


| Basic Information | |
|---|---|
| Family ID | F090518 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.22 % |
| % of genes near scaffold ends (potentially truncated) | 45.37 % |
| % of genes from short scaffolds (< 2000 bps) | 84.26 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.185 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (15.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.519 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 35.19 |
| PF03401 | TctC | 13.89 |
| PF13185 | GAF_2 | 5.56 |
| PF04392 | ABC_sub_bind | 2.78 |
| PF00881 | Nitroreductase | 0.93 |
| PF05532 | CsbD | 0.93 |
| PF07991 | IlvN | 0.93 |
| PF02653 | BPD_transp_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 13.89 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.78 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.85 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.93 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.19 % |
| Unclassified | root | N/A | 39.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2001200001|2001227122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1078 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_5918534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1049 | Open in IMG/M |
| 3300000890|JGI11643J12802_11935546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300000953|JGI11615J12901_10217948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 704 | Open in IMG/M |
| 3300001904|JGI24736J21556_1072475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300003324|soilH2_10223773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3858 | Open in IMG/M |
| 3300004009|Ga0055437_10072065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 971 | Open in IMG/M |
| 3300004019|Ga0055439_10027137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 1427 | Open in IMG/M |
| 3300004020|Ga0055440_10024452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 1206 | Open in IMG/M |
| 3300004058|Ga0055498_10004350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1574 | Open in IMG/M |
| 3300004114|Ga0062593_101887340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 660 | Open in IMG/M |
| 3300004156|Ga0062589_100211298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1413 | Open in IMG/M |
| 3300004156|Ga0062589_100406885 | Not Available | 1108 | Open in IMG/M |
| 3300004156|Ga0062589_102108565 | Not Available | 575 | Open in IMG/M |
| 3300004156|Ga0062589_102550706 | Not Available | 530 | Open in IMG/M |
| 3300004281|Ga0066397_10098893 | Not Available | 609 | Open in IMG/M |
| 3300004463|Ga0063356_103854393 | Not Available | 646 | Open in IMG/M |
| 3300004479|Ga0062595_100560817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 878 | Open in IMG/M |
| 3300004480|Ga0062592_100228511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300004480|Ga0062592_102484776 | Not Available | 521 | Open in IMG/M |
| 3300004643|Ga0062591_101550391 | Not Available | 665 | Open in IMG/M |
| 3300004643|Ga0062591_102871451 | Not Available | 511 | Open in IMG/M |
| 3300005104|Ga0066818_1010860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300005162|Ga0066814_10000387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 2592 | Open in IMG/M |
| 3300005164|Ga0066815_10059949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300005290|Ga0065712_10186599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
| 3300005293|Ga0065715_10514232 | Not Available | 769 | Open in IMG/M |
| 3300005295|Ga0065707_10116869 | Not Available | 2226 | Open in IMG/M |
| 3300005332|Ga0066388_101803621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300005332|Ga0066388_102251777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 985 | Open in IMG/M |
| 3300005332|Ga0066388_108637951 | Not Available | 506 | Open in IMG/M |
| 3300005333|Ga0070677_10911382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300005344|Ga0070661_100009925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6606 | Open in IMG/M |
| 3300005406|Ga0070703_10198363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 786 | Open in IMG/M |
| 3300005458|Ga0070681_10628898 | Not Available | 988 | Open in IMG/M |
| 3300005529|Ga0070741_10014652 | All Organisms → cellular organisms → Bacteria | 13513 | Open in IMG/M |
| 3300005564|Ga0070664_100502179 | Not Available | 1118 | Open in IMG/M |
| 3300005937|Ga0081455_10000508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 50455 | Open in IMG/M |
| 3300006237|Ga0097621_102398283 | Not Available | 505 | Open in IMG/M |
| 3300006852|Ga0075433_10043685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3891 | Open in IMG/M |
