


| Basic Information | |
|---|---|
| Family ID | F101433 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VKRRISFVILAVVGVAAVVLGIRAGDPETIHRFAAQI |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.59 % |
| % of genes near scaffold ends (potentially truncated) | 6.86 % |
| % of genes from short scaffolds (< 2000 bps) | 65.69 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (26.471 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.471 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.196 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF12801 | Fer4_5 | 19.61 |
| PF00578 | AhpC-TSA | 9.80 |
| PF13746 | Fer4_18 | 4.90 |
| PF07995 | GSDH | 1.96 |
| PF04055 | Radical_SAM | 1.96 |
| PF13510 | Fer2_4 | 0.98 |
| PF11551 | Omp28 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF02880 | PGM_PMM_III | 0.98 |
| PF01869 | BcrAD_BadFG | 0.98 |
| PF02607 | B12-binding_2 | 0.98 |
| PF01797 | Y1_Tnp | 0.98 |
| PF02091 | tRNA-synt_2e | 0.98 |
| PF16881 | LIAS_N | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.96 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.06 % |
| Unclassified | root | N/A | 2.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100559017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 508 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101578086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 823 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103922269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 574 | Open in IMG/M |
| 3300001580|Draft_10025566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 4313 | Open in IMG/M |
| 3300002220|MLSBCLC_10622278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1004 | Open in IMG/M |
| 3300002220|MLSBCLC_10654163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 908 | Open in IMG/M |
| 3300005832|Ga0074469_10677600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1460 | Open in IMG/M |
| 3300005832|Ga0074469_10968026 | All Organisms → cellular organisms → Bacteria | 32482 | Open in IMG/M |
| 3300006224|Ga0079037_100271995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1559 | Open in IMG/M |
| 3300006224|Ga0079037_100811266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 919 | Open in IMG/M |
| 3300009037|Ga0105093_10211634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1001 | Open in IMG/M |
| 3300009081|Ga0105098_10091471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1302 | Open in IMG/M |
| 3300009091|Ga0102851_12278283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 617 | Open in IMG/M |
| 3300009506|Ga0118657_10577677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1440 | Open in IMG/M |
| 3300009509|Ga0123573_10548021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1097 | Open in IMG/M |
| 3300009943|Ga0117933_1022772 | All Organisms → cellular organisms → Bacteria | 38790 | Open in IMG/M |
| 3300010291|Ga0129302_1005538 | All Organisms → cellular organisms → Bacteria | 8067 | Open in IMG/M |
| 3300010302|Ga0116202_10000573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 | 20701 | Open in IMG/M |
| 3300010302|Ga0116202_10012444 | All Organisms → cellular organisms → Bacteria | 4832 | Open in IMG/M |
| 3300010302|Ga0116202_10063925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1864 | Open in IMG/M |
| 3300010302|Ga0116202_10147556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1120 | Open in IMG/M |
