


| Basic Information | |
|---|---|
| Family ID | F100979 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMHEKVN |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.84 % |
| % of genes near scaffold ends (potentially truncated) | 34.31 % |
| % of genes from short scaffolds (< 2000 bps) | 64.71 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.255 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (46.078 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 5.88 |
| PF13884 | Peptidase_S74 | 3.92 |
| PF14464 | Prok-JAB | 2.94 |
| PF07484 | Collar | 0.98 |
| PF05939 | Phage_min_tail | 0.98 |
| PF13550 | Phage-tail_3 | 0.98 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
| PF13385 | Laminin_G_3 | 0.98 |
| PF05100 | Phage_tail_L | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.98 |
| COG4718 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.78 % |
| Unclassified | root | N/A | 37.25 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002231|KVRMV2_100438515 | Not Available | 815 | Open in IMG/M |
| 3300002242|KVWGV2_10194971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 836 | Open in IMG/M |
| 3300002482|JGI25127J35165_1003265 | Not Available | 4373 | Open in IMG/M |
| 3300002482|JGI25127J35165_1032793 | Not Available | 1184 | Open in IMG/M |
| 3300002488|JGI25128J35275_1001684 | Not Available | 6513 | Open in IMG/M |
| 3300003075|Ga0051126_10660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured gamma proteobacterium HF0070_03O15 | 506 | Open in IMG/M |
| 3300004951|Ga0068513_1013788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 858 | Open in IMG/M |
| 3300006027|Ga0075462_10006440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 3810 | Open in IMG/M |
| 3300006027|Ga0075462_10046771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1378 | Open in IMG/M |
| 3300006027|Ga0075462_10152514 | All Organisms → Viruses | 706 | Open in IMG/M |
| 3300006735|Ga0098038_1269930 | All Organisms → Viruses | 533 | Open in IMG/M |
| 3300006749|Ga0098042_1007631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage MED4-117 | 3523 | Open in IMG/M |
| 3300006916|Ga0070750_10082728 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300006919|Ga0070746_10045581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 2303 | Open in IMG/M |
| 3300006928|Ga0098041_1060530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1222 | Open in IMG/M |
| 3300009790|Ga0115012_10215449 | Not Available | 1414 | Open in IMG/M |
| 3300010936|Ga0137784_1012829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Prochlorococcus phage MED4-184 | 4677 | Open in IMG/M |
| 3300010936|Ga0137784_1207772 | Not Available | 928 | Open in IMG/M |
| 3300011013|Ga0114934_10087775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1530 | Open in IMG/M |
| 3300012919|Ga0160422_10149541 | unclassified Hyphomonas → Hyphomonas sp. | 1397 | Open in IMG/M |
| 3300012919|Ga0160422_10158260 | Not Available | 1359 | Open in IMG/M |
| 3300012920|Ga0160423_10015336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage MED4-117 | 5848 | Open in IMG/M |
| 3300012920|Ga0160423_10156624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1597 | Open in IMG/M |
| 3300012920|Ga0160423_10162877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1562 | Open in IMG/M |
| 3300012920|Ga0160423_10168749 | Not Available | 1531 | Open in IMG/M |
| 3300012920|Ga0160423_10306485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1092 | Open in IMG/M |
| 3300012920|Ga0160423_10315761 | All Organisms → Viruses | 1074 | Open in IMG/M |
| 3300012920|Ga0160423_10788059 | Not Available | 639 | Open in IMG/M |
| 3300012928|Ga0163110_10900779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 700 | Open in IMG/M |
| 3300012952|Ga0163180_10001781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12191 | Open in IMG/M |
| 3300012953|Ga0163179_10162210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured gamma proteobacterium HF0070_03O15 | 1681 | Open in IMG/M |
| 3300012954|Ga0163111_12138333 | Not Available | 565 | Open in IMG/M |
| 3300017733|Ga0181426_1008648 | All Organisms → Viruses | 2001 | Open in IMG/M |
| 3300017739|Ga0181433_1144892 | Not Available | 561 | Open in IMG/M |
