


| Basic Information | |
|---|---|
| Family ID | F090831 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 87.96 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.741 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.963 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.259 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.43% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF02777 | Sod_Fe_C | 25.00 |
| PF13442 | Cytochrome_CBB3 | 16.67 |
| PF02775 | TPP_enzyme_C | 4.63 |
| PF02445 | NadA | 4.63 |
| PF00753 | Lactamase_B | 2.78 |
| PF10012 | DUF2255 | 1.85 |
| PF13519 | VWA_2 | 0.93 |
| PF04199 | Cyclase | 0.93 |
| PF00149 | Metallophos | 0.93 |
| PF02663 | FmdE | 0.93 |
| PF00903 | Glyoxalase | 0.93 |
| PF00118 | Cpn60_TCP1 | 0.93 |
| PF12796 | Ank_2 | 0.93 |
| PF00135 | COesterase | 0.93 |
| PF13360 | PQQ_2 | 0.93 |
| PF02628 | COX15-CtaA | 0.93 |
| PF01007 | IRK | 0.93 |
| PF05638 | T6SS_HCP | 0.93 |
| PF13531 | SBP_bac_11 | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF07519 | Tannase | 0.93 |
| PF14378 | PAP2_3 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 25.00 |
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 4.63 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.93 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 0.93 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.93 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.74 % |
| Unclassified | root | N/A | 34.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002G2H8A | Not Available | 509 | Open in IMG/M |
| 3300000953|JGI11615J12901_10643577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 844 | Open in IMG/M |
| 3300004157|Ga0062590_102621886 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004801|Ga0058860_10018516 | Not Available | 527 | Open in IMG/M |
| 3300005093|Ga0062594_101186142 | Not Available | 755 | Open in IMG/M |
| 3300005293|Ga0065715_10713458 | Not Available | 643 | Open in IMG/M |
| 3300005295|Ga0065707_10956975 | Not Available | 550 | Open in IMG/M |
| 3300005295|Ga0065707_11018460 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005332|Ga0066388_105801491 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005334|Ga0068869_102043396 | Not Available | 515 | Open in IMG/M |
| 3300005337|Ga0070682_101986128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005354|Ga0070675_100045732 | All Organisms → cellular organisms → Bacteria | 3582 | Open in IMG/M |
| 3300005441|Ga0070700_100206662 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300005441|Ga0070700_100856269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300005451|Ga0066681_10624399 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005618|Ga0068864_100183193 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300005713|Ga0066905_100840078 | Not Available | 799 | Open in IMG/M |
| 3300005764|Ga0066903_103642285 | Not Available | 829 | Open in IMG/M |
| 3300005843|Ga0068860_102547423 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006058|Ga0075432_10478421 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006172|Ga0075018_10090048 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300006237|Ga0097621_101423747 | Not Available | 656 | Open in IMG/M |
| 3300006358|Ga0068871_100955570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 796 | Open in IMG/M |
| 3300006358|Ga0068871_101077162 | Not Available | 751 | Open in IMG/M |
| 3300006755|Ga0079222_11946622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300006846|Ga0075430_101382987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300006847|Ga0075431_101312054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 684 | Open in IMG/M |