| 3300010319|Ga0136653_10000127 | All Organisms → cellular organisms → Bacteria | 36781 | Open in IMG/M |
| 3300010412|Ga0136852_11151086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 737 | Open in IMG/M |
| 3300010413|Ga0136851_10271888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1727 | Open in IMG/M |
| 3300013088|Ga0163200_1053936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1213 | Open in IMG/M |
| 3300013089|Ga0163203_1007705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3002 | Open in IMG/M |
| 3300013092|Ga0163199_1265837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 655 | Open in IMG/M |
| 3300013092|Ga0163199_1298978 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 609 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10081908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2080 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10441173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 757 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10287016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 | 1091 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10538113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 769 | Open in IMG/M |
| 3300014490|Ga0182010_10706038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 568 | Open in IMG/M |
| 3300014502|Ga0182021_11044242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 983 | Open in IMG/M |
| 3300014502|Ga0182021_11403915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 841 | Open in IMG/M |
| 3300014502|Ga0182021_11523912 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300014839|Ga0182027_10151608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2730 | Open in IMG/M |
| 3300019252|Ga0172286_1058154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 908 | Open in IMG/M |
| 3300019861|Ga0206388_1181435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 583 | Open in IMG/M |
| 3300020074|Ga0194113_10094948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2637 | Open in IMG/M |
| 3300020074|Ga0194113_10406489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 999 | Open in IMG/M |
| 3300020814|Ga0214088_1409729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 583 | Open in IMG/M |
| 3300022547|Ga0212126_1007780 | All Organisms → cellular organisms → Bacteria | 5423 | Open in IMG/M |
| 3300022556|Ga0212121_10000509 | All Organisms → cellular organisms → Bacteria | 43395 | Open in IMG/M |
| 3300022556|Ga0212121_10003166 | All Organisms → cellular organisms → Bacteria | 17445 | Open in IMG/M |
| 3300022556|Ga0212121_10009017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 9964 | Open in IMG/M |
| 3300022556|Ga0212121_10011312 | All Organisms → cellular organisms → Bacteria | 8749 | Open in IMG/M |
| 3300022556|Ga0212121_10056297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3213 | Open in IMG/M |
| (restricted) 3300023177|Ga0233423_10000398 | All Organisms → cellular organisms → Bacteria | 23765 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10124020 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1418 | Open in IMG/M |
| 3300025136|Ga0209610_1224597 | Not Available | 584 | Open in IMG/M |
| 3300025285|Ga0208046_1000310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 10666 | Open in IMG/M |
| 3300025447|Ga0208102_1084960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 507 | Open in IMG/M |
