


| Basic Information | |
|---|---|
| Family ID | F095628 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 40.95 % |
| % of genes from short scaffolds (< 2000 bps) | 76.19 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (59.048 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine (39.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00202 | Aminotran_3 | 49.52 |
| PF13414 | TPR_11 | 5.71 |
| PF03144 | GTP_EFTU_D2 | 1.90 |
| PF13370 | Fer4_13 | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF01865 | PhoU_div | 0.95 |
| PF02737 | 3HCDH_N | 0.95 |
| PF13431 | TPR_17 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.95 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.95 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.81 % |
| Unclassified | root | N/A | 36.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573026|GS311G0146KB_1112118313163 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 837 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1064274 | Not Available | 576 | Open in IMG/M |
| 3300000247|LPaug09P26500mDRAFT_1016426 | All Organisms → cellular organisms → Archaea | 1106 | Open in IMG/M |
| 3300000247|LPaug09P26500mDRAFT_1025463 | Not Available | 791 | Open in IMG/M |
| 3300000248|LPfeb09P12500mDRAFT_1003773 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 2544 | Open in IMG/M |
| 3300000252|LPjun08P161000mDRAFT_1000042 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 9479 | Open in IMG/M |
| 3300000259|LP_J_08_P26_500DRAFT_1001294 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 4935 | Open in IMG/M |
| 3300000264|LP_A_09_P04_500DRAFT_1002240 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 3231 | Open in IMG/M |
| 3300000322|LPaug08P121000mDRAFT_1033252 | Not Available | 593 | Open in IMG/M |
| 3300000323|LPaug09P202000mDRAFT_1016086 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1262 | Open in IMG/M |
| 3300000323|LPaug09P202000mDRAFT_1035634 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 701 | Open in IMG/M |
| 3300001783|Vondamm_10029524 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1849 | Open in IMG/M |
| 3300001783|Vondamm_10061796 | Not Available | 1097 | Open in IMG/M |
| 3300001974|GOS2246_10049508 | Not Available | 1338 | Open in IMG/M |
| 3300002177|JGI24816J26688_1036823 | Not Available | 912 | Open in IMG/M |
| 3300002956|JGI26059J44795_1068048 | Not Available | 503 | Open in IMG/M |
| 3300002965|JGI26063J44948_1090551 | Not Available | 540 | Open in IMG/M |
| 3300003147|Ga0052235_1054488 | All Organisms → cellular organisms → Archaea | 5674 | Open in IMG/M |
| 3300003538|FS904DNA_1117822 | Not Available | 699 | Open in IMG/M |
| 3300005399|Ga0066860_10083330 | All Organisms → cellular organisms → Archaea | 1151 | Open in IMG/M |
| 3300005431|Ga0066854_10038075 | Not Available | 1587 | Open in IMG/M |
| 3300005592|Ga0066838_10015820 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300005593|Ga0066837_10040578 | Not Available | 1785 | Open in IMG/M |
| 3300005594|Ga0066839_10042592 | Not Available | 1582 | Open in IMG/M |
| 3300005594|Ga0066839_10127498 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 882 | Open in IMG/M |
| 3300005603|Ga0066853_10053894 | Not Available | 1390 | Open in IMG/M |
| 3300005951|Ga0066379_10224727 | All Organisms → cellular organisms → Archaea | 608 | Open in IMG/M |
| 3300006012|Ga0066374_10090152 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 877 | Open in IMG/M |
| 3300006013|Ga0066382_10120579 | All Organisms → cellular organisms → Archaea | 914 | Open in IMG/M |
| 3300006019|Ga0066375_10119322 | All Organisms → cellular organisms → Archaea | 838 | Open in IMG/M |
| 3300006077|Ga0081594_1296973 | Not Available | 507 | Open in IMG/M |
| 3300006077|Ga0081594_1296996 | Not Available | 507 | Open in IMG/M |
| 3300006078|Ga0081595_1022965 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2107 | Open in IMG/M |
| 3300006078|Ga0081595_1170231 | Not Available | 792 | Open in IMG/M |
| 3300006303|Ga0068490_1096838 | All Organisms → cellular organisms → Archaea | 1227 | Open in IMG/M |