| 3300006852|Ga0075433_10800033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 824 | Open in IMG/M |
| 3300006954|Ga0079219_10076082 | Not Available | 1557 | Open in IMG/M |
| 3300009036|Ga0105244_10106000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1371 | Open in IMG/M |
| 3300009100|Ga0075418_11746917 | Not Available | 676 | Open in IMG/M |
| 3300009101|Ga0105247_10050267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2565 | Open in IMG/M |
| 3300009101|Ga0105247_10804322 | Not Available | 718 | Open in IMG/M |
| 3300009148|Ga0105243_10070822 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
| 3300009174|Ga0105241_10916394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 815 | Open in IMG/M |
| 3300009553|Ga0105249_11899297 | Not Available | 668 | Open in IMG/M |
| 3300010047|Ga0126382_12288705 | Not Available | 522 | Open in IMG/M |
| 3300010047|Ga0126382_12300718 | Not Available | 521 | Open in IMG/M |
| 3300010110|Ga0126316_1150381 | Not Available | 511 | Open in IMG/M |
| 3300010359|Ga0126376_11490657 | Not Available | 705 | Open in IMG/M |
| 3300010362|Ga0126377_10051243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3600 | Open in IMG/M |
| 3300010362|Ga0126377_10149048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2196 | Open in IMG/M |
| 3300010373|Ga0134128_11274439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 810 | Open in IMG/M |
| 3300010375|Ga0105239_10563452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1298 | Open in IMG/M |
| 3300010375|Ga0105239_12143684 | Not Available | 650 | Open in IMG/M |
| 3300010400|Ga0134122_10144804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1926 | Open in IMG/M |
| 3300011119|Ga0105246_10428960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1105 | Open in IMG/M |
| 3300012477|Ga0157336_1013011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 667 | Open in IMG/M |
| 3300012484|Ga0157333_1013645 | Not Available | 641 | Open in IMG/M |
| 3300012507|Ga0157342_1007416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1063 | Open in IMG/M |
| 3300012951|Ga0164300_10012928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2691 | Open in IMG/M |
| 3300012960|Ga0164301_10145395 | Not Available | 1442 | Open in IMG/M |
| 3300012986|Ga0164304_10217749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1258 | Open in IMG/M |
| 3300013306|Ga0163162_13420280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300014262|Ga0075301_1140332 | Not Available | 555 | Open in IMG/M |
| 3300014324|Ga0075352_1278972 | Not Available | 525 | Open in IMG/M |
| 3300014497|Ga0182008_10180087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1069 | Open in IMG/M |
| 3300015371|Ga0132258_10123868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6148 | Open in IMG/M |
| 3300015372|Ga0132256_100608329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
| 3300019356|Ga0173481_10000353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 9481 | Open in IMG/M |
| 3300019361|Ga0173482_10158459 | Not Available | 889 | Open in IMG/M |
| 3300022737|Ga0247747_1005473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1225 | Open in IMG/M |
| 3300022898|Ga0247745_1000622 | Not Available | 4956 | Open in IMG/M |
| 3300023168|Ga0247748_1011410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1176 | Open in IMG/M |
| 3300025315|Ga0207697_10030694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2199 | Open in IMG/M |
| 3300025551|Ga0210131_1093949 | Not Available | 520 | Open in IMG/M |
| 3300025558|Ga0210139_1045132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 886 | Open in IMG/M |
| 3300025900|Ga0207710_10578068 | Not Available | 586 | Open in IMG/M |
| 3300025917|Ga0207660_11009274 | Not Available | 679 | Open in IMG/M |
| 3300025920|Ga0207649_10985630 | Not Available | 663 | Open in IMG/M |
| 3300025921|Ga0207652_11255934 | Not Available | 643 | Open in IMG/M |
| 3300025942|Ga0207689_10393880 | Not Available | 1154 | Open in IMG/M |
| 3300025957|Ga0210089_1005164 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300025986|Ga0207658_11637899 | Not Available | 588 | Open in IMG/M |
| 3300026075|Ga0207708_10248941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1431 | Open in IMG/M |
| 3300026142|Ga0207698_10236074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1663 | Open in IMG/M |
| 3300026690|Ga0207494_102247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300026741|Ga0207510_100543 | Not Available | 1064 | Open in IMG/M |
| 3300026773|Ga0207566_101260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 803 | Open in IMG/M |
| 3300026806|Ga0207546_100418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1064 | Open in IMG/M |
