


| Basic Information | |
|---|---|
| Family ID | F093968 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTHRDGFPRFSARSAWRGDAGHRKARATPSESLGKPP |
| Number of Associated Samples | 43 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.06 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 76.42 % |
| Associated GOLD sequencing projects | 38 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.245 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (42.453 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.434 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (47.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01527 | HTH_Tnp_1 | 1.89 |
| PF13432 | TPR_16 | 1.89 |
| PF13371 | TPR_9 | 1.89 |
| PF04314 | PCuAC | 1.89 |
| PF08238 | Sel1 | 0.94 |
| PF00196 | GerE | 0.94 |
| PF14597 | Lactamase_B_5 | 0.94 |
| PF00775 | Dioxygenase_C | 0.94 |
| PF02775 | TPP_enzyme_C | 0.94 |
| PF13439 | Glyco_transf_4 | 0.94 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.94 |
| PF13545 | HTH_Crp_2 | 0.94 |
| PF01717 | Meth_synt_2 | 0.94 |
| PF06808 | DctM | 0.94 |
| PF03444 | HrcA_DNA-bdg | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| PF00813 | FliP | 0.94 |
| PF13416 | SBP_bac_8 | 0.94 |
| PF04952 | AstE_AspA | 0.94 |
| PF13469 | Sulfotransfer_3 | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF08241 | Methyltransf_11 | 0.94 |
| PF00171 | Aldedh | 0.94 |
| PF13378 | MR_MLE_C | 0.94 |
| PF00989 | PAS | 0.94 |
| PF13085 | Fer2_3 | 0.94 |
| PF08544 | GHMP_kinases_C | 0.94 |
| PF13336 | AcetylCoA_hyd_C | 0.94 |
| PF04055 | Radical_SAM | 0.94 |
| PF00571 | CBS | 0.94 |
| PF11902 | DUF3422 | 0.94 |
| PF00805 | Pentapeptide | 0.94 |
| PF13714 | PEP_mutase | 0.94 |
| PF03476 | MOSC_N | 0.94 |
| PF00378 | ECH_1 | 0.94 |
| PF07969 | Amidohydro_3 | 0.94 |
| PF03372 | Exo_endo_phos | 0.94 |
| PF01497 | Peripla_BP_2 | 0.94 |
| PF02776 | TPP_enzyme_N | 0.94 |
| PF13641 | Glyco_tranf_2_3 | 0.94 |
| PF04828 | GFA | 0.94 |
| PF10414 | CysG_dimeriser | 0.94 |
| PF02108 | FliH | 0.94 |
| PF13533 | Biotin_lipoyl_2 | 0.94 |
| PF01799 | Fer2_2 | 0.94 |
| PF13936 | HTH_38 | 0.94 |
| PF14602 | Hexapep_2 | 0.94 |
| PF12697 | Abhydrolase_6 | 0.94 |
| PF01207 | Dus | 0.94 |
| PF07311 | Dodecin | 0.94 |
| PF01968 | Hydantoinase_A | 0.94 |
| PF00583 | Acetyltransf_1 | 0.94 |
| PF13489 | Methyltransf_23 | 0.94 |
| PF14824 | Sirohm_synth_M | 0.94 |
| PF04386 | SspB | 0.94 |
| PF05721 | PhyH | 0.94 |
| PF08755 | YccV-like | 0.94 |
| PF02615 | Ldh_2 | 0.94 |
| PF04107 | GCS2 | 0.94 |
| PF00043 | GST_C | 0.94 |
| PF08450 | SGL | 0.94 |
| PF13617 | Lipoprotein_19 | 0.94 |
| PF01638 | HxlR | 0.94 |
| PF03738 | GSP_synth | 0.94 |
| PF00166 | Cpn10 | 0.94 |
| PF07027 | DUF1318 | 0.94 |
| PF13844 | Glyco_transf_41 | 0.94 |
| PF10431 | ClpB_D2-small | 0.94 |
| PF13023 | HD_3 | 0.94 |
| PF00977 | His_biosynth | 0.94 |
| PF11739 | DctA-YdbH | 0.94 |
| PF02581 | TMP-TENI | 0.94 |
| PF00106 | adh_short | 0.94 |
| PF13091 | PLDc_2 | 0.94 |
| PF03449 | GreA_GreB_N | 0.94 |
| PF00581 | Rhodanese | 0.94 |
| PF02538 | Hydantoinase_B | 0.94 |
| PF16326 | ABC_tran_CTD | 0.94 |
| PF00892 | EamA | 0.94 |
| PF01323 | DSBA | 0.94 |
| PF06271 | RDD | 0.94 |
| PF03328 | HpcH_HpaI | 0.94 |
| PF03725 | RNase_PH_C | 0.94 |
| PF10518 | TAT_signal | 0.94 |
| PF01583 | APS_kinase | 0.94 |
| PF03466 | LysR_substrate | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.89 |
| COG1317 | Flagellar biosynthesis/type III secretory pathway protein FliH | Cell motility [N] | 1.89 |
| COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 1.89 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.94 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.94 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.94 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.94 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.94 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.94 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.94 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.94 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.94 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.94 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.94 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.94 |
