


| Basic Information | |
|---|---|
| Family ID | F090440 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 95.37 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.704 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (25.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF13609 | Porin_4 | 0.93 |
| PF00825 | Ribonuclease_P | 0.93 |
| PF01235 | Na_Ala_symp | 0.93 |
| PF02190 | LON_substr_bdg | 0.93 |
| PF00291 | PALP | 0.93 |
| PF00815 | Histidinol_dh | 0.93 |
| PF13519 | VWA_2 | 0.93 |
| PF01930 | Cas_Cas4 | 0.93 |
| PF00270 | DEAD | 0.93 |
| PF00318 | Ribosomal_S2 | 0.93 |
| PF00111 | Fer2 | 0.93 |
| PF02548 | Pantoate_transf | 0.93 |
| PF02867 | Ribonuc_red_lgC | 0.93 |
| PF05226 | CHASE2 | 0.93 |
| PF01039 | Carboxyl_trans | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF12838 | Fer4_7 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.93 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.93 |
| COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.93 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.93 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.93 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.93 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.93 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.70 % |
| All Organisms | root | All Organisms | 21.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002642|Ga0005258J37292_10223 | Not Available | 543 | Open in IMG/M |
| 3300002644|Ga0005264J37220_10073 | Not Available | 562 | Open in IMG/M |
| 3300002685|Ga0005237J37283_1001748 | Not Available | 552 | Open in IMG/M |
| 3300003304|Ga0005273J48911_1000092 | Not Available | 554 | Open in IMG/M |
| 3300003677|Ga0008458J53046_100034 | Not Available | 546 | Open in IMG/M |
| 3300003681|Ga0008457_1000030 | Not Available | 558 | Open in IMG/M |
| 3300004958|Ga0066614_104020 | Not Available | 556 | Open in IMG/M |
| 3300004958|Ga0066614_104412 | Not Available | 546 | Open in IMG/M |
| 3300006377|Ga0079049_1050412 | Not Available | 538 | Open in IMG/M |
| 3300006385|Ga0079050_1029041 | Not Available | 525 | Open in IMG/M |
| 3300006385|Ga0079050_1429290 | Not Available | 539 | Open in IMG/M |
| 3300006706|Ga0005505_1030492 | Not Available | 501 | Open in IMG/M |
| 3300006718|Ga0005504_1278358 | Not Available | 521 | Open in IMG/M |
| 3300006732|Ga0079232_1600006 | Not Available | 532 | Open in IMG/M |
| 3300007325|Ga0079257_1382312 | Not Available | 510 | Open in IMG/M |
| 3300007326|Ga0079243_1011832 | Not Available | 519 | Open in IMG/M |
| 3300008550|Ga0103924_14119 | Not Available | 533 | Open in IMG/M |
| 3300008562|Ga0103942_10861 | Not Available | 563 | Open in IMG/M |
| 3300008564|Ga0103930_1513 | Not Available | 531 | Open in IMG/M |
| 3300008602|Ga0103918_11302 | Not Available | 552 | Open in IMG/M |
| 3300008603|Ga0103916_1126 | Not Available | 525 | Open in IMG/M |
| 3300008671|Ga0103945_11467 | Not Available | 533 | Open in IMG/M |
| 3300008675|Ga0103938_11700 | Not Available | 531 | Open in IMG/M |
| 3300008693|Ga0103943_12488 | Not Available | 561 | Open in IMG/M |
| 3300008779|Ga0103594_10334 | Not Available | 539 | Open in IMG/M |
| 3300008791|Ga0103696_1032947 | Not Available | 566 | Open in IMG/M |
| 3300008839|Ga0103887_10165 | Not Available | 609 | Open in IMG/M |
| 3300008842|Ga0103890_10090 | Not Available | 623 | Open in IMG/M |
| 3300008846|Ga0103894_100294 | Not Available | 641 | Open in IMG/M |
| 3300008847|Ga0103895_10126 | Not Available | 558 | Open in IMG/M |
| 3300008856|Ga0103902_100809 | Not Available | 594 | Open in IMG/M |
| 3300008915|Ga0103480_103205 | Not Available | 584 | Open in IMG/M |
| 3300008921|Ga0103486_1009575 | Not Available | 627 | Open in IMG/M |
| 3300008922|Ga0103487_1014820 | Not Available | 515 | Open in IMG/M |
| 3300008956|Ga0104261_1036743 | Not Available | 599 | Open in IMG/M |
| 3300009076|Ga0115550_1231978 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009592|Ga0115101_1123665 | Not Available | 540 | Open in IMG/M |
| 3300009606|Ga0115102_10468424 | Not Available | 555 | Open in IMG/M |
| 3300009606|Ga0115102_10903961 | Not Available | 530 | Open in IMG/M |