| 3300017753|Ga0181407_1056332 | Not Available | 1022 | Open in IMG/M |
| 3300017768|Ga0187220_1038160 | All Organisms → Viruses | 1448 | Open in IMG/M |
| 3300017771|Ga0181425_1034992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1652 | Open in IMG/M |
| 3300020248|Ga0211584_1000100 | Not Available | 11345 | Open in IMG/M |
| 3300020269|Ga0211484_1000160 | Not Available | 20811 | Open in IMG/M |
| 3300020281|Ga0211483_10002964 | All Organisms → Viruses | 6082 | Open in IMG/M |
| 3300020281|Ga0211483_10153266 | All Organisms → Viruses | 764 | Open in IMG/M |
| 3300020289|Ga0211621_1003140 | Not Available | 3632 | Open in IMG/M |
| 3300020297|Ga0211490_1050912 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300020378|Ga0211527_10130268 | All Organisms → Viruses | 724 | Open in IMG/M |
| 3300020380|Ga0211498_10003190 | All Organisms → Viruses | 5966 | Open in IMG/M |
| 3300020384|Ga0211596_10135333 | All Organisms → Viruses | 760 | Open in IMG/M |
| 3300020393|Ga0211618_10163251 | Not Available | 772 | Open in IMG/M |
| 3300020394|Ga0211497_10264134 | Not Available | 646 | Open in IMG/M |
| 3300020397|Ga0211583_10216159 | Not Available | 698 | Open in IMG/M |
| 3300020401|Ga0211617_10010361 | All Organisms → Viruses | 4100 | Open in IMG/M |
| 3300020401|Ga0211617_10015711 | All Organisms → Viruses → Predicted Viral | 3263 | Open in IMG/M |
| 3300020402|Ga0211499_10139093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C232 | 884 | Open in IMG/M |
| 3300020409|Ga0211472_10223073 | All Organisms → Viruses | 757 | Open in IMG/M |
| 3300020410|Ga0211699_10216766 | All Organisms → Viruses | 733 | Open in IMG/M |
| 3300020410|Ga0211699_10321736 | unclassified Hyphomonas → Hyphomonas sp. | 605 | Open in IMG/M |
| 3300020417|Ga0211528_10383314 | Not Available | 517 | Open in IMG/M |
| 3300020418|Ga0211557_10117753 | Not Available | 1297 | Open in IMG/M |
| 3300020418|Ga0211557_10164861 | Not Available | 1053 | Open in IMG/M |
| 3300020424|Ga0211620_10005949 | All Organisms → Viruses | 5497 | Open in IMG/M |
| 3300020424|Ga0211620_10262521 | Not Available | 737 | Open in IMG/M |
| 3300020424|Ga0211620_10360625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 618 | Open in IMG/M |
| 3300020432|Ga0211556_10208244 | Not Available | 895 | Open in IMG/M |
| 3300020436|Ga0211708_10014206 | Not Available | 2995 | Open in IMG/M |
| 3300020436|Ga0211708_10036551 | Not Available | 1879 | Open in IMG/M |
| 3300020436|Ga0211708_10194259 | Not Available | 814 | Open in IMG/M |
| 3300020436|Ga0211708_10450553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300020437|Ga0211539_10071300 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1377 | Open in IMG/M |
| 3300020437|Ga0211539_10171738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 887 | Open in IMG/M |
| 3300020442|Ga0211559_10001123 | Not Available | 16188 | Open in IMG/M |
| 3300020451|Ga0211473_10062981 | All Organisms → Viruses | 1868 | Open in IMG/M |
| 3300020451|Ga0211473_10233593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured gamma proteobacterium HF0070_03O15 | 946 | Open in IMG/M |
| 3300020470|Ga0211543_10001329 | Not Available | 16579 | Open in IMG/M |
| 3300020471|Ga0211614_10009750 | All Organisms → cellular organisms → Bacteria | 3996 | Open in IMG/M |
| 3300022065|Ga0212024_1037545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage MED4-117 | 835 | Open in IMG/M |
| 3300022066|Ga0224902_100077 | All Organisms → Viruses → Predicted Viral | 4608 | Open in IMG/M |
| 3300022074|Ga0224906_1011618 | All Organisms → Viruses → Predicted Viral | 3380 | Open in IMG/M |
| 3300022074|Ga0224906_1121041 | Not Available | 757 | Open in IMG/M |
| 3300025101|Ga0208159_1006393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3476 | Open in IMG/M |
| 3300025101|Ga0208159_1039840 | Not Available | 1021 | Open in IMG/M |
| 3300025127|Ga0209348_1000561 | Not Available | 19106 | Open in IMG/M |
| 3300025127|Ga0209348_1002906 | Not Available | 7893 | Open in IMG/M |
| 3300025132|Ga0209232_1012316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 3496 | Open in IMG/M |
| 3300025132|Ga0209232_1048378 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300025132|Ga0209232_1161300 | Not Available | 709 | Open in IMG/M |