| COG2969 | Stringent starvation protein B, binds SsrA peptide | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.94 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.94 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.94 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.94 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG3784 | Uncharacterized conserved protein YdbL, DUF1318 family | Function unknown [S] | 0.94 |
| COG3785 | Heat shock protein HspQ | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.94 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.94 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.94 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.94 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.19 % |
| Unclassified | root | N/A | 19.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001459|MCRcombined_1053992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300001781|Deep_1000929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 17593 | Open in IMG/M |
| 3300003885|Ga0063294_10424419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 806 | Open in IMG/M |
| 3300005590|Ga0070727_10389679 | Not Available | 776 | Open in IMG/M |
| 3300006002|Ga0066368_10011291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3145 | Open in IMG/M |
| 3300006340|Ga0068503_10014381 | Not Available | 1433 | Open in IMG/M |
| 3300006420|Ga0082248_10020960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1165 | Open in IMG/M |
| 3300006900|Ga0066376_10255001 | Not Available | 1035 | Open in IMG/M |
| 3300006900|Ga0066376_10331461 | Not Available | 882 | Open in IMG/M |
| 3300006900|Ga0066376_10431801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin1 | 750 | Open in IMG/M |
| 3300006900|Ga0066376_10526229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300008463|Ga0115335_104944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2358 | Open in IMG/M |
| 3300009030|Ga0114950_10001446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 17887 | Open in IMG/M |
| 3300009030|Ga0114950_10080189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2591 | Open in IMG/M |
| 3300009030|Ga0114950_10303552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1286 | Open in IMG/M |
| 3300009030|Ga0114950_10678495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 817 | Open in IMG/M |
| 3300009030|Ga0114950_11302089 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009102|Ga0114948_10138886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1678 | Open in IMG/M |
| 3300009102|Ga0114948_10143081 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300009102|Ga0114948_10454802 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300009102|Ga0114948_10469904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 956 | Open in IMG/M |
| 3300009102|Ga0114948_10475460 | Not Available | 950 | Open in IMG/M |
| 3300009102|Ga0114948_10566205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 872 | Open in IMG/M |
| 3300009102|Ga0114948_10682331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 795 | Open in IMG/M |
| 3300009139|Ga0114949_10880840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300009702|Ga0114931_10001112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 34223 | Open in IMG/M |
| 3300009702|Ga0114931_10599081 | Not Available | 681 | Open in IMG/M |
| 3300010430|Ga0118733_101959877 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300010430|Ga0118733_103915091 | Not Available | 801 | Open in IMG/M |
| 3300010883|Ga0133547_10376746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2911 | Open in IMG/M |