| 3300026293|Ga0209227_1031047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2065 | Open in IMG/M |
| 3300027871|Ga0209397_10228018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 868 | Open in IMG/M |
| 3300027896|Ga0209777_10012972 | All Organisms → cellular organisms → Bacteria | 8618 | Open in IMG/M |
| 3300027896|Ga0209777_10082331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2790 | Open in IMG/M |
| 3300027902|Ga0209048_10309177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1105 | Open in IMG/M |
| 3300027917|Ga0209536_100020260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 9314 | Open in IMG/M |
| 3300028156|Ga0268281_1014702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2401 | Open in IMG/M |
| 3300028191|Ga0265595_1100544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 942 | Open in IMG/M |
| 3300028920|Ga0272441_10415947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1110 | Open in IMG/M |
| 3300029674|Ga0265604_125946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 590 | Open in IMG/M |
| 3300031111|Ga0272444_10734306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 693 | Open in IMG/M |
| 3300031585|Ga0315534_1139074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 896 | Open in IMG/M |
| 3300031746|Ga0315293_10333743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1208 | Open in IMG/M |
| 3300031772|Ga0315288_11361997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 597 | Open in IMG/M |
| 3300031834|Ga0315290_11109380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 661 | Open in IMG/M |
| 3300031999|Ga0315274_10140399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3082 | Open in IMG/M |
| 3300032069|Ga0315282_10009017 | All Organisms → cellular organisms → Bacteria | 15952 | Open in IMG/M |
| 3300032118|Ga0315277_10000539 | All Organisms → cellular organisms → Bacteria | 60128 | Open in IMG/M |
| 3300032163|Ga0315281_10118155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3048 | Open in IMG/M |
| 3300032163|Ga0315281_10837251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 946 | Open in IMG/M |
| 3300032516|Ga0315273_10120840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3586 | Open in IMG/M |
| 3300032829|Ga0335070_10813565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 869 | Open in IMG/M |
| 3300032893|Ga0335069_10042263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 6064 | Open in IMG/M |
| 3300032897|Ga0335071_10649994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1005 | Open in IMG/M |
| 3300033416|Ga0316622_100000290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 | 27640 | Open in IMG/M |
| 3300033416|Ga0316622_100018452 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 5928 | Open in IMG/M |
| 3300033416|Ga0316622_100080380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3198 | Open in IMG/M |
| 3300033416|Ga0316622_100400279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1543 | Open in IMG/M |
| 3300033416|Ga0316622_100452610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1454 | Open in IMG/M |
| 3300033416|Ga0316622_101381034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 823 | Open in IMG/M |
| 3300033433|Ga0326726_10737886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 951 | Open in IMG/M |
| 3300033480|Ga0316620_10176993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1749 | Open in IMG/M |