| 3300006303|Ga0068490_1172801 | Not Available | 611 | Open in IMG/M |
| 3300006304|Ga0068504_1211797 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 671 | Open in IMG/M |
| 3300006308|Ga0068470_1176728 | Not Available | 1720 | Open in IMG/M |
| 3300006308|Ga0068470_1285198 | Not Available | 886 | Open in IMG/M |
| 3300006308|Ga0068470_1298816 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3494 | Open in IMG/M |
| 3300006308|Ga0068470_1323973 | All Organisms → cellular organisms → Archaea | 763 | Open in IMG/M |
| 3300006308|Ga0068470_1758616 | All Organisms → cellular organisms → Archaea | 730 | Open in IMG/M |
| 3300006310|Ga0068471_1091713 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 23685 | Open in IMG/M |
| 3300006310|Ga0068471_1200543 | Not Available | 2784 | Open in IMG/M |
| 3300006310|Ga0068471_1258795 | All Organisms → cellular organisms → Archaea | 1484 | Open in IMG/M |
| 3300006310|Ga0068471_1546252 | Not Available | 1756 | Open in IMG/M |
| 3300006310|Ga0068471_1566850 | All Organisms → cellular organisms → Archaea | 1441 | Open in IMG/M |
| 3300006310|Ga0068471_1567441 | All Organisms → cellular organisms → Archaea | 1051 | Open in IMG/M |
| 3300006311|Ga0068478_1121731 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 11454 | Open in IMG/M |
| 3300006315|Ga0068487_1020778 | All Organisms → cellular organisms → Archaea | 3554 | Open in IMG/M |
| 3300006316|Ga0068473_1373383 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006316|Ga0068473_1564599 | Not Available | 634 | Open in IMG/M |
| 3300006316|Ga0068473_1678503 | Not Available | 677 | Open in IMG/M |
| 3300006318|Ga0068475_1048920 | All Organisms → cellular organisms → Archaea | 1473 | Open in IMG/M |
| 3300006325|Ga0068501_1405248 | Not Available | 617 | Open in IMG/M |
| 3300006326|Ga0068477_1481146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 550 | Open in IMG/M |
| 3300006326|Ga0068477_1508490 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 622 | Open in IMG/M |
| 3300006327|Ga0068499_1496093 | Not Available | 1234 | Open in IMG/M |
| 3300006330|Ga0068483_1144621 | All Organisms → cellular organisms → Archaea | 1618 | Open in IMG/M |
| 3300006331|Ga0068488_1135512 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 912 | Open in IMG/M |
| 3300006331|Ga0068488_1261694 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 1139 | Open in IMG/M |
| 3300006335|Ga0068480_1132931 | Not Available | 4928 | Open in IMG/M |
| 3300006335|Ga0068480_1313880 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3650 | Open in IMG/M |
| 3300006338|Ga0068482_1319115 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 670 | Open in IMG/M |
| 3300006338|Ga0068482_1335678 | All Organisms → cellular organisms → Archaea | 799 | Open in IMG/M |
| 3300006339|Ga0068481_1214839 | Not Available | 2364 | Open in IMG/M |
| 3300006339|Ga0068481_1364218 | Not Available | 2407 | Open in IMG/M |
| 3300006339|Ga0068481_1440423 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis chungbukensis | 4198 | Open in IMG/M |
| 3300006339|Ga0068481_1484519 | All Organisms → cellular organisms → Archaea | 1437 | Open in IMG/M |
| 3300006339|Ga0068481_1570933 | Not Available | 1804 | Open in IMG/M |
| 3300006340|Ga0068503_10196947 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 5864 | Open in IMG/M |
| 3300006340|Ga0068503_10207965 | Not Available | 1986 | Open in IMG/M |
| 3300006340|Ga0068503_10463541 | Not Available | 507 | Open in IMG/M |
| 3300006341|Ga0068493_10269495 | All Organisms → cellular organisms → Archaea | 1262 | Open in IMG/M |
| 3300006344|Ga0099695_1030596 | All Organisms → cellular organisms → Archaea | 4902 | Open in IMG/M |
| 3300006346|Ga0099696_1151743 | Not Available | 1886 | Open in IMG/M |
| 3300006346|Ga0099696_1153208 | All Organisms → cellular organisms → Archaea | 1812 | Open in IMG/M |
| 3300006346|Ga0099696_1178520 | Not Available | 1891 | Open in IMG/M |
| 3300006346|Ga0099696_1306021 | Not Available | 551 | Open in IMG/M |