| 3300010933|Ga0137936_1023158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 702 | Open in IMG/M |
| 3300010933|Ga0137936_1025584 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300011112|Ga0114947_10020280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum | 3335 | Open in IMG/M |
| 3300011112|Ga0114947_10130185 | Not Available | 1579 | Open in IMG/M |
| 3300011112|Ga0114947_10150887 | Not Available | 1484 | Open in IMG/M |
| 3300011112|Ga0114947_10164829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1428 | Open in IMG/M |
| 3300011112|Ga0114947_10239176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1213 | Open in IMG/M |
| 3300011112|Ga0114947_10279268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 1131 | Open in IMG/M |
| 3300011112|Ga0114947_10570974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300011112|Ga0114947_10643556 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300011112|Ga0114947_10691289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 740 | Open in IMG/M |
| 3300011112|Ga0114947_10901164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300011112|Ga0114947_11171874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 574 | Open in IMG/M |
| 3300011112|Ga0114947_11209926 | Not Available | 565 | Open in IMG/M |
| 3300011112|Ga0114947_11447523 | Not Available | 518 | Open in IMG/M |
| 3300011112|Ga0114947_11507890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 508 | Open in IMG/M |
| 3300011112|Ga0114947_11546770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 502 | Open in IMG/M |
| 3300020230|Ga0212167_1280845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1028 | Open in IMG/M |
| 3300020230|Ga0212167_1281173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1020 | Open in IMG/M |
| 3300020231|Ga0212168_1030323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300020231|Ga0212168_1129702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
| 3300020231|Ga0212168_1305574 | Not Available | 1042 | Open in IMG/M |
| 3300020231|Ga0212168_1382529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300020231|Ga0212168_1430731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1668 | Open in IMG/M |
| 3300020232|Ga0212226_105492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1877 | Open in IMG/M |
| 3300020232|Ga0212226_172147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3966 | Open in IMG/M |
| 3300020232|Ga0212226_177581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 6136 | Open in IMG/M |
| 3300020234|Ga0212227_1030109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2510 | Open in IMG/M |
| 3300020234|Ga0212227_1034098 | Not Available | 1392 | Open in IMG/M |
| 3300020234|Ga0212227_1135363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 3880 | Open in IMG/M |
| 3300020234|Ga0212227_1189279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1177 | Open in IMG/M |
| 3300020234|Ga0212227_1260206 | Not Available | 1093 | Open in IMG/M |
| 3300020235|Ga0212228_1189048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1639 | Open in IMG/M |
| 3300020235|Ga0212228_1413897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1842 | Open in IMG/M |
| 3300020364|Ga0211538_1003026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 8692 | Open in IMG/M |
| 3300020389|Ga0211680_10124030 | Not Available | 1049 | Open in IMG/M |
| 3300020423|Ga0211525_10004218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10724 | Open in IMG/M |
| 3300020423|Ga0211525_10054948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1873 | Open in IMG/M |
| 3300022227|Ga0187827_10065941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2818 | Open in IMG/M |
| 3300023442|Ga0256751_1027979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2046 | Open in IMG/M |
| 3300024058|Ga0209997_10004855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 5215 | Open in IMG/M |