| 3300033480|Ga0316620_10335791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1339 | Open in IMG/M |
| 3300033480|Ga0316620_11771239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 613 | Open in IMG/M |
| 3300033481|Ga0316600_10265918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1144 | Open in IMG/M |
| 3300033482|Ga0316627_102053946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 594 | Open in IMG/M |
| 3300033482|Ga0316627_102454995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 549 | Open in IMG/M |
| 3300033482|Ga0316627_103023590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 501 | Open in IMG/M |
| 3300033486|Ga0316624_10811799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 832 | Open in IMG/M |
| 3300033487|Ga0316630_11212041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 670 | Open in IMG/M |
| 3300033513|Ga0316628_100087581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 3434 | Open in IMG/M |
| 3300033513|Ga0316628_101524584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 890 | Open in IMG/M |
| 3300033513|Ga0316628_103937712 | Not Available | 531 | Open in IMG/M |
| 3300033521|Ga0316616_100128039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 2336 | Open in IMG/M |
| 3300033521|Ga0316616_101295127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 | 933 | Open in IMG/M |
| 3300033557|Ga0316617_100436680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1168 | Open in IMG/M |
| 3300033557|Ga0316617_100485110 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1118 | Open in IMG/M |
| 3300033557|Ga0316617_101816913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 622 | Open in IMG/M |
| 3300033557|Ga0316617_102207067 | Not Available | 568 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 26.47% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 11.76% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 10.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.84% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 4.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.94% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.94% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 2.94% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 1.96% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment | 1.96% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.96% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.98% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.98% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.98% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 0.98% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Anaerobic Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture | 0.98% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009943 | Combined Assembly of Gp0139325, Gp0139347, Gp0139348 | Environmental | Open in IMG/M |
| 3300010291 | Hot spring sediment bacterial and archeal communities from California, USA to study Microbial Dark Matter (Phase II) - Blank Spring sediment metaG | Environmental | Open in IMG/M |
| 3300010302 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 325m metaG | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019861 | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1 | Engineered | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300022547 | Wilbur_combined assembly | Environmental | Open in IMG/M |