| 3300006346|Ga0099696_1309239 | All Organisms → cellular organisms → Archaea | 663 | Open in IMG/M |
| 3300006347|Ga0099697_1432934 | All Organisms → cellular organisms → Archaea | 874 | Open in IMG/M |
| 3300006414|Ga0099957_1061633 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 7050 | Open in IMG/M |
| 3300006567|Ga0099958_1123577 | Not Available | 2301 | Open in IMG/M |
| 3300006567|Ga0099958_1123897 | Not Available | 1167 | Open in IMG/M |
| 3300006902|Ga0066372_10706677 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 606 | Open in IMG/M |
| 3300006902|Ga0066372_10906342 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 537 | Open in IMG/M |
| 3300007160|Ga0099959_1039807 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 18981 | Open in IMG/M |
| 3300007160|Ga0099959_1132298 | All Organisms → cellular organisms → Archaea | 1305 | Open in IMG/M |
| 3300007291|Ga0066367_1046126 | Not Available | 1532 | Open in IMG/M |
| 3300007508|Ga0105011_1128013 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 917 | Open in IMG/M |
| 3300007509|Ga0105012_1140859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 917 | Open in IMG/M |
| 3300008464|Ga0115336_157550 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300009703|Ga0114933_10799628 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 601 | Open in IMG/M |
| 3300020432|Ga0211556_10315467 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 702 | Open in IMG/M |
| 3300020447|Ga0211691_10352284 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 589 | Open in IMG/M |
| 3300020449|Ga0211642_10405589 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 587 | Open in IMG/M |
| 3300021065|Ga0206686_1004114 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
| 3300024344|Ga0209992_10363445 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 579 | Open in IMG/M |
| 3300029149|Ga0119977_101035 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 725 | Open in IMG/M |
| 3300031775|Ga0315326_10469596 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 811 | Open in IMG/M |
| 3300031861|Ga0315319_10446842 | All Organisms → cellular organisms → Archaea | 647 | Open in IMG/M |
| 3300032360|Ga0315334_10123649 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon | 2019 | Open in IMG/M |
| 3300032360|Ga0315334_11422278 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 595 | Open in IMG/M |
| 3300032820|Ga0310342_102510243 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3 | 616 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 39.05% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 21.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.19% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.90% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 1.90% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 1.90% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.90% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.95% |
| Deep-Ocean Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep-Ocean Sediment | 0.95% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.95% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.95% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.95% |
| Sediment | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573026 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-FOS-0p8-Deep1200 | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000247 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m | Environmental | Open in IMG/M |
| 3300000248 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000252 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P16 1000m | Environmental | Open in IMG/M |
| 3300000259 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500 | Environmental | Open in IMG/M |
| 3300000264 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_500 | Environmental | Open in IMG/M |
| 3300000322 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P12 1000m | Environmental | Open in IMG/M |
| 3300000323 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000m | Environmental | Open in IMG/M |