| 3300024058|Ga0209997_10107794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1310 | Open in IMG/M |
| 3300024058|Ga0209997_10256043 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300024058|Ga0209997_10381011 | Not Available | 693 | Open in IMG/M |
| 3300024060|Ga0209987_10056916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2209 | Open in IMG/M |
| 3300024431|Ga0209988_10179112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1261 | Open in IMG/M |
| 3300024431|Ga0209988_10197317 | Not Available | 1189 | Open in IMG/M |
| 3300024431|Ga0209988_10237102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300024431|Ga0209988_10646771 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300024516|Ga0209980_10016206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3841 | Open in IMG/M |
| 3300024516|Ga0209980_10089530 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300024516|Ga0209980_10095938 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300024516|Ga0209980_10101462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300024516|Ga0209980_10103402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1386 | Open in IMG/M |
| 3300024516|Ga0209980_10170865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1019 | Open in IMG/M |
| 3300024516|Ga0209980_10300924 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300024516|Ga0209980_10338815 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10529548 | Not Available | 548 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10502033 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026253|Ga0208879_1022618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3549 | Open in IMG/M |
| 3300026253|Ga0208879_1087939 | Not Available | 1366 | Open in IMG/M |
| 3300026253|Ga0208879_1155453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300026253|Ga0208879_1180926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300027685|Ga0209554_1241074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 507 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10003397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8722 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10033207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2496 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10250039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10036288 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10187076 | Not Available | 1005 | Open in IMG/M |
| 3300028600|Ga0265303_11014688 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 687 | Open in IMG/M |
| 3300031623|Ga0302123_10069696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1905 | Open in IMG/M |
| 3300031646|Ga0302133_10384082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 642 | Open in IMG/M |
| 3300031800|Ga0310122_10021997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3694 | Open in IMG/M |
| 3300031804|Ga0310124_10166246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1362 | Open in IMG/M |
| 3300032820|Ga0310342_100148856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2282 | Open in IMG/M |
| 3300032820|Ga0310342_100479104 | Not Available | 1382 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 42.45% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 16.04% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.26% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 5.66% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.89% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.89% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.94% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.94% |
| Hydrothermal Fe-Rich Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat | 0.94% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.94% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.94% |