| 3300006854|Ga0075425_101559924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300006854|Ga0075425_101739662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300006871|Ga0075434_100880446 | Not Available | 911 | Open in IMG/M |
| 3300006881|Ga0068865_100117490 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300006904|Ga0075424_102864629 | Not Available | 502 | Open in IMG/M |
| 3300006918|Ga0079216_11425140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. | 575 | Open in IMG/M |
| 3300006954|Ga0079219_10237221 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300006954|Ga0079219_11279417 | Not Available | 643 | Open in IMG/M |
| 3300007004|Ga0079218_10372104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1202 | Open in IMG/M |
| 3300007076|Ga0075435_100834983 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009100|Ga0075418_13042241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300009137|Ga0066709_101379599 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300009147|Ga0114129_12733999 | Not Available | 587 | Open in IMG/M |
| 3300009162|Ga0075423_11322596 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009162|Ga0075423_12842027 | Not Available | 530 | Open in IMG/M |
| 3300009444|Ga0114945_11046365 | Not Available | 507 | Open in IMG/M |
| 3300009545|Ga0105237_11230607 | Not Available | 755 | Open in IMG/M |
| 3300010045|Ga0126311_11027373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300010047|Ga0126382_12439369 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010326|Ga0134065_10264571 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010337|Ga0134062_10458880 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010366|Ga0126379_10790555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300010373|Ga0134128_12944271 | Not Available | 524 | Open in IMG/M |
| 3300010391|Ga0136847_13364133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300010400|Ga0134122_10490202 | Not Available | 1109 | Open in IMG/M |
| 3300010400|Ga0134122_10832388 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300011416|Ga0137422_1060563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
| 3300012203|Ga0137399_10201253 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300012353|Ga0137367_10747927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 680 | Open in IMG/M |
| 3300012360|Ga0137375_10147313 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300012360|Ga0137375_11382271 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012362|Ga0137361_11585079 | Not Available | 576 | Open in IMG/M |
| 3300012893|Ga0157284_10053603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300012922|Ga0137394_10984344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 701 | Open in IMG/M |
| 3300012944|Ga0137410_11750721 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012957|Ga0164303_11272379 | Not Available | 543 | Open in IMG/M |
| 3300014318|Ga0075351_1125408 | Not Available | 583 | Open in IMG/M |
| 3300014326|Ga0157380_13069769 | Not Available | 532 | Open in IMG/M |
| 3300014326|Ga0157380_13159951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300014745|Ga0157377_10308045 | Not Available | 1048 | Open in IMG/M |
| 3300014880|Ga0180082_1057484 | Not Available | 835 | Open in IMG/M |
| 3300015371|Ga0132258_10021905 | All Organisms → cellular organisms → Bacteria | 13973 | Open in IMG/M |
| 3300015371|Ga0132258_13456148 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300018063|Ga0184637_10123075 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1599 | Open in IMG/M |
| 3300018482|Ga0066669_11278420 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021081|Ga0210379_10175140 | Not Available | 919 | Open in IMG/M |