| 3300001783 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Vondamm Sites | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002177 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_250m | Environmental | Open in IMG/M |
| 3300002956 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300002965 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003147 | Planktonic microbial communities from North Pacific Subtropical Gyre | Environmental | Open in IMG/M |
| 3300003538 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005594 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006077 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid B | Environmental | Open in IMG/M |
| 3300006078 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid C | Environmental | Open in IMG/M |
| 3300006303 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_1_1000m | Environmental | Open in IMG/M |
| 3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006327 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0125m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006344 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0500m | Environmental | Open in IMG/M |
| 3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300008464 | Deep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit | Engineered | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029149 | Marine sediment microbial communities from University of Hong Kong - Deep-ocean Sediment | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS311G0146KB_00562190 | 2189573026 | Marine Estuarine | MVYMYSMNLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI |
| LPjun09P12500mDRAFT_10642742 | 3300000222 | Marine | MVYMYSTNVNFCIRNARAALVMKYGNEPFYDLRASSYA |
| LPaug09P26500mDRAFT_10164262 | 3300000247 | Marine | MVYMYSINLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| LPaug09P26500mDRAFT_10254632 | 3300000247 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRI* |
| LPfeb09P12500mDRAFT_10037731 | 3300000248 | Marine | MYSIYLTFCIRNARAALVMKYGIEPFYDSQASSYA |
| LPjun08P161000mDRAFT_100004215 | 3300000252 | Marine | MVYMYSIHLTFCIRNARAALVMKYGNGPFYDLQASSYAYKMRI* |
| LP_J_08_P26_500DRAFT_10012947 | 3300000259 | Marine | MVYMYSIISPFAYVTQEPLVMKYGIEPFYDSQASSYAYKMRI* |
| LP_A_09_P04_500DRAFT_10022404 | 3300000264 | Marine | MYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMR |
| LPaug08P121000mDRAFT_10332522 | 3300000322 | Marine | MYSTNFFLCIRNTSAALVMNYGNEPVYDLQASSYAYKMRI* |
| LPaug09P202000mDRAFT_10160861 | 3300000323 | Marine | MVYMYSINLNFCIRNARAALVMKYGNEPFYDLRASSYAY |
| LPaug09P202000mDRAFT_10356342 | 3300000323 | Marine | MVYMYSTNFFLCIRNTSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Vondamm_100295243 | 3300001783 | Hydrothermal Vent Plume | MVYMYLINLNFCIRNARAALVMKYGIGPFYDLQASSY |
| Vondamm_100617961 | 3300001783 | Hydrothermal Vent Plume | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSY |
| GOS2246_100495082 | 3300001974 | Marine | MIAIKDHFWKICCIVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| JGI24816J26688_10368232 | 3300002177 | Marine | MVYMYSIYLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRI* |
| JGI26059J44795_10680482 | 3300002956 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| JGI26063J44948_10905512 | 3300002965 | Marine | MVYMYSMNVNFCIRNARAALVMKYGNEPFYDLRASSYAYKMW |
| Ga0052235_10544884 | 3300003147 | Marine | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKIGFDQNDQI* |
| FS904DNA_11178222 | 3300003538 | Diffuse Hydrothermal Flow Volcanic Vent | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI* |
| Ga0066860_100833302 | 3300005399 | Marine | MYSTDFFLCIRNSSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0066854_100380752 | 3300005431 | Marine | MYSIHVTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRFDKLFKS |
| Ga0066838_100158203 | 3300005592 | Marine | MYSIHVTFCIRNARAALVMKYGSEPVYDLQASSYAYKMWI* |