| Sediment | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001459 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - All Sites - lt1k | Environmental | Open in IMG/M |
| 3300001781 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites | Environmental | Open in IMG/M |
| 3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006420 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300008463 | Deep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added | Engineered | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
| 3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300010933 | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1383E | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
| 3300020231 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04 | Environmental | Open in IMG/M |
| 3300020232 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR05 | Environmental | Open in IMG/M |
| 3300020234 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 | Environmental | Open in IMG/M |
| 3300020235 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 | Environmental | Open in IMG/M |
| 3300020364 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556021-ERR599037) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020423 | Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023442 | Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-SC8 | Environmental | Open in IMG/M |
| 3300024058 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024060 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024431 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300027685 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MCRcombined_10539921 | 3300001459 | Hydrothermal Vent Plume | MTYRDGLPRFSARSVRCCDTGHREACATLSERLGKP |
| Deep_10009291 | 3300001781 | Hydrothermal Vent Plume | MTYRDGLPRFSARSVRCCDTGHREACATLSESHGKPPSRSHMRAARGHG |
| Ga0063294_104244192 | 3300003885 | Hydrothermal Vents | MTHRDGLPRFSSRSVRCGDAGHREACATPSESLGKPPFRSRR |
| Ga0070727_103896791 | 3300005590 | Marine Sediment | MTHRDGFPRFSARRAWRGDAGHRKARATPSESLGK |
| Ga0066368_100112916 | 3300006002 | Marine | MTYRDGLPRFSARSVRCCDTGHREACTTLSERLGKPPFRSRMQS |
| Ga0068503_100143812 | 3300006340 | Marine | MTHRDGLPRFLARSGGRSDAAHRKPRATPSESLGN |
| Ga0082248_100209601 | 3300006420 | Sediment | MTHRDGFPRFSARSAWRGDAGHRKARATPSESLGKPP |
| Ga0066376_102550012 | 3300006900 | Marine | MTRRDGLPRFSARSAGRGDSAYRETRATPSESLGKLPFRSST |
| Ga0066376_103314612 | 3300006900 | Marine | MTHRNNLWDGLPRFSARSVGRGDAAHREARATPSESLG |
| Ga0066376_104318011 | 3300006900 | Marine | MTHRDNVWDGFPRYSARSVGRGDAAHREARATPSESLGKPP |
| Ga0066376_105262291 | 3300006900 | Marine | MTHRDGFPRFSARSVGRGDAAHREARATPSESLGKP |
| Ga0115335_1049444 | 3300008463 | Sediment | MAHRDGFPRFSARSAWRGDAGHRKPRATPSESLGKPPFR |
| Ga0114950_1000144617 | 3300009030 | Deep Subsurface | MTHGDGLPRVSARSAWRGDAGHREARATLSESLGKPPPRSSTRP |
| Ga0114950_100801891 | 3300009030 | Deep Subsurface | MTPRDCFPRFSARNVRRGDASHRKACATRTESLGKPPFRSRRR |
| Ga0114950_103035521 | 3300009030 | Deep Subsurface | MKTHRDGFPRFSARSVRCGDAGHREACATLPESLGK |
| Ga0114950_106784952 | 3300009030 | Deep Subsurface | MTHRDGFPRVSARSAWRGDAGHRKPCATQPESLGKPPFRSGGR |
| Ga0114950_113020892 | 3300009030 | Deep Subsurface | MKPHRDGFARFSARSVRCGDAGYREACATLPESLAKPPFGSRMRLVVA |
| Ga0114948_101388861 | 3300009102 | Deep Subsurface | MTHRDGFPRLSARSAWRSDAGHRQPCATPPESLGKPPFRSGR |
| Ga0114948_101430811 | 3300009102 | Deep Subsurface | MTLGDGLPRFSARSAWRGDAGHREARATPSESLGKPPPRSS |
| Ga0114948_104548021 | 3300009102 | Deep Subsurface | MTHRDGFPRLSARSAWRSDAGHRKPCGTQPESLGKPP |
| Ga0114948_104699042 | 3300009102 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCAPSKSIGPSESLG |
| Ga0114948_104754601 | 3300009102 | Deep Subsurface | MTHRDGFPRLSARSAWRGDARHRKPCGTPSESLGKPPFRSRGRTGSGRIG |
| Ga0114948_105662052 | 3300009102 | Deep Subsurface | MTHRDGLPRLSARSVRCGDAGHREACATPSESLGKPPF |
| Ga0114948_106823311 | 3300009102 | Deep Subsurface | MTHRDGLPRYSARSVRCGDAGHREACATPSESLGKPP |