| 3300026861|Ga0207503_1000923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1308 | Open in IMG/M |
| 3300026884|Ga0207455_1005700 | Not Available | 626 | Open in IMG/M |
| 3300027775|Ga0209177_10062168 | Not Available | 1091 | Open in IMG/M |
| 3300027775|Ga0209177_10089888 | Not Available | 954 | Open in IMG/M |
| 3300027907|Ga0207428_10741058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 701 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1029467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1158434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 504 | Open in IMG/M |
| 3300031716|Ga0310813_10000986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 17271 | Open in IMG/M |
| 3300031820|Ga0307473_11557307 | Not Available | 503 | Open in IMG/M |
| 3300031847|Ga0310907_10422081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 699 | Open in IMG/M |
| 3300032000|Ga0310903_10553154 | Not Available | 607 | Open in IMG/M |
| 3300032122|Ga0310895_10062693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1406 | Open in IMG/M |
| 3300032174|Ga0307470_10065738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1933 | Open in IMG/M |
| 3300033004|Ga0335084_10661920 | Not Available | 1066 | Open in IMG/M |
| 3300033004|Ga0335084_11238682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 744 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 15.74% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2001200001 | Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150 | Environmental | Open in IMG/M |
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026690 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026741 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes) | Environmental | Open in IMG/M |
| 3300026773 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026806 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026861 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2001250902 | 2001200001 | Soil | MTKMSSKQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG |
| SwBSRL2_0795.00000990 | 2162886013 | Switchgrass Rhizosphere | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| JGI11643J12802_119355463 | 3300000890 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLG |
| JGI11615J12901_102179482 | 3300000953 | Soil | MTKIELEQIDDSILHFEVSDEALESAGDNTVAANYTLGACTGLSVCPG* |
| JGI24736J21556_10724752 | 3300001904 | Corn Rhizosphere | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCP |
| soilH2_102237734 | 3300003324 | Sugarcane Root And Bulk Soil | EDSILNYEISDEALESAGDNVASANYTLGACTGLSICPG* |
| Ga0055437_100720652 | 3300004009 | Natural And Restored Wetlands | MIKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG* |
| Ga0055439_100271373 | 3300004019 | Natural And Restored Wetlands | MTKIEPAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG* |
| Ga0055440_100244521 | 3300004020 | Natural And Restored Wetlands | MTKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG* |
| Ga0055498_100043503 | 3300004058 | Natural And Restored Wetlands | MTKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG* |
| Ga0062593_1018873401 | 3300004114 | Soil | MTKIELAQTEDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG |
| Ga0062589_1002112983 | 3300004156 | Soil | MTKIEFAQTEDSILNFEISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0062589_1004068852 | 3300004156 | Soil | MTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG* |
| Ga0062589_1021085652 | 3300004156 | Soil | MTKIEFAQTDDSILNFDVSDEAIESAGDNAIAANYTLGACTGLSVCPG* |
| Ga0062589_1025507062 | 3300004156 | Soil | MTKIELEQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0066397_100988932 | 3300004281 | Tropical Forest Soil | MTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0063356_1038543931 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTKIELAQTEDSILNFEISDEALESAGDNVTAANYTLGACTGLSVCPG |
| Ga0062595_1005608172 | 3300004479 | Soil | MTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVCPG* |
| Ga0062592_1002285113 | 3300004480 | Soil | MTKIELAQTEDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG* |
| Ga0062592_1024847762 | 3300004480 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNAAAANYTLGACTGLSVCPG* |
| Ga0062591_1015503911 | 3300004643 | Soil | SQQKGIYAMTKIEFAQTEDSILNFEISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0062591_1028714511 | 3300004643 | Soil | MTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVCPG |
| Ga0066818_10108601 | 3300005104 | Soil | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0066814_100003874 | 3300005162 | Soil | MTKIELEQIDEGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0066815_100599491 | 3300005164 | Soil | MTKIELEQIDEGILNFNVSDEALESAGDNAVAANYTLGACSGLSVCPG* |
