLVTITVI |
| Ga0307344_1219312 | 3300028727 | Anaerobic Digestor Sludge | MIKNIVFEGVVSYDVEYDLWCVGEDYIENIISDFEDKKVLVTITVI |
| Ga0134843_100270919 | 3300029775 | Fermentation Pit Mud | MITDIVLEGVVSYDNKYDLWCVDEDFIENTISEFEGKKVVVTITVI |
| Ga0134854_100497513 | 3300029822 | Fermentation Pit Mud | MVKNIILEGVVSFDAKYDLWCVDEDYIENIISDFEDKKVLVTITVI |
| ⦗Top⦘ |