| 3300025319|Ga0209520_10583168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300025544|Ga0208078_1080320 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025908|Ga0207643_10382286 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300025926|Ga0207659_10320561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
| 3300025940|Ga0207691_11197397 | Not Available | 630 | Open in IMG/M |
| 3300025942|Ga0207689_10303272 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300025945|Ga0207679_11708380 | Not Available | 576 | Open in IMG/M |
| 3300025981|Ga0207640_10230292 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300026075|Ga0207708_10427916 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300026075|Ga0207708_10435119 | Not Available | 1090 | Open in IMG/M |
| 3300026095|Ga0207676_10103189 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300026216|Ga0209903_1059826 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027429|Ga0207616_101324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300027880|Ga0209481_10040914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2126 | Open in IMG/M |
| 3300027886|Ga0209486_10273253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300027909|Ga0209382_11470349 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300028380|Ga0268265_11789797 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300028799|Ga0307284_10237433 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031152|Ga0307501_10124096 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031421|Ga0308194_10336567 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031562|Ga0310886_10900564 | Not Available | 562 | Open in IMG/M |
| 3300031720|Ga0307469_10309584 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300031847|Ga0310907_10249132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300031854|Ga0310904_10508415 | Not Available | 809 | Open in IMG/M |
| 3300031854|Ga0310904_11081819 | Not Available | 574 | Open in IMG/M |
| 3300031943|Ga0310885_10476925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300031944|Ga0310884_10755308 | Not Available | 592 | Open in IMG/M |
| 3300032012|Ga0310902_10400772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300032075|Ga0310890_10043985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2511 | Open in IMG/M |
| 3300032144|Ga0315910_11150946 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032174|Ga0307470_11216146 | Not Available | 613 | Open in IMG/M |
| 3300032180|Ga0307471_102646135 | Not Available | 636 | Open in IMG/M |
| 3300033433|Ga0326726_10587162 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.93% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300027429 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_10670800 | 2170459003 | Grass Soil | IVLNWTGALKGDEIAFTRGMDGGQGQTQQFTAKRQK |
| JGI11615J12901_106435772 | 3300000953 | Soil | DGTIDKTNIKFKTTQQGRGGEVTFEWTGTLKGDELAMKRMATGREGAPQEFTLKREK* |
| Ga0062590_1026218861 | 3300004157 | Soil | DLKFKTKQQGRGGEVILTWTGTLKGDEIAFSRMPEGGQAVMFTAKRQK* |
| Ga0058860_100185162 | 3300004801 | Host-Associated | KQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ* |
| Ga0062594_1011861422 | 3300005093 | Soil | GRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ* |
| Ga0065715_107134582 | 3300005293 | Miscanthus Rhizosphere | MGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ* |
| Ga0065707_109569752 | 3300005295 | Switchgrass Rhizosphere | RGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ* |
| Ga0065707_110184602 | 3300005295 | Switchgrass Rhizosphere | QGRGGEVTFEWSGTLKGDEIAMKRSVAGREGAPQEFTLKREK* |