| 3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
| 3300023177 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MG | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300025136 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025285 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m (SPAdes) | Environmental | Open in IMG/M |
| 3300025447 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M (SPAdes) | Environmental | Open in IMG/M |
| 3300026293 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028156 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300029674 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031111 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-13 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1005590171 | 3300001213 | Wetland | MKRRVSFVILAVLGVAAVLLGIRAGDPETIHRFAA |
| JGIcombinedJ13530_1015780862 | 3300001213 | Wetland | MKRRVSFVVLAIIGVVAVVLGIRAGDPETIHRFAAQI* |
| JGIcombinedJ13530_1039222692 | 3300001213 | Wetland | MKRRVAFVILAAVGIAAVVLGIKAGDPETIHRFAAQI* |
| Draft_100255662 | 3300001580 | Hydrocarbon Resource Environments | VKRKVSFIILVAIGVAAVVLGIRAGDPETIHRFAAQI* |
| MLSBCLC_106222782 | 3300002220 | Hydrocarbon Resource Environments | VKRKVSFIILAAIGVAAVVLGIRAGDPETIHRFAAQI* |
| MLSBCLC_106541632 | 3300002220 | Hydrocarbon Resource Environments | MKRRAVFVLVALAGITAVVVGIVKGDPETIHRFAAQI* |
| Ga0074469_106776002 | 3300005832 | Sediment (Intertidal) | VKRRIAFVVLAVAGIAAVVLGIRAGDPETIHRFAAQI* |
| Ga0074469_109680268 | 3300005832 | Sediment (Intertidal) | MKRRVAFVLLAAIGVAAVVLGIRLGDPETIHRFAAQI* |
| Ga0079037_1002719952 | 3300006224 | Freshwater Wetlands | VKRRVISALLAAAGVAAVVAGILAGNPETIHRFAAQI* |
| Ga0079037_1008112662 | 3300006224 | Freshwater Wetlands | MKRRISFAILAAIGVAAVVLGIGAGDPETIHRFAAQI* |
| Ga0105093_102116342 | 3300009037 | Freshwater Sediment | MKRRVAFILLAVIGVAAVVIGIKAGDPETIHRFAAQI* |
| Ga0105098_100914712 | 3300009081 | Freshwater Sediment | MKRRVVFVVLAAVGIAAVVLGIRAGDPETIHRFAAQI* |
| Ga0102851_122782832 | 3300009091 | Freshwater Wetlands | MKRRISFAILAVIGVAAVVLGIGAGDPETIHRFAAQI* |
| Ga0118657_105776772 | 3300009506 | Mangrove Sediment | VKKRRLVFGLLAAAGVALLVVGIIKGDPETIHRFAAQI* |
| Ga0123573_105480212 | 3300009509 | Mangrove Sediment | MKRRVAFVLLAVIGVAAVVLGVRAGDTETIHRFAAQI* |
| Ga0117933_102277222 | 3300009943 | Hot Spring Fe-Si Sediment | MARRVVFIVSALAGMGAVVVGVVLRNLETIHRFAAQI* |
| Ga0129302_10055387 | 3300010291 | Hot Spring Sediment | MKRRVIFAAVVLVGLAAVAVGIARGDFETIHRFAAQI* |
| Ga0116202_100005732 | 3300010302 | Anoxic Lake Water | VKRKISFVVLAVIGAAAVVLGIKAGDPETIHRFAAQI* |
| Ga0116202_100124444 | 3300010302 | Anoxic Lake Water | MKRRVSFIILAVVGVVAVVLGIKAGDPETIHRFAAQI* |
| Ga0116202_100639252 | 3300010302 | Anoxic Lake Water | MARKISFVVLALVGIAAVALGLKFGDLATIHRFASQI* |
| Ga0116202_101475562 | 3300010302 | Anoxic Lake Water | VKRRVAFVVLAVAGIAAVVLGIRAGDPETIHRFAAQI* |
| Ga0136653_1000012714 | 3300010319 | Anoxic Lake Water | VKRKISFVVLAVIGVAAIVFGIKAGNPETIHRFAAQI* |
| Ga0136852_111510862 | 3300010412 | Mangrove Sediment | VKRRVIFAVLAAVGVAAIVVGIIKGDPETIHRFAAQI* |
| Ga0136851_102718882 | 3300010413 | Mangrove Sediment | MKRRVAFVLLAVIGVAAVVFGVRAGDPETIHRFAAQI* |
| Ga0163200_10539361 | 3300013088 | Freshwater | MKRRIAFMLLAVIGVAAVVLGIRAGDPETIHRFAAQI* |
| Ga0163203_10077053 | 3300013089 | Freshwater | MKRRVAFMLLAVIGVVAVVLGIRAGDPETIHRFAAQI* |
| Ga0163199_12658372 | 3300013092 | Freshwater | VKRRISFVILAVVGVAVVVMGIKAGDPETIHRFASQI* |