| 3300009608|Ga0115100_10036915 | Not Available | 508 | Open in IMG/M |
| 3300009717|Ga0123375_14464 | Not Available | 508 | Open in IMG/M |
| 3300009723|Ga0123374_113087 | Not Available | 551 | Open in IMG/M |
| 3300009732|Ga0123373_176939 | Not Available | 525 | Open in IMG/M |
| 3300009748|Ga0123370_1015397 | Not Available | 550 | Open in IMG/M |
| 3300011298|Ga0138362_1076509 | Not Available | 548 | Open in IMG/M |
| 3300016723|Ga0182085_1348557 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Ostreida → Ostreoidea → Ostreidae → Ostrea → Ostrea edulis | 825 | Open in IMG/M |
| 3300016724|Ga0182048_1022240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → gamma proteobacterium HIMB30 | 4477 | Open in IMG/M |
| 3300016724|Ga0182048_1081172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4720 | Open in IMG/M |
| 3300016724|Ga0182048_1178434 | Not Available | 978 | Open in IMG/M |
| 3300016724|Ga0182048_1366065 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 605 | Open in IMG/M |
| 3300016726|Ga0182045_1189209 | Not Available | 989 | Open in IMG/M |
| 3300016729|Ga0182056_1124708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1587 | Open in IMG/M |
| 3300016732|Ga0182057_1208682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 570 | Open in IMG/M |
| 3300016733|Ga0182042_1218609 | Not Available | 871 | Open in IMG/M |
| 3300016734|Ga0182092_1466005 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales | 899 | Open in IMG/M |
| 3300016734|Ga0182092_1509046 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → environmental samples → uncultured Candidatus Poseidoniales archaeon | 648 | Open in IMG/M |
| 3300016734|Ga0182092_1509630 | Not Available | 593 | Open in IMG/M |
| 3300016736|Ga0182049_1020203 | Not Available | 561 | Open in IMG/M |
| 3300016739|Ga0182076_1329577 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae | 501 | Open in IMG/M |
| 3300016740|Ga0182096_1374919 | Not Available | 1197 | Open in IMG/M |
| 3300016748|Ga0182043_1063889 | Not Available | 510 | Open in IMG/M |
| 3300016751|Ga0182062_1011788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 728 | Open in IMG/M |
| 3300016751|Ga0182062_1137721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos | 927 | Open in IMG/M |
| 3300016766|Ga0182091_1340604 | Not Available | 790 | Open in IMG/M |
| 3300016766|Ga0182091_1433238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300018049|Ga0181572_10917905 | Not Available | 517 | Open in IMG/M |
| 3300018418|Ga0181567_10964989 | Not Available | 534 | Open in IMG/M |
| 3300018642|Ga0188867_1005984 | Not Available | 611 | Open in IMG/M |
| 3300018774|Ga0193570_1026951 | Not Available | 536 | Open in IMG/M |
| 3300018779|Ga0193149_1061590 | Not Available | 533 | Open in IMG/M |
| 3300019046|Ga0193546_10038066 | Not Available | 650 | Open in IMG/M |
| 3300019253|Ga0182064_1460676 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300019271|Ga0182065_1303630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
| 3300019271|Ga0182065_1505946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300019276|Ga0182067_1470085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300019283|Ga0182058_1313710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 2857 | Open in IMG/M |
| 3300020166|Ga0206128_1171530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 856 | Open in IMG/M |
| 3300020469|Ga0211577_10083245 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300021291|Ga0206694_1080297 | Not Available | 548 | Open in IMG/M |
| 3300021303|Ga0210308_1039116 | Not Available | 533 | Open in IMG/M |
| 3300021305|Ga0210296_1009731 | Not Available | 528 | Open in IMG/M |
| 3300021348|Ga0206695_1436369 | Not Available | 528 | Open in IMG/M |
| 3300021355|Ga0206690_10466294 | Not Available | 536 | Open in IMG/M |
| 3300022375|Ga0210313_1040604 | Not Available | 556 | Open in IMG/M |
| 3300022900|Ga0255771_1310744 | Not Available | 508 | Open in IMG/M |
| 3300023676|Ga0232114_131520 | Not Available | 522 | Open in IMG/M |
| 3300023683|Ga0228681_1046314 | Not Available | 515 | Open in IMG/M |