| Ga0114949_108808403 | 3300009139 | Deep Subsurface | MTHRDGFPRLSARSAWRGDARHRKPCAPSKSIGPSESLGK |
| Ga0114931_100011121 | 3300009702 | Deep Subsurface | MTHRDGLPRFSARSVWQSDAGHRAPRATLSESLGKPPFRSSMG |
| Ga0114931_105990811 | 3300009702 | Deep Subsurface | MTHRDGAPRFSARSARRGDAGHREACATLSESLGAP |
| Ga0118733_1019598773 | 3300010430 | Marine Sediment | MTHRDGFPRFSARSAWRGDAGHREPRATPSESLGKPPFRSPGR |
| Ga0118733_1039150911 | 3300010430 | Marine Sediment | MTHRDGFPRFSARRAWRGDAGHRKARATPSESLGKPP |
| Ga0133547_103767465 | 3300010883 | Marine | MSHRDGLPRFSARSVRRGDAAHHEACATLSESLDK |
| Ga0137936_10231583 | 3300010933 | Marine Sediment | MTHRDGLPRFSALSVRCGDAGHREACATPSESLGKPPFRSRMRPVGG |
| Ga0137936_10255842 | 3300010933 | Marine Sediment | MTRRAGLPRFSARSVRRGDAGHRKACATPSESLGKP |
| Ga0114947_100202801 | 3300011112 | Deep Subsurface | MTRRAGGPGFSALSVRPGDAGHRKACATPSESLGKPPFR |
| Ga0114947_101301851 | 3300011112 | Deep Subsurface | MTRRAGLPRFSARSVRCGDAGHREACATPSESLGKPP |
| Ga0114947_101508873 | 3300011112 | Deep Subsurface | MTHRDGLPRFSARSVRCGDAGHREACATPSESLGKPPF |
| Ga0114947_101648291 | 3300011112 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCATPPESLGKP |
| Ga0114947_102391764 | 3300011112 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGYRKPRATRSESLGKPPFRSRRR |
| Ga0114947_102792681 | 3300011112 | Deep Subsurface | MTHRDGFPSVSARRAWCGDAGHRKPCGTPSESLGKPPFRSGRRTGS |
| Ga0114947_105709741 | 3300011112 | Deep Subsurface | MTHRDGLPRFSARSVRRGDAGHREACATPSESLGKPPFRSRMRPV |
| Ga0114947_106435561 | 3300011112 | Deep Subsurface | MTRRAGLPRFSALSVRCGDAGHREACATPSESLGK |
| Ga0114947_106912892 | 3300011112 | Deep Subsurface | MTHRDGFPRFSARSAWRGDARHRKPCATQPESLGKPP |
| Ga0114947_109011641 | 3300011112 | Deep Subsurface | MTRRAGGPGFSALSVRPGDAGHRKACATPSESLGKPPLRSGMRS |
| Ga0114947_111718741 | 3300011112 | Deep Subsurface | MTHRDGLPRFSARSVRCDDAGHRKACATPSESLGKPPFRSRMRPVG |
| Ga0114947_112099261 | 3300011112 | Deep Subsurface | MTRRAGLPRFSVRSVRRGDAGHREACAMPSESLGKPPLRSRMR |
| Ga0114947_114475231 | 3300011112 | Deep Subsurface | MTRRAGLPRFSARSVRCGDAGHREACATPSESLGKP |
| Ga0114947_115078901 | 3300011112 | Deep Subsurface | MTHRDGLPRFSERSVRRGDAGHREARATLSESLGKP |
| Ga0114947_115467702 | 3300011112 | Deep Subsurface | MTHRDGFPRFSARSAWRGDARHRKPCAPSKSIAPS |
| Ga0212167_12808451 | 3300020230 | Sediment | VTHRDGLPRFSARSVRRGDAGHREACATPSASLGKPPLRSRM |
| Ga0212167_12811733 | 3300020230 | Sediment | MTHRGGLPRFSARSVRCGDAGHRKACATPSESLGKP |
| Ga0212168_10303233 | 3300020231 | Sediment | MTHRDGFPRFSARSAWRGDARHRKPCAPSKSIAPSESLG |
| Ga0212168_11297021 | 3300020231 | Sediment | MTHRDGLPRFSALSVRCGDAGHREACATPSESLGKPPFR |
| Ga0212168_13055741 | 3300020231 | Sediment | MTRRAGLPMFSARSVRCGDAGHRKACATPSESLGKPP |
| Ga0212168_13825291 | 3300020231 | Sediment | MTHGDGLPWFSALSVRPGDAGHRKACATPSESLGKPPLRSRMRP |
| Ga0212168_14307311 | 3300020231 | Sediment | MTRRAGLPRFSALSVRCGDAGHREACATPSESLGKPP |
| Ga0212226_1054923 | 3300020232 | Sediment | MTHRDGFPRLSARSAWRGDARHRKPCAPSKSIGPSESLGKPPFT |
| Ga0212226_17214710 | 3300020232 | Sediment | MTRRAGLPRFSALSVRRGDAGHREGCATPSASLGKPPV |
| Ga0212226_1775811 | 3300020232 | Sediment | MTHRDGFPRFSVRSACRGDARHRKPRATPSESLGEPPFRSGG |
| Ga0212227_10301091 | 3300020234 | Sediment | MTHRDGFPRLSARSAWRGDAGHRKPCAPSKSIGPSESL |
| Ga0212227_10340982 | 3300020234 | Sediment | MTHGDGFSRLSARSAWRGDAGHRKPCAPSKSTGPSESLGKPPFRSD |
| Ga0212227_11353631 | 3300020234 | Sediment | MTHRDGLPRFSARSAWRGDAGHREARATPSESLGKPPPRSST |
| Ga0212227_11892791 | 3300020234 | Sediment | MTHGDGLPRFSARSAWRGDAGHREARATPSESLGKPPPRSSTRP |
| Ga0212227_12602061 | 3300020234 | Sediment | MTHRDGFPRFSARSAGRGDARHRKPRAPSKSILPSESL |
| Ga0212228_11890481 | 3300020235 | Sediment | MTPRDCFPRFSARNVRRGDASHRKACATRTESLGKPPVRSR |
| Ga0212228_14138972 | 3300020235 | Sediment | MKTHRDGFARFSARSVRCGDAGHREACATLPESLAKPPFGSRMR |
| Ga0211538_10030261 | 3300020364 | Marine | MTYKDGFPRFSARSVRRGDAAHREACATLSESLGK |