| 3300025151|Ga0209645_1109564 | All Organisms → Viruses | 886 | Open in IMG/M |
| 3300025759|Ga0208899_1001650 | Not Available | 15638 | Open in IMG/M |
| 3300025759|Ga0208899_1113936 | All Organisms → Viruses | 984 | Open in IMG/M |
| 3300029302|Ga0135227_1004821 | All Organisms → Viruses | 883 | Open in IMG/M |
| 3300029302|Ga0135227_1027699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured gamma proteobacterium HF0070_03O15 | 611 | Open in IMG/M |
| 3300029308|Ga0135226_1017873 | Not Available | 638 | Open in IMG/M |
| 3300029309|Ga0183683_1009094 | All Organisms → Viruses | 2638 | Open in IMG/M |
| 3300029318|Ga0185543_1005210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 3429 | Open in IMG/M |
| 3300029319|Ga0183748_1001285 | Not Available | 15221 | Open in IMG/M |
| 3300029319|Ga0183748_1004535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6843 | Open in IMG/M |
| 3300029319|Ga0183748_1009349 | All Organisms → Viruses → Predicted Viral | 4183 | Open in IMG/M |
| 3300029319|Ga0183748_1012273 | All Organisms → Viruses | 3455 | Open in IMG/M |
| 3300029792|Ga0183826_1006337 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300029792|Ga0183826_1009326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 1658 | Open in IMG/M |
| 3300029792|Ga0183826_1017021 | All Organisms → Viruses | 1182 | Open in IMG/M |
| 3300029792|Ga0183826_1017396 | All Organisms → Viruses | 1167 | Open in IMG/M |
| 3300029792|Ga0183826_1039116 | Not Available | 739 | Open in IMG/M |
| 3300031774|Ga0315331_10005319 | Not Available | 9681 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 46.08% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.71% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 8.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.84% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.84% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.96% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.98% |
| Coral | Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300003075 | Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - healthy corals | Host-Associated | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010936 | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020384 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KVRMV2_1004385154 | 3300002231 | Marine Sediment | FLKTLSFTSVLVLLLIVALSPLYVTMAIMTRQMAPKVD* |
| KVWGV2_101949711 | 3300002242 | Marine Sediment | MIKFAILKALSFTSVLVLLLIVALSPLYVTMAIMTRQMAP |
| JGI25127J35165_10032653 | 3300002482 | Marine | MIKFAILRALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKMQEKIN* |
| JGI25127J35165_10327931 | 3300002482 | Marine | IKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKIN* |
| JGI25128J35275_10016843 | 3300002488 | Marine | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQLNEKVN* |
| Ga0051126_106602 | 3300003075 | Coral | MVKLAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKTN* |
| Ga0068513_10137883 | 3300004951 | Marine Water | MIKFAILKALSFTSVLVLLLIVALTPLYVTMGIMSRQMTQQKIVD* |
| Ga0075462_100064406 | 3300006027 | Aqueous | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQLNEKVN* |
| Ga0075462_100467714 | 3300006027 | Aqueous | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQLNEKVN* |
| Ga0075462_101525143 | 3300006027 | Aqueous | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN* |
| Ga0098038_12699302 | 3300006735 | Marine | MVKFAILKALSLSSVLVLLLIVAISPLYVTMGIMTRQMQETKN* |
| Ga0098042_10076313 | 3300006749 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKVD* |
| Ga0070750_100827283 | 3300006916 | Aqueous | KFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN* |
| Ga0070746_100455813 | 3300006919 | Aqueous | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKIN* |
| Ga0098041_10605302 | 3300006928 | Marine | MIKFVILKALSFSSVLVLLLILALSPLYITMGIMTRQMQEKVN* |
| Ga0115012_102154492 | 3300009790 | Marine | MMKVVVAKAAAFTSLIVLLLIVTLSPLYVTMGLMTRQIHEKIN* |
| Ga0137784_10128294 | 3300010936 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQDKVN* |
| Ga0137784_12077724 | 3300010936 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQE* |
| Ga0114934_100877752 | 3300011013 | Deep Subsurface | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQMQSDKVN* |