| Ga0066837_100405782 | 3300005593 | Marine | MIAIKDHFRKICCTVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0066839_100425922 | 3300005594 | Marine | MYSTNFFLCIRNSSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0066839_101274982 | 3300005594 | Marine | MVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0066853_100538942 | 3300005603 | Marine | MVYMYSIHVTFCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| Ga0066379_102247272 | 3300005951 | Marine | MVYMYLINLTSCIRNARAALVMKYGIGPFYDLRAS |
| Ga0066374_100901522 | 3300006012 | Marine | MYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0066382_101205792 | 3300006013 | Marine | MVYMYSTNFFLCIRNSSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0066375_101193221 | 3300006019 | Marine | MYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKM |
| Ga0081594_12969731 | 3300006077 | Diffuse Hydrothermal Fluid | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSYA |
| Ga0081594_12969962 | 3300006077 | Diffuse Hydrothermal Fluid | MVYMYLINLNFCIRNARAALVMKYGIGPFYDLQPPVTH |
| Ga0081595_10229653 | 3300006078 | Diffuse Hydrothermal Fluids | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDLQASSYAYK |
| Ga0081595_11702312 | 3300006078 | Diffuse Hydrothermal Fluids | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKMWI* |
| Ga0068490_10968381 | 3300006303 | Marine | YSTNFFLCIRNSSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0068490_11728012 | 3300006303 | Marine | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| Ga0068504_12117971 | 3300006304 | Marine | MYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKM* |
| Ga0068470_11767283 | 3300006308 | Marine | MVYMYSINLNYCIRNARAALVMKYGNEPFYDLRASSYAYKM |
| Ga0068470_12851982 | 3300006308 | Marine | MYSIHVTFCIRNARAALVMKYGNEPFYDLQASSYAYKMRI* |
| Ga0068470_12988165 | 3300006308 | Marine | MVYMYSIHLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068470_13239732 | 3300006308 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDSQAS |
| Ga0068470_17586161 | 3300006308 | Marine | MVYMYLINLTFCIRNARAALVMKYGIGPFYDLEPPITH |
| Ga0068471_109171318 | 3300006310 | Marine | MYSIHVTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRI* |
| Ga0068471_12005432 | 3300006310 | Marine | MVYMYSIHLTFCIRNARAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0068471_12587952 | 3300006310 | Marine | ICCTVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0068471_15462522 | 3300006310 | Marine | MYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRI* |
| Ga0068471_15668502 | 3300006310 | Marine | MYSTNFFQLLRNTSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0068471_15674412 | 3300006310 | Marine | MYSIDVTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI* |
| Ga0068471_15873672 | 3300006310 | Marine | MVYMYLINLTSCIRNARAALVMKYGIGPFYDLEPPITHTK* |
| Ga0068478_112173120 | 3300006311 | Marine | MYSIHLTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI* |
| Ga0068487_10207781 | 3300006315 | Marine | MVYMYSIELNFCIRNARAALVMKYGSGPFYDLQASSYAYKMWI* |
| Ga0068473_13733832 | 3300006316 | Marine | VYMYLINLNLCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068473_15645992 | 3300006316 | Marine | MVYMYSTNLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWIRPNTQI* |
| Ga0068473_16785032 | 3300006316 | Marine | MVYMYSINLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWF |
| Ga0068475_10489202 | 3300006318 | Marine | MVYMYSISLNFCIRNARAALVMKYGIGPFYDLQASSYAYKMWI* |
| Ga0068501_14052482 | 3300006325 | Marine | MYFLFSFCTVYKYLLHQSFRIRHSRAALVMKYGIEPFYDSQASSYAYNMRI* |
| Ga0068477_14811461 | 3300006326 | Marine | MVYMYSININFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068477_15084901 | 3300006326 | Marine | IYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0068499_14960932 | 3300006327 | Marine | LNGLYVFNDLNFCIRNARAALVMKYGSGPFYDLQASSYAYKMWI* |
| Ga0068483_11446212 | 3300006330 | Marine | MVYMYSMNVNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068488_11355121 | 3300006331 | Marine | MVYMYSMNVNFCIRNASAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068488_12616942 | 3300006331 | Marine | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASNYAYKMRI* |