| Ga0211680_101240301 | 3300020389 | Marine | VIMTHKDAMWDGLPRFSARSVRRGDAAHREVRATPSEGLGKPSL |
| Ga0211525_100042181 | 3300020423 | Marine | MTHGDGLPRFSARSVGRGDAAHRKPRATPSESLGK |
| Ga0211525_100549481 | 3300020423 | Marine | MTHRDGLPRFSARSVGRSDAAHRKPRATPSESLGK |
| Ga0187827_100659414 | 3300022227 | Seawater | MTHRDGLPRFSARSVGRSDAGHRKPRATPSESLGK |
| Ga0256751_10279791 | 3300023442 | Hydrothermal Fe-Rich Mat | MTHGDGLPRFSALSVRCGDAGHREACATPSESLGK |
| Ga0209997_100048556 | 3300024058 | Deep Subsurface | MARRAGLPRFSALSVRRGDAGHREARATPSESLGKPPLRSR |
| Ga0209997_101077941 | 3300024058 | Deep Subsurface | MTRRAGLPRFSALSVRCGDAGHREACATPSESLGKPPFR |
| Ga0209997_102560431 | 3300024058 | Deep Subsurface | MTHRDGFPRLSARSAWRGDARHRKPCAPSKSIGPS |
| Ga0209997_103810111 | 3300024058 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCGTPPESLGK |
| Ga0209987_100569161 | 3300024060 | Deep Subsurface | MTHRDGLPRFSARSAWRGDAGHREARATPSESLGKPSPR |
| Ga0209988_101791121 | 3300024431 | Deep Subsurface | MTHGDGLPRFSARSAWRGDAGHRETRATLSESLGKPPPR |
| Ga0209988_101973172 | 3300024431 | Deep Subsurface | MKTHRDGFARFSARSVGCGDAGHREACATLPESLAK |
| Ga0209988_102371023 | 3300024431 | Deep Subsurface | MKTHRDGFARFSARSVGCGDAGHREACATLPESLAKPP |
| Ga0209988_106467712 | 3300024431 | Deep Subsurface | MKTHRDGFARFSARSVRRGDAGYREACATLPESLAK |
| Ga0209980_100162067 | 3300024516 | Deep Subsurface | MTHRDGFPRFSARSGWCGDARHRKPCAPSTRIGPSESLGKPPFR |
| Ga0209980_100895301 | 3300024516 | Deep Subsurface | MTHRDGFPRFSARSAWRGDAGHRKPCVTPPESLGKPPFRSRGRTAGG |
| Ga0209980_100959383 | 3300024516 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCATPPESLGKPPFRSGGRTAGG |
| Ga0209980_101014623 | 3300024516 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCAPFESYGPPES |
| Ga0209980_101034021 | 3300024516 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCGTPSESLGKP |
| Ga0209980_101708651 | 3300024516 | Deep Subsurface | MTHRDGFPRLSARSAWRGDAGHRKPCATPSESLGKPPFRS |
| Ga0209980_103009242 | 3300024516 | Deep Subsurface | MTHRDGLPRFSALSVRPGDAGHRKACATPSESLGKPP |
| Ga0209980_103388152 | 3300024516 | Deep Subsurface | MTRRDGLPRFSVRSVRCGDAGHRKACATPSESLGKPPFRSRMRP |
| (restricted) Ga0255049_105295481 | 3300024517 | Seawater | MTRRDGLPRFSARRVGCGDAGHRKARATPSDNLGK |
| (restricted) Ga0255056_105020331 | 3300024521 | Seawater | MMTPRDGFPGSSARSAWRGDAGHRKARATPSESLGKPPFRSP |
| Ga0208879_10226186 | 3300026253 | Marine | MTHGDGLPRFSARSAWRGDAGHREARATTSESLGKPPF |
| Ga0208879_10879391 | 3300026253 | Marine | MTHRDGLPRFSARSVRRGDAAHREAHATPSESLGNP |
| Ga0208879_11554532 | 3300026253 | Marine | MTHRDGLPRFSARSAGRGDAAHREARATPSESLGK |
| Ga0208879_11809261 | 3300026253 | Marine | MTHEDGLPRLSARSVGRGDAAHREARATPSESLGKPPFRSPPQPVGERRE |
| Ga0209554_12410741 | 3300027685 | Marine | MTHRDGLPRISARSAGRGDAAHREARATPSESLGKP |
| (restricted) Ga0255058_100033979 | 3300027872 | Seawater | MTHRDGVPRFSARSAWRGDAGHRKARATPSESLGKPPFRS |
| (restricted) Ga0255058_100332074 | 3300027872 | Seawater | MTHRDGFPRFSARSAWRGDAGHRKARATPSESLGKPPFRS |
| (restricted) Ga0255058_102500391 | 3300027872 | Seawater | MTHGDGFPRFSARSAWRGDAGHRKARATPSESLGKPPF |
| (restricted) Ga0255057_100362881 | 3300027997 | Seawater | MTHRDGLPGFSARSVGCGDAGHHKARATPSENPGK |
| (restricted) Ga0255057_101870761 | 3300027997 | Seawater | MTHRDGFPRFSARSAWRGDAGHRKPRATPSEGLGK |
| Ga0265303_110146882 | 3300028600 | Sediment | MTHRDGFPRLLARSGRRGDAGHREAGATQSKSLGKPPLRSQMQ |
| Ga0302123_100696963 | 3300031623 | Marine | MTHRDGFPRFSARTVRCRDAGHRKTDATQSESRGKPPFRSRM |
| Ga0302133_103840821 | 3300031646 | Marine | MTYRDGLTRFSARSVRRGDSGHREACATLSVNLVKPPFR |
| Ga0310122_100219976 | 3300031800 | Marine | MTHRDGFPRFSARSVGRGDAAHREARATPSESLGKPP |
| Ga0310124_101662461 | 3300031804 | Marine | MKTHRDGFPRFSARSARRGDAGHRETCATQGTPVAESLGKP |
| Ga0310342_1001488565 | 3300032820 | Seawater | MAHGDGLPRFSAWSVRRGDAAHRKPRETPSESLGKPCRW |
| Ga0310342_1004791041 | 3300032820 | Seawater | MTHRDGLPRFSARSVGRSDATHRKPRATPSESLGRLPFRS |
| ⦗Top⦘ |