| Ga0066388_1058014911 | 3300005332 | Tropical Forest Soil | KQMGRGGEVTLNWSGTLKGDEIAFTRMQDGGQGQPQEFTLKRMQ* |
| Ga0068869_1020433961 | 3300005334 | Miscanthus Rhizosphere | GMLKFKTKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK* |
| Ga0070682_1019861282 | 3300005337 | Corn Rhizosphere | LKFKTTQQGRGGEVTFEWTGTLKGDEIAMKRSVEGREGGPQEFTLKRQ* |
| Ga0070675_1000457324 | 3300005354 | Miscanthus Rhizosphere | VTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ* |
| Ga0070700_1002066624 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKFKTKQMGRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ* |
| Ga0070700_1008562692 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ* |
| Ga0066681_106243991 | 3300005451 | Soil | GGEVTLNWSGTLKGDEIAFTRAQEGGQGQPVEFTLKREK* |
| Ga0068857_1010721892 | 3300005577 | Corn Rhizosphere | ANNALKFVTHQMGRGGQVTFNWDGTLKGDEIAMKRAVEGREGGPQEFTLKRQ* |
| Ga0068864_1001831931 | 3300005618 | Switchgrass Rhizosphere | QMGRGGEVVMSWAGTLKGDEIAFSRTPEGGQAQTFTAKRQK* |
| Ga0066905_1008400782 | 3300005713 | Tropical Forest Soil | GEVTLNWSGALKGDEIAFTRMQDGGQGQPQEFTLKRMQ* |
| Ga0066903_1036422852 | 3300005764 | Tropical Forest Soil | AEVTMSWSGTVKGDEIAMTRTVEGGQGQSQEFTLKRQK* |
| Ga0068860_1025474231 | 3300005843 | Switchgrass Rhizosphere | GRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ* |
| Ga0068862_1008712213 | 3300005844 | Switchgrass Rhizosphere | ISGSALKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK* |
| Ga0075432_104784211 | 3300006058 | Populus Rhizosphere | IEKTALKFKTTQQGRGGQVTFNWSGTLKGDEIAMSRAAEGGQGQTQEFVLKRQP* |
| Ga0075018_100900482 | 3300006172 | Watersheds | FKTKQQGRGGEVVFSWTGTVKGDEIAFSRTPEGGQAQTFTAKRQK* |
| Ga0097621_1014237471 | 3300006237 | Miscanthus Rhizosphere | LNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK* |
| Ga0068871_1009555701 | 3300006358 | Miscanthus Rhizosphere | MGRGGEINLSWSGTVKGDEIAMTRTVEGGQGQSQEFTLKRQK* |
| Ga0068871_1010771622 | 3300006358 | Miscanthus Rhizosphere | ISGSTLKFKTKQMGRGGEVVLNWTGTVKGDEIAFTRGAEGATPVEFTVKRSKE* |
| Ga0079222_119466222 | 3300006755 | Agricultural Soil | NMLKFKTTQQGRGGEITLTWTGTLKGDEIAFSRMPEGGQAQEFVLKRK* |
| Ga0075430_1013829871 | 3300006846 | Populus Rhizosphere | TKQQGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK* |
| Ga0075431_1013120543 | 3300006847 | Populus Rhizosphere | GRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK* |
| Ga0075425_1015599241 | 3300006854 | Populus Rhizosphere | GEINISWSGTVKGDEIAMTRTIEGGQGQPQEFTLKRQK* |
| Ga0075425_1017396622 | 3300006854 | Populus Rhizosphere | MGRGGEVTVSWSGRINGEVPEIVMKRTVEDGQGQPQEFTLKRQQP* |
| Ga0075434_1008804461 | 3300006871 | Populus Rhizosphere | GGEVTLNWSGTLKGDEIAFTRMAEGGQGEPQQFTLKRMQ* |
| Ga0068865_1001174901 | 3300006881 | Miscanthus Rhizosphere | GRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ* |
| Ga0075424_1028646291 | 3300006904 | Populus Rhizosphere | KFKTTQMGRGGNEVNMSWSGTLKGDEIAMTRTVEGGQGQPQEFTLKRQK* |
| Ga0079216_114251403 | 3300006918 | Agricultural Soil | TLNWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK* |
| Ga0079219_102372211 | 3300006954 | Agricultural Soil | GEVTLNWTGTLKGDEIAFTRMAEGGQGQAQEFTLKRQN* |
| Ga0079219_112794171 | 3300006954 | Agricultural Soil | LNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ* |
| Ga0079218_103721041 | 3300007004 | Agricultural Soil | ALKFKTQQQGRGGNQITLDWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK* |
| Ga0075435_1008349832 | 3300007076 | Populus Rhizosphere | GGEVTLNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ* |
| Ga0075418_130422411 | 3300009100 | Populus Rhizosphere | GGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK* |
| Ga0066709_1013795991 | 3300009137 | Grasslands Soil | RGGQVTYSWTGTVKGDEIAFSRTPEGGQAQQFTAKRQKS* |