| Ga0065712_101865993 | 3300005290 | Miscanthus Rhizosphere | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0065715_105142322 | 3300005293 | Miscanthus Rhizosphere | MTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVC |
| Ga0065707_101168691 | 3300005295 | Switchgrass Rhizosphere | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCP |
| Ga0066388_1018036213 | 3300005332 | Tropical Forest Soil | MTKIELEQIDSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG* |
| Ga0066388_1022517773 | 3300005332 | Tropical Forest Soil | MTKIELEQIDDSILNFNVSDEALESAGDNGVAANYTLGACTGLSVCPG* |
| Ga0066388_1086379511 | 3300005332 | Tropical Forest Soil | AMTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0070677_109113821 | 3300005333 | Miscanthus Rhizosphere | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLS |
| Ga0070661_1000099251 | 3300005344 | Corn Rhizosphere | VRQLHRGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0070703_101983631 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKIELEQIDDNILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0070681_106288983 | 3300005458 | Corn Rhizosphere | MTKIELVQIDDSILNFDISDEALESAGDTTLAANYTLGACTGLSVCPG* |
| Ga0070741_100146523 | 3300005529 | Surface Soil | MTKFDLEMNEDSILNYEISDEALESAGDNVTAANYTLGACTGLSICPG* |
| Ga0070664_1005021791 | 3300005564 | Corn Rhizosphere | MTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG* |
| Ga0081455_1000050820 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTKIELEQIEILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0097621_1023982831 | 3300006237 | Miscanthus Rhizosphere | MTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGL |
| Ga0075433_100436851 | 3300006852 | Populus Rhizosphere | KIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0075433_108000331 | 3300006852 | Populus Rhizosphere | MTKIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0079219_100760823 | 3300006954 | Agricultural Soil | MTKIELEQIDILNFDISDEALESAGDNTVAANYTLGACTGLSVCPG* |
| Ga0105244_101060001 | 3300009036 | Miscanthus Rhizosphere | MTKIELAQTEDSILSFEISDEALESAGDNVTAANYTL |
| Ga0075418_117469173 | 3300009100 | Populus Rhizosphere | IDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0105247_100502673 | 3300009101 | Switchgrass Rhizosphere | MTKIELEQIDDNILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0105247_108043222 | 3300009101 | Switchgrass Rhizosphere | HRGAVKKDLTMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0105243_100708221 | 3300009148 | Miscanthus Rhizosphere | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTSLSVCPG* |
| Ga0105241_109163941 | 3300009174 | Corn Rhizosphere | AMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0105249_118992971 | 3300009553 | Switchgrass Rhizosphere | TKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0126382_122887052 | 3300010047 | Tropical Forest Soil | DSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG* |
| Ga0126382_123007181 | 3300010047 | Tropical Forest Soil | MTTIELEQIDILNFDISDDALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0126316_11503811 | 3300010110 | Soil | AMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0126376_114906572 | 3300010359 | Tropical Forest Soil | EKRKQAMTKIQLEQHEDSILNYEISDEALECAGDNVTAANYTLGACSGLSVCPG* |
| Ga0126377_100512434 | 3300010362 | Tropical Forest Soil | MTKIQLEQIDDSILSFEISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0126377_101490482 | 3300010362 | Tropical Forest Soil | MTKIELEQIDSILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0134128_112744393 | 3300010373 | Terrestrial Soil | IELVQIDDSILNFDIADEALESAGDTTLAANYTLGACTGLSVCPG* |
| Ga0105239_105634522 | 3300010375 | Corn Rhizosphere | MTKIELAQTEDSILSFKISDEALESAGENVTAANYTLGACTGLSVCPG* |
| Ga0105239_121436841 | 3300010375 | Corn Rhizosphere | MTKIELQQIDEGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0134122_101448041 | 3300010400 | Terrestrial Soil | MTKIDLDQHEDRILNYEISDEALESAGDNVTAANYTLGACSGLSVCPG* |
| Ga0105246_104289601 | 3300011119 | Miscanthus Rhizosphere | AMTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG* |
| Ga0157336_10130111 | 3300012477 | Arabidopsis Rhizosphere | MTKIELEQIDDGILNFKVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0157333_10136451 | 3300012484 | Soil | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGL |
| Ga0157342_10074163 | 3300012507 | Arabidopsis Rhizosphere | MTKIELEQIDDSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG* |
| Ga0164300_100129283 | 3300012951 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNVVAANYTLGACTGLSVCPG* |
| Ga0164301_101453952 | 3300012960 | Soil | MTKLELEQIDDSIRNFNVSDEALASAGDNAVAANYTLGACTGLSVCPG* |