| Ga0163199_12989782 | 3300013092 | Freshwater | VKRRIAFALLAVFGVVAIVVGIKAGNPETIHRFAAQIGLSCMGLV* |
| (restricted) Ga0172365_100819083 | 3300013127 | Sediment | MARKISFVVLALVGIAAVALGLKFGDLDTIHRFASQI* |
| (restricted) Ga0172365_104411732 | 3300013127 | Sediment | MKRRIVFIVLALAGIAAVVAGIRLGDPETIHRFAAQI* |
| (restricted) Ga0172363_102870162 | 3300013130 | Sediment | MKRRIVFIILALAGIAAVVARIALGDPETIHRFAAQI* |
| (restricted) Ga0172375_105381133 | 3300013137 | Freshwater | VKRRVAFVVLAVAGIAAVVLGIRAGDPETIHRFAA |
| Ga0182010_107060382 | 3300014490 | Fen | MRRKVTFVILAVVGVVAVALGIKAGNPETIHRFAAQI* |
| Ga0182021_110442422 | 3300014502 | Fen | MKRRVAFVLLAVFGVVAIALGIKAGDPETIHRFAAQI* |
| Ga0182021_114039152 | 3300014502 | Fen | VKRRIAFALLAVFGVAAIALGIKAGNPETIHRFAAQI* |
| Ga0182021_115239121 | 3300014502 | Fen | MRRKIAFVVIAVVGVAAVALGVKFGDPETIHRFASQI* |
| Ga0182027_101516082 | 3300014839 | Fen | VKRRIAFSLLVLVGVLAVVLGIKAGNPETIHRFAAQI* |
| Ga0172286_10581542 | 3300019252 | Wetland | VKRRVISALLAAAGVAAVVAGILAGNPETIHRFAAQI |
| Ga0206388_11814352 | 3300019861 | Anaerobic Enrichment Culture | MRRKVSFIILAAIGVAAVVLGIRAGDPETIHRFAAQI |
| Ga0194113_100949482 | 3300020074 | Freshwater Lake | MKRRVVFVVLAVVGVAAAALGIAKGDPETIHRFAAQI |
| Ga0194113_104064892 | 3300020074 | Freshwater Lake | MARRISFAVLALVGIAAVALGIKFGDLDTIHRFASQI |
| Ga0214088_14097292 | 3300020814 | Granular Sludge | MKRRVTFVALAVIGLAAIALGVFRYGDPETIHRFAAQI |
| Ga0212126_10077803 | 3300022547 | Hot Spring Sediment | MKRRVIFAAVVLVGLAAVAVGIARGDFETIHRFAAQI |
| Ga0212121_1000050928 | 3300022556 | Anoxic Lake Water | VKRKISFVVLAVIGVAAIVFGIKAGNPETIHRFAAQI |
| Ga0212121_100031667 | 3300022556 | Anoxic Lake Water | VKRRVAFVVLAVAGIAAVVLGIRAGDPETIHRFAAQI |
| Ga0212121_100090175 | 3300022556 | Anoxic Lake Water | VKRKISFVVLAVIGAAAVVLGIKAGDPETIHRFAAQI |
| Ga0212121_100113122 | 3300022556 | Anoxic Lake Water | MKRRVSFIILAVVGVVAVVLGIKAGDPETIHRFAAQI |
| Ga0212121_100562973 | 3300022556 | Anoxic Lake Water | VKRRVSFVILALVGIAAIVLGLKAGDPETIHRFAAQI |
| (restricted) Ga0233423_100003987 | 3300023177 | Freshwater | VKRRISFIVLAVVGVAAVVLGIRAGDPETIHRFAAQI |
| (restricted) Ga0233425_101240202 | 3300024054 | Freshwater | MKRRVAFVVLAVVGIAAIALGITKGDPETIHRFAAQI |
| Ga0209610_12245971 | 3300025136 | Anoxic Lake Water | NSSVRSRVKRRVAFVVLAVAGIAAVVLGIRAGDPETIHRFAAQI |
| Ga0208046_10003106 | 3300025285 | Freshwater | VKRRIVFTLLAVIGVVAVVLGIRFGDPETIHRFAAQI |
| Ga0208102_10849602 | 3300025447 | Freshwater | VKRKVSFVILAVVGVVAVVLGIKAGNPETIHRFAAQI |
| Ga0209227_10310472 | 3300026293 | Anoxygenic And Chlorotrophic Microbial Mat | MVRRIVFIVSALAGMGAVVVGVVLRNLETIHRFAAQI |
| Ga0209397_102280182 | 3300027871 | Wetland | MKRRIVFAILAAAGVAAAVAGIIAGNPETIHRFAAQI |
| Ga0209777_100129722 | 3300027896 | Freshwater Lake Sediment | MARRLAFGLLLAGGVAAIVLGIARGDPETIHRFASQI |
| Ga0209777_100823313 | 3300027896 | Freshwater Lake Sediment | MRRKVTFVILAVVGVAAVVLGIKAGNPETIHRFAAQI |
| Ga0209048_103091772 | 3300027902 | Freshwater Lake Sediment | VKRKVSFVILAVVGVVVVVLGIKAGNPETIHRFAAQI |
| Ga0209536_1000202605 | 3300027917 | Marine Sediment | MKRRIAFGVLAALGVVAVVLGIVKGDPETIHRFAAQI |
| Ga0268281_10147022 | 3300028156 | Saline Water | MKRRIAFILVAVIGIVAVVLGIMAGDPETIHRFAAQI |
| Ga0265595_11005442 | 3300028191 | Saline Water | MKRRVAFVLLAVIGIAAVVLGIRFGDPETIHRFAAQI |
| Ga0272441_104159471 | 3300028920 | Marine Sediment | MKRRILFGVLAAAGVALVVVGIIKGDPETIHRFAAQI |
| Ga0265604_1259461 | 3300029674 | Marine | MKRRVAFVLLAVIGIAAVVLGIRFGDPETIHRFAAQIWLSCMGLV |