| Ga0068480_11329313 | 3300006335 | Marine | MVYKYIFYQGFRIVTSSAALVMKYGNGPFYDLQASSYAYKMWI* |
| Ga0068480_13138804 | 3300006335 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRFDRMIKSEM* |
| Ga0068482_13191152 | 3300006338 | Marine | MYFIHPTLCIRNARAALVMKYGNEPFYDLQASSYAYKMRF* |
| Ga0068482_13356781 | 3300006338 | Marine | MVYMYSINLNFCIRNARAALVMKYGSGPFYDLQASSYAYKMW |
| Ga0068481_12148392 | 3300006339 | Marine | MVYMYSIHLSFCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| Ga0068481_13642182 | 3300006339 | Marine | MVYMYSIHVTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI* |
| Ga0068481_14404232 | 3300006339 | Marine | MYSIHVTFCIRNARAALVMKYGIEPFYDSQAPVTHTK* |
| Ga0068481_14845192 | 3300006339 | Marine | MVYMYLINLTFCIRNARAALVMKYGNGPFYDLQASSYAYKMWI* |
| Ga0068481_15709333 | 3300006339 | Marine | MVYMYSINLNLCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0068503_101969479 | 3300006340 | Marine | MYSIHLTFCIRNARAALVMKYGNGPFYDLQASSYAYKMSFDKL |
| Ga0068503_102079652 | 3300006340 | Marine | MVYMYSMNLNFCIRNTSAALVMNYGNEPVYDLQASSYAYKMRI* |
| Ga0068503_104635412 | 3300006340 | Marine | MVYMYSINLNFCIRNARAALVMKYGIGPFYDLQASSYAYKMWI |
| Ga0068493_102694952 | 3300006341 | Marine | MYFIYVESCIRNTSAALVMKYGIVPLYDLQDSSYAYKMRI* |
| Ga0099695_10305963 | 3300006344 | Marine | IIFKVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0099696_11517432 | 3300006346 | Marine | MVYMYSTECQLLHSNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0099696_11532082 | 3300006346 | Marine | MVYMYSTKIDFCIRNARAALVMKYGSEPFYDLRASSYAYKMWI* |
| Ga0099696_11785202 | 3300006346 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMWI* |
| Ga0099696_13060212 | 3300006346 | Marine | MVYMYSTNVNFCIRNARAALVMKYGNEPFYDLQASSYAYKM* |
| Ga0099696_13092392 | 3300006346 | Marine | MYLINFTSCIRNARAALVMKYGIVPFYDLQASSYAYKMRI* |
| Ga0099697_14329342 | 3300006347 | Marine | MVYMYSTDVNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI* |
| Ga0099957_10616332 | 3300006414 | Marine | MYSIHVTFCIRNARAALVMKYGIEPFYDLQASSYAYKMRI* |
| Ga0099958_11235772 | 3300006567 | Marine | MVYMYSMNLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMRI* |
| Ga0099958_11238971 | 3300006567 | Marine | MVYMYSIHLTFCIRNARAALVMKYGIGPFYDLQAS |
| Ga0066372_107066771 | 3300006902 | Marine | KICCTVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
| Ga0066372_109063422 | 3300006902 | Marine | SINVNSCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| Ga0099959_103980725 | 3300007160 | Marine | MYSIHLTFCIRNARAALVMKYGIGPFYDLQASSYAYKMRI* |
| Ga0099959_11322982 | 3300007160 | Marine | MYSIHLTFCIRNARAALVMKYGNGPFYDLQASSYAYKMWI* |
| Ga0066367_10461261 | 3300007291 | Marine | MYSINFFLCIRNTSAALVMNYGNEPVYDLQASSYA |
| Ga0105011_11280131 | 3300007508 | Marine | VYMYLMNLNFCIRNARAALVMKYGSGPFYDLQASSYAYKMWV* |
| Ga0105012_11408591 | 3300007509 | Marine | VYMYLMNLNFCIRNARAALVMKYGSGPFYDLQASSYAYKMWI* |
| Ga0115336_1575501 | 3300008464 | Sediment | YMYLRDFCFCIRNPSAALAMKYGSEPFYDSWASSYAYKMRI* |
| Ga0114933_107996282 | 3300009703 | Deep Subsurface | YMYFIYVESCIRNTSAALVMKYGIVPLYDLQASNYAYKMRI* |
| Ga0211556_103154672 | 3300020432 | Marine | YLMNLNFCIRNARAALVMKYGSGPFYDLQASSYAYKMWI |
| Ga0211691_103522841 | 3300020447 | Marine | MYSINFFLCIRNTSAALVMNYGNEPVYDLQASNYAYKMRI |
| Ga0211642_104055891 | 3300020449 | Marine | YSTNFFLCIRNTSAALVMNYGNEPVYDLQASSYAYKMRI |
| Ga0206686_10041143 | 3300021065 | Seawater | MVYMYSIHLTFCIRNARAALVMKYGIEPFYDSQASSYAYKMRI |
| Ga0209992_103634452 | 3300024344 | Deep Subsurface | INLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI |
| Ga0119977_1010351 | 3300029149 | Deep-Ocean Sediment | VYMYLRDFCFCIRNPSAALAMKYGSEPFYDSWASSYAYKMRI |
| Ga0315326_104695962 | 3300031775 | Seawater | MYSINLNFCIRNARAALVMKYGNEPFYDLRASSYAYKMWI |
| Ga0315319_104468421 | 3300031861 | Seawater | MYSIHLTFCIRNARAALVMKYGIEPFYDLQASSYA |
| Ga0315334_101236491 | 3300032360 | Seawater | MYSIHVTFCIRNARAALVMKYGIEPFYDLQASSYA |
| Ga0315334_114222782 | 3300032360 | Seawater | VYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI |
| Ga0310342_1025102432 | 3300032820 | Seawater | QPISSYCIRNTSAALVMNYGNEPVYDLQASSYAYKMRI |
| ⦗Top⦘ |