| Ga0114129_127339992 | 3300009147 | Populus Rhizosphere | ALKFKTTQQGRGGQVTFSWSGPLKGDEIAMSRMAEGGQGQNQEFVLKRQP* |
| Ga0075423_113225962 | 3300009162 | Populus Rhizosphere | MGRGGNEVTLNWSGTVKGDEIAMTRAIEGGQGQSQELTLKRQK* |
| Ga0075423_128420271 | 3300009162 | Populus Rhizosphere | TLNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ* |
| Ga0114945_110463652 | 3300009444 | Thermal Springs | LSYAGTLKGDEIAFKRMAEGGQGQSQDFVAKRQK* |
| Ga0105237_112306071 | 3300009545 | Corn Rhizosphere | KQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK* |
| Ga0126311_110273732 | 3300010045 | Serpentine Soil | QMGRGGEIVFNWTGTVKGDEIAFSRMAEGGQGQAQEFSLKKQK* |
| Ga0126382_124393691 | 3300010047 | Tropical Forest Soil | TQQGRGGEVTMEWTGTLKGDEIAMKRSVAGREGAPQEFTLKREK* |
| Ga0134065_102645712 | 3300010326 | Grasslands Soil | LNWSGTLKGYEIAFTRAQEGGQGQPVEFTLKREK* |
| Ga0134062_104588801 | 3300010337 | Grasslands Soil | SKQMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRQK* |
| Ga0126379_107905551 | 3300010366 | Tropical Forest Soil | KIAFKSTQMGRGGEINLSWSGTLKGDEIAMTRAVEGGQGQSQEFTLKRQK* |
| Ga0134128_129442711 | 3300010373 | Terrestrial Soil | QMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPMEFTLKRQK* |
| Ga0136847_133641331 | 3300010391 | Freshwater Sediment | QQGRGGEVTMSWSGTVKGDEIAFSRMVEGGQGQAQEFTLKRQK* |
| Ga0134122_104902021 | 3300010400 | Terrestrial Soil | KSVQQGRGGQVTMNWAGTVKGDEIAFTRTPEGGQAVEFTAKRQK* |
| Ga0134122_108323882 | 3300010400 | Terrestrial Soil | LKFKTKQMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPMEFTLKRQK* |
| Ga0137422_10605631 | 3300011416 | Soil | FKTQQQGRGGTPVTLNWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK* |
| Ga0137399_102012533 | 3300012203 | Vadose Zone Soil | GEVTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRQQ* |
| Ga0137367_107479272 | 3300012353 | Vadose Zone Soil | KQMGRGGEIMMAWAGTLKGDEIAFTRTPEGGQAQTFTAKRQK* |
| Ga0137375_101473133 | 3300012360 | Vadose Zone Soil | NGMLKFKTKQMGRGGEVTLAWSGTLKGDEIAFTRMAEGGQGQPMEFTLKREK* |
| Ga0137375_113822711 | 3300012360 | Vadose Zone Soil | GRGGEVTFEWTGTLKGDELAMKRMATGREGAPQEFTLKREK* |
| Ga0137361_115850792 | 3300012362 | Vadose Zone Soil | KSKQMGRGGEVTLNWSGTLKGDEIAFTRAQEGGQGQPVEFTLKREK* |
| Ga0157284_100536033 | 3300012893 | Soil | KFKTKQMGRGGEVVFNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK* |
| Ga0137394_109843441 | 3300012922 | Vadose Zone Soil | TKQMGRGGEVTLNWSGTLKGSEIAFTRMAEGGQGQPVEFTLKRQ* |
| Ga0137410_117507211 | 3300012944 | Vadose Zone Soil | LKFKSTQMGRGGEINMSWSGTLTGDEIAFTRTIEGGQGQSQEFTLKRQK* |
| Ga0164303_112723792 | 3300012957 | Soil | GMLKFKTKQMGRGGEVTLNWSGTLKGDEIAFSRMAEGGQGEQQQFTLKRMQ* |
| Ga0075351_11254081 | 3300014318 | Natural And Restored Wetlands | GRGGGAPVTLNWSGILKGDEIAMSRMAEGGQGQAQEFVLKRQK* |
| Ga0157380_130697692 | 3300014326 | Switchgrass Rhizosphere | NQVTLNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK* |
| Ga0157380_131599512 | 3300014326 | Switchgrass Rhizosphere | SGSDLKFKTKQQGRGGEVILTWTGTLKGDEIAFSRMPEGGQAVMFTAKRQK* |
| Ga0157377_103080451 | 3300014745 | Miscanthus Rhizosphere | MGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ* |
| Ga0180082_10574842 | 3300014880 | Soil | GRGGEITLDWSGALKGDEIAFTRMAEGGQGQPQEFTLKRQQ* |
| Ga0132258_1002190518 | 3300015371 | Arabidopsis Rhizosphere | LNWAGTLKGDEIAMSRMAEGGQGQAQEFVLKRQPWTSY* |
| Ga0132258_134561483 | 3300015371 | Arabidopsis Rhizosphere | LNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ* |
| Ga0184637_101230751 | 3300018063 | Groundwater Sediment | RVRRGVQQQGRGGGAPVTLNWTGTLKGDEIAMSRMPEGGQAVDFVLKRQK |
| Ga0066669_112784201 | 3300018482 | Grasslands Soil | VTYSWTGTVKGDEIAFSRTPEGGQAQQFTAKRQKS |