| Ga0164304_102177491 | 3300012986 | Soil | RGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0163162_134202801 | 3300013306 | Switchgrass Rhizosphere | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGL |
| Ga0075301_11403321 | 3300014262 | Natural And Restored Wetlands | MTKIELEQIDDSILNFNVSDEALESSGDNVTAANYTLGACTGLSVCPG* |
| Ga0075352_12789721 | 3300014324 | Natural And Restored Wetlands | TKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG* |
| Ga0182008_101800872 | 3300014497 | Rhizosphere | MTKIELVQIDDSILNFDIADEALESAGDTTLAANYTLGACTGLSVCPG* |
| Ga0132258_101238684 | 3300015371 | Arabidopsis Rhizosphere | MTKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG* |
| Ga0132256_1006083291 | 3300015372 | Arabidopsis Rhizosphere | DDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0173481_100003535 | 3300019356 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0173482_101584593 | 3300019361 | Soil | MTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG |
| Ga0247747_10054732 | 3300022737 | Soil | MTKIELEQIDDNILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0247745_10006221 | 3300022898 | Soil | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYT |
| Ga0247748_10114101 | 3300023168 | Soil | QIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0207697_100306943 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKIELEQINDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0210131_10939492 | 3300025551 | Natural And Restored Wetlands | TEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG |
| Ga0210139_10451322 | 3300025558 | Natural And Restored Wetlands | MTKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG |
| Ga0207710_105780681 | 3300025900 | Switchgrass Rhizosphere | LEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0207660_110092741 | 3300025917 | Corn Rhizosphere | MTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLG |
| Ga0207649_109856302 | 3300025920 | Corn Rhizosphere | MTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG |
| Ga0207652_112559341 | 3300025921 | Corn Rhizosphere | MTKIELAQTDDRILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG |
| Ga0207689_103938801 | 3300025942 | Miscanthus Rhizosphere | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTL |
| Ga0210089_10051642 | 3300025957 | Natural And Restored Wetlands | MTKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG |
| Ga0207658_116378991 | 3300025986 | Switchgrass Rhizosphere | EDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG |
| Ga0207708_102489411 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0207698_102360741 | 3300026142 | Corn Rhizosphere | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLS |
| Ga0207494_1022472 | 3300026690 | Soil | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACT |
| Ga0207510_1005432 | 3300026741 | Soil | MTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLG |
| Ga0207566_1012601 | 3300026773 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYT |
| Ga0207546_1004182 | 3300026806 | Soil | ELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0207503_10009231 | 3300026861 | Soil | IDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0207455_10057002 | 3300026884 | Soil | LHRGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0209177_100621682 | 3300027775 | Agricultural Soil | MTKIELEQIDILNFDISDEALESAGDNTVAANYTLGACTGLSVCPG |
| Ga0209177_100898883 | 3300027775 | Agricultural Soil | KIELVQIDDSILNFDISDEALESAGDTTLAANYTLGACTGLSVCPG |
| Ga0207428_107410581 | 3300027907 | Populus Rhizosphere | MTKIELEQIDDSILHFEVSDEALESAGDNTVAANYTLGACTGLSVCPG |
| (restricted) Ga0255311_10294672 | 3300031150 | Sandy Soil | MTKIELEQIDDSILNFDISDDALESAGDNAVAANYTLGACTGLSVCPG |
| (restricted) Ga0255311_11584341 | 3300031150 | Sandy Soil | MTKIELEQIDDSILNFNVSDEALESAGDNAIAANYTLGACTGLSVCPG |
| Ga0310813_100009867 | 3300031716 | Soil | MTKIELEQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0307473_115573071 | 3300031820 | Hardwood Forest Soil | MTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0310907_104220812 | 3300031847 | Soil | MTKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG |
| Ga0310903_105531541 | 3300032000 | Soil | MHKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG |
| Ga0310895_100626931 | 3300032122 | Soil | MTKIELEQIDDNILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0307470_100657383 | 3300032174 | Hardwood Forest Soil | MTKIEFEQIDSILNFDISDEALESAGDNVVAANYTLGACTGLSVCPG |
| Ga0335084_106619203 | 3300033004 | Soil | MTKIELAQTEDSILSFEISDEALESAGENVTAAHYTLGACTGLSVCPG |
| Ga0335084_112386821 | 3300033004 | Soil | MTKIELEQIDVLNFDISDEALESASDNAVAANYTLGACTGLSVCPG |
| ⦗Top⦘ |