| Ga0272444_107343062 | 3300031111 | Marine Sediment | MKRRILFGVLAAVGVTLVVVGIIKGDPETIHRFAAQI |
| Ga0315534_11390742 | 3300031585 | Salt Marsh Sediment | VKRRVAFVLLAVIGIAAVALGIRFGDPETIHRFAAQI |
| Ga0315293_103337432 | 3300031746 | Sediment | MKRRVAFVILAVVGLTAVVLGIKAGDPETIHRFAAQI |
| Ga0315288_113619972 | 3300031772 | Sediment | MKRRFAFALLVVIGIIAVVMGIRAGDPETIHRFAAQI |
| Ga0315290_111093801 | 3300031834 | Sediment | MKRRIVFILLAVVGVAAVVLGFKAGDPETIHRFAAQI |
| Ga0315274_101403992 | 3300031999 | Sediment | VKRRISFVILAVVGVAAVILGIRAGDPETIHRFAAQI |
| Ga0315282_100090176 | 3300032069 | Sediment | MARRITFIVLALAGVAAVALGIKLGDPETIHRFASQI |
| Ga0315277_1000053948 | 3300032118 | Sediment | MKRRVAFALLAVIGVAAVVLGIRAGDPETIHRFAAQI |
| Ga0315281_101181552 | 3300032163 | Sediment | MKRRIAFILLAVIGVAAVVLGIKVGDPETIHRFAAQI |
| Ga0315281_108372511 | 3300032163 | Sediment | VKRRVSFIILAVIGVMAVVLGIKAGNPETIHRFAAQI |
| Ga0315273_101208402 | 3300032516 | Sediment | VKRRISFVILAVVGVAVVVMGIKAGDPETIHRFASQI |
| Ga0335070_108135652 | 3300032829 | Soil | VKRRISFVILAVLGVVALVVGIKAGNPETIHRFAAQI |
| Ga0335069_100422632 | 3300032893 | Soil | LKRKVTFVILAVVGLVVVVLGIKAGNPETIHRFAAQI |
| Ga0335071_106499942 | 3300032897 | Soil | VKRRISFIILAMAGVAAVVLGITAGNPETIHRFAAQI |
| Ga0316622_1000002907 | 3300033416 | Soil | VKRRISFVILAVVGVAAVVLGIRAGDPETIHRFAAQI |
| Ga0316622_1000184527 | 3300033416 | Soil | VKRRVAFVILAAVGIAAVVLGIKAGDPETIHRFAAQI |
| Ga0316622_1000803802 | 3300033416 | Soil | MRRRVAFVLLAVIGVAAVVLGIKAGDPETIHRFAAQI |
| Ga0316622_1004002792 | 3300033416 | Soil | MKRRVVFIFVALAGLAAVVLGITKGDPETIHRFAAQI |
| Ga0316622_1004526102 | 3300033416 | Soil | VKRRVAFAVLAVVGIAAIVLGIRAGDPETIHRFAAQI |
| Ga0316622_1013810341 | 3300033416 | Soil | AAAHQPVLVVKRRVSFVILAVVGVAAVVLGIRAGDPETIHRFAAQI |
| Ga0326726_107378862 | 3300033433 | Peat Soil | VKRKFSFAILAVVGVVAVVLGIKAGNPETIHRFAAQI |
| Ga0316620_101769932 | 3300033480 | Soil | VKRRVAFVILAVVGLGAVLLGIKAGDPETIHRFAAQI |
| Ga0316620_103357912 | 3300033480 | Soil | LKRRVSFVILAVIGVAAVVMGIRAGDPETIHRFAAQI |
| Ga0316620_117712391 | 3300033480 | Soil | MKRRVAFILLVLIGAAAAVMGIRAGDPETIHRFAAQI |
| Ga0316600_102659182 | 3300033481 | Soil | VKRRIVSAILVAAGVAAAVAGIIAGNPETIHRFAAQI |
| Ga0316627_1020539462 | 3300033482 | Soil | MKRRIAFALLAVIGVAAVVIGIRAGDPETIHRFAAQI |
| Ga0316627_1024549951 | 3300033482 | Soil | VKRRTVFIVLAVVGIVAVAVGITKGDPETIHRFAAQI |
| Ga0316627_1030235901 | 3300033482 | Soil | VKRKIIFVILAAAGVSAVVAGIVAGDPETIHRFAAQI |
| Ga0316624_108117992 | 3300033486 | Soil | MKRRVAFILLALIGMAAAVMGIRAGDPETIHRFAAQI |
| Ga0316630_112120412 | 3300033487 | Soil | VKRRISFIILAVAGVAAVVLGIRAGDPETIHRFAAQI |
| Ga0316628_1000875812 | 3300033513 | Soil | MKRRVVFILLALAGLAAVVLGITKGDPETIHRFAAQI |
| Ga0316628_1015245841 | 3300033513 | Soil | VKRRISFVILAVVGLVAVVLGIKAGDPETIHRFAAQI |
| Ga0316628_1039377122 | 3300033513 | Soil | NSSVRSSVKRRVAFVVLAVVGIAAVVLGIRAGDPETVHRFAAQI |
| Ga0316616_1001280392 | 3300033521 | Soil | VKRRVSFVILAVLGFAVVVLGIRAGDPETIHRFAAQI |
| Ga0316616_1012951272 | 3300033521 | Soil | MKRRIAFVVIAVIGLAAVALGIKFGDPETIHRFASQI |
| Ga0316617_1004366802 | 3300033557 | Soil | MKRRIAFALLAVIGVAAVVIGIRVGDPETIHRFAAQI |
| Ga0316617_1004851102 | 3300033557 | Soil | VKRRVSFVILAVLGVAAVVLGIKAGDPETIHRFAAQI |
| Ga0316617_1018169132 | 3300033557 | Soil | MKRRISFAILAVIGVAAVVLGIGAGDPETIHRFAAQI |
| Ga0316617_1022070672 | 3300033557 | Soil | RVKRKLPFILLAAAGIALVAFGIVKDDPETIHRFAAQI |
| ⦗Top⦘ |