| Ga0160422_101495416 | 3300012919 | Seawater | MVKLMILKALSFTSVLVLLLIVALSPLYVTMGIMTRQMTEKTTP* |
| Ga0160422_101582604 | 3300012919 | Seawater | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQIHEKVN* |
| Ga0160423_100153367 | 3300012920 | Surface Seawater | MIKFAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMHEKVN* |
| Ga0160423_101566244 | 3300012920 | Surface Seawater | FVNMIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQMHEKVN* |
| Ga0160423_101628771 | 3300012920 | Surface Seawater | NACVIFVNMIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQMHEKVN* |
| Ga0160423_101687491 | 3300012920 | Surface Seawater | ALSFSSVLVLLIIVALSPLYVTMGIMTRQMQEKVN* |
| Ga0160423_103064853 | 3300012920 | Surface Seawater | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQQKIID* |
| Ga0160423_103157613 | 3300012920 | Surface Seawater | MVKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQMQEKTN* |
| Ga0160423_107880593 | 3300012920 | Surface Seawater | KALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKIN* |
| Ga0163110_109007793 | 3300012928 | Surface Seawater | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQMHEKVN* |
| Ga0163180_1000178127 | 3300012952 | Seawater | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQDKVN* |
| Ga0163179_101622102 | 3300012953 | Seawater | MVKLAVIKALAFSSVLCLFLILALSPLYVTMGLMTRQMQDKVN* |
| Ga0163111_121383332 | 3300012954 | Surface Seawater | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMHEKVN* |
| Ga0181426_10086483 | 3300017733 | Seawater | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGMMTRQMQDKVN |
| Ga0181433_11448923 | 3300017739 | Seawater | AVIKALSFTSVLVLLLIVALSPLYVTMGLMTRQMTSETK |
| Ga0181407_10563322 | 3300017753 | Seawater | MIKFAILKALSFSSVLVLLLIVAISPLYVTMGIMTRQMQDKVN |
| Ga0187220_10381603 | 3300017768 | Seawater | MIKEQIARATALMSVLVLLLIVTLSPLYVTMGIMTRQMQDKVN |
| Ga0181425_10349922 | 3300017771 | Seawater | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQDKVN |
| Ga0211584_100010014 | 3300020248 | Marine | MIKFAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMTEKKL |
| Ga0211484_100016033 | 3300020269 | Marine | MIRYAVIKALAFSSVLVLLLIVALSPLYVTMGLMTRQINEKVN |
| Ga0211483_100029645 | 3300020281 | Marine | MIKFAILRALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKIN |
| Ga0211483_101532661 | 3300020281 | Marine | IKALAFSSVLCLILILALSPLYVTMGIMTRQMHEKIN |
| Ga0211621_10031409 | 3300020289 | Marine | KALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKIN |
| Ga0211490_10509122 | 3300020297 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQESTR |
| Ga0211527_101302681 | 3300020378 | Marine | ALSFTSVLVLLLIVALSPLYVTMGLMTRQMQEKVN |
| Ga0211498_100031908 | 3300020380 | Marine | MIKFAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMQESTR |
| Ga0211596_101353333 | 3300020384 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMIEKKL |
| Ga0211618_101632513 | 3300020393 | Marine | FAIIKALSFTSVLVLLLILALSPLYVTMSLMTRQMTTETK |
| Ga0211497_102641341 | 3300020394 | Marine | KALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKVN |
| Ga0211583_102161593 | 3300020397 | Marine | ILKALSFSSVLVLLLILALSPLYVTMGLMTRQMQEKVN |
| Ga0211617_100103614 | 3300020401 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTIGLMTRQMQEKVN |
| Ga0211617_100157114 | 3300020401 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVIMGIMTRQMQEKVN |
| Ga0211499_101390933 | 3300020402 | Marine | ILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKIN |
| Ga0211472_102230733 | 3300020409 | Marine | MIKIAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN |
| Ga0211699_102167663 | 3300020410 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQIQEKIN |
| Ga0211699_103217362 | 3300020410 | Marine | MVKFALLKALSFTSVLVLLLIVALSPLYVTMGLMTRQMQEKSR |
| Ga0211528_103833143 | 3300020417 | Marine | KFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKVN |
| Ga0211557_101177534 | 3300020418 | Marine | AILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKTN |
| Ga0211557_101648612 | 3300020418 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQIQEKVN |
| Ga0211620_100059494 | 3300020424 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKIN |
| Ga0211620_102625212 | 3300020424 | Marine | MIRESIAKALAFTSVLVLLLIVALSPLYVTMSLMTRQLQEKTN |
| Ga0211620_103606253 | 3300020424 | Marine | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTKQMIHKSK |
| Ga0211556_102082443 | 3300020432 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKTN |
| Ga0211708_100142061 | 3300020436 | Marine | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQMHEKVN |
| Ga0211708_100365511 | 3300020436 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMT |
| Ga0211708_101942593 | 3300020436 | Marine | IKFAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMQEKVN |
| Ga0211708_104505533 | 3300020436 | Marine | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMT |
| Ga0211539_100713001 | 3300020437 | Marine | ILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN |
| Ga0211539_101717381 | 3300020437 | Marine | ILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKIN |
| Ga0211559_100011232 | 3300020442 | Marine | MIKFTILKALSFSSVLVLLLIVALSPLYVTMGLMTKQMHEKVN |
| Ga0211473_100629814 | 3300020451 | Marine | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKTN |
| Ga0211473_102335931 | 3300020451 | Marine | RIVKASRIFLMVKLAVIKALAFSSVLCLFLILALSPLYVTMGLMTRQMQHKVN |
| Ga0211543_100013294 | 3300020470 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN |
| Ga0211614_100097501 | 3300020471 | Marine | FAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMQESTR |
| Ga0212024_10375451 | 3300022065 | Aqueous | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQLN |
| Ga0224902_1000774 | 3300022066 | Seawater | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQDKVN |
| Ga0224906_10116187 | 3300022074 | Seawater | MIKFAILKALSFSSVLVLLLIVTLSPLYVTMGIMTRQMQDKVN |
| Ga0224906_11210413 | 3300022074 | Seawater | MVKLAVIKALAFSSVLCLFLILALSPLYVTMGLMTRQMQDKVN |
| Ga0208159_10063938 | 3300025101 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKVD |
| Ga0208159_10398403 | 3300025101 | Marine | MIKFVILKALSFSSVLVLLLILALSPLYVTMGIMTRQMQEKVN |
| Ga0209348_100056112 | 3300025127 | Marine | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN |
| Ga0209348_10029062 | 3300025127 | Marine | MIKFAILRALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKVN |
| Ga0209232_10123163 | 3300025132 | Marine | MIKFALLKALSFTSVLVLLLIVALSPLYVTMGLMTRQMQEKTN |
| Ga0209232_10483781 | 3300025132 | Marine | FAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQESSR |
| Ga0209232_11613002 | 3300025132 | Marine | MVKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQLNEKVN |
| Ga0209645_11095643 | 3300025151 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKLN |
| Ga0208899_10016506 | 3300025759 | Aqueous | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGIMTRQLNEKVN |
| Ga0208899_11139363 | 3300025759 | Aqueous | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQLNEKVN |
| Ga0135227_10048213 | 3300029302 | Marine Harbor | MIKFAILKALSFSSVLVLLFILALSPLYVTMGLMTRQMQEKLK |
| Ga0135227_10276991 | 3300029302 | Marine Harbor | LKALSLTSVLVLLLIVALSPLYVTMGLMTRQMQEKVN |
| Ga0135226_10178734 | 3300029308 | Marine Harbor | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQMQESTRADRDWE |
| Ga0183683_10090946 | 3300029309 | Marine | MVKLLIVKTLAFSSVLCLLLILTLSPLYVITGLMTRQMHEKTN |
| Ga0185543_10052101 | 3300029318 | Marine | LKALSFSSVLVLLLIVALSPLYVTMGIMTRQMHEKVN |
| Ga0183748_10012854 | 3300029319 | Marine | MMKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTKQMHEKVN |
| Ga0183748_10045358 | 3300029319 | Marine | MIKFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQLNEKVN |
| Ga0183748_10093491 | 3300029319 | Marine | KFAILKALSFSSVLVLLLIVALSPLYVTMGIMTRQMQEKVN |
| Ga0183748_10122737 | 3300029319 | Marine | MIKFAILKALAFSSVLVLLLIVALSPLYVTMGLMTRQMHEKVN |
| Ga0183826_10063371 | 3300029792 | Marine | LKALSFTSVLVLLLIVALSPLYVTMGLMTRQMQEKIN |
| Ga0183826_10093261 | 3300029792 | Marine | LKALSFTSVLVLLLIVALSPLYVTMGLMTRQMHEKVN |
| Ga0183826_10170211 | 3300029792 | Marine | MIKFAILKALSFSSVLVLLLILALSPLYVTMGLMTR |
| Ga0183826_10173962 | 3300029792 | Marine | MIKFAILKALSFTSVLVLLLIVALSPLYVTMGLMTRQLHEKVN |
| Ga0183826_10391161 | 3300029792 | Marine | KFAILKALSFSSVLVLLLILALSPLYVTMGLMTRQMQEKVN |
| Ga0315331_1000531911 | 3300031774 | Seawater | MVKLAVIKALAFSSVLCLFLILALSPLYVTMGLFTRMQMQEKIY |
| ⦗Top⦘ |