| Ga0210379_101751402 | 3300021081 | Groundwater Sediment | GGALKFKTQQQGRGGGAPVTLNWSGTLKGDEIAMTRMAEGGQGQAQEFVLKRQK |
| Ga0209520_105831682 | 3300025319 | Soil | QQQGRGGQVTFNWSGTLKGDEIAMSRMAEGGQGQAQEFVLKRQK |
| Ga0208078_10803201 | 3300025544 | Arctic Peat Soil | MGRGGEIVLSWTGTLKGDEIAFSRTPEGGQAQTFTAKRQK |
| Ga0207643_103822862 | 3300025908 | Miscanthus Rhizosphere | VTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ |
| Ga0207659_103205611 | 3300025926 | Miscanthus Rhizosphere | GGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK |
| Ga0207691_111973971 | 3300025940 | Miscanthus Rhizosphere | NALKFVTHQMGRGGEVTFNWDGTLKGDEIAMKRSVEGREGGPQEFTLKRQ |
| Ga0207689_103032723 | 3300025942 | Miscanthus Rhizosphere | KFKTTQQGRGGEVVFEWTGTLKGDEIAMKRMVTGREGQPQEFTLKREK |
| Ga0207679_117083802 | 3300025945 | Corn Rhizosphere | MGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ |
| Ga0207640_102302921 | 3300025981 | Corn Rhizosphere | VTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ |
| Ga0207708_104279161 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKFKTKQMGRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ |
| Ga0207708_104351191 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFVTHQMGRGGQVTFNWDGTLKGDEIAMKRAVEGREGGPQEFTLKRQ |
| Ga0207676_101031891 | 3300026095 | Switchgrass Rhizosphere | GADLKFKTKQMGRGGEVVMSWAGTLKGDEIAFSRTPEGGQAQTFTAKRQK |
| Ga0209903_10598262 | 3300026216 | Soil | FKTKQMGRGGEIVLNWTGTLKGDEIAFSRMAEGGQGQAQTFTAKRQK |
| Ga0207616_1013241 | 3300027429 | Soil | FKTKQMGRGGEVTLNWSGTLKGDEIAFTRMADGGQGQPQEFTLKRMQ |
| Ga0209481_100409143 | 3300027880 | Populus Rhizosphere | GSALKFKTKQMGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK |
| Ga0209486_102732531 | 3300027886 | Agricultural Soil | ALKFKTQQQGRGGNQITLDWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK |
| Ga0209382_114703493 | 3300027909 | Populus Rhizosphere | QQGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK |
| Ga0268265_117897972 | 3300028380 | Switchgrass Rhizosphere | MGRGGNEVNMSWSGTVKGDEIAMTRTIEGGQGQAQEFTLKREK |
| Ga0307284_102374331 | 3300028799 | Soil | KFKSKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQPVEFTLKREK |
| Ga0307501_101240962 | 3300031152 | Soil | MLKFKTKQMGRGGEITLDWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQ |
| Ga0308194_103365671 | 3300031421 | Soil | NIKFKSKQQGRGGEVVMTWTGTLKGDEIAFSRQPEGGQAVEFTAKRQK |
| Ga0310886_109005642 | 3300031562 | Soil | VTLNWSGTLKGDEIAMSRKAEGGEGAAQEFVLKREK |
| Ga0307469_103095841 | 3300031720 | Hardwood Forest Soil | ANGTLKFRTKQMGRGGEITLNWSGILKGDEIAFTRMAEGGQGQPQEFTLKRQQ |
| Ga0310907_102491323 | 3300031847 | Soil | LKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK |
| Ga0310904_105084151 | 3300031854 | Soil | GGQITFNWDGTLKGDEIAMKRSVEGREGGPQEFTLKRQ |
| Ga0310904_110818191 | 3300031854 | Soil | EVTLDWSGALKGDEIAFTRMAEGGQGQPQEFTLKRQ |
| Ga0310885_104769253 | 3300031943 | Soil | TLNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK |
| Ga0310884_107553082 | 3300031944 | Soil | QVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ |
| Ga0310902_104007721 | 3300032012 | Soil | ALKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK |
| Ga0310890_100439851 | 3300032075 | Soil | SKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK |
| Ga0315910_111509461 | 3300032144 | Soil | KTKQQGRGGNEITLNWAGTLKGDEIAMSRMADGGQGQAQEFTLKREK |
| Ga0307470_112161462 | 3300032174 | Hardwood Forest Soil | EASLSGSTVKFKTKQMGRGGEVILNWTGTVKGEEIAFSRMAEGGQGQAQEFTLKKQK |
| Ga0307471_1026461352 | 3300032180 | Hardwood Forest Soil | ITLNWSGALKGDEIAFTRMAEGGQGQAQEFTLKRQQ |
| Ga0326726_105871621 | 3300033433 | Peat Soil | GRGGEVTLNWSGTLKGDEIAFTRAQDGGQGQPVEFTLKREK |
| ⦗Top⦘ |