| 3300024180|Ga0228668_1052129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 808 | Open in IMG/M |
| 3300025701|Ga0209771_1032917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2047 | Open in IMG/M |
| 3300025729|Ga0209558_1185315 | Not Available | 675 | Open in IMG/M |
| 3300026390|Ga0247558_128089 | Not Available | 554 | Open in IMG/M |
| 3300026421|Ga0247569_1099032 | Not Available | 503 | Open in IMG/M |
| 3300026434|Ga0247591_1066563 | Not Available | 682 | Open in IMG/M |
| 3300026443|Ga0247559_1117377 | Not Available | 543 | Open in IMG/M |
| 3300026447|Ga0247607_1087056 | Not Available | 554 | Open in IMG/M |
| 3300026447|Ga0247607_1087173 | Not Available | 554 | Open in IMG/M |
| 3300026465|Ga0247588_1111716 | Not Available | 547 | Open in IMG/M |
| 3300026495|Ga0247571_1093293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 697 | Open in IMG/M |
| 3300026495|Ga0247571_1164564 | Not Available | 525 | Open in IMG/M |
| 3300026503|Ga0247605_1173730 | Not Available | 515 | Open in IMG/M |
| 3300026513|Ga0247590_1169979 | Not Available | 556 | Open in IMG/M |
| 3300028076|Ga0247562_1018683 | Not Available | 733 | Open in IMG/M |
| 3300028102|Ga0247586_1050322 | Not Available | 787 | Open in IMG/M |
| 3300028110|Ga0247584_1056855 | Not Available | 988 | Open in IMG/M |
| 3300028290|Ga0247572_1168883 | Not Available | 548 | Open in IMG/M |
| 3300030780|Ga0073988_10010566 | Not Available | 557 | Open in IMG/M |
| 3300030956|Ga0073944_11404539 | Not Available | 540 | Open in IMG/M |
| 3300033529|Ga0316587_1105992 | Not Available | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 25.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.59% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 16.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.41% |
| Coastal Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water | 7.41% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.63% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 4.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.78% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 2.78% |
| Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 2.78% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_135m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300002644 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_200m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300002685 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_200m_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003304 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI075_150m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003677 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003681 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004958 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_120m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006377 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006385 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006706 | Marine microbial communities from the Deep Indian Ocean - MP0958 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006718 | Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006732 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 250_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007325 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008550 | Planktonic microbial communities from coastal waters of California, USA - Canon-21 | Environmental | Open in IMG/M |
| 3300008562 | Planktonic microbial communities from coastal waters of California, USA - Canon-49 | Environmental | Open in IMG/M |
| 3300008564 | Planktonic microbial communities from coastal waters of California, USA - Canon-33 | Environmental | Open in IMG/M |
| 3300008602 | Planktonic microbial communities from coastal waters of California, USA - Canon-10 | Environmental | Open in IMG/M |
| 3300008603 | Planktonic microbial communities from coastal waters of California, USA - Canon-7 | Environmental | Open in IMG/M |
| 3300008671 | Planktonic microbial communities from coastal waters of California, USA - Canon-54 | Environmental | Open in IMG/M |
| 3300008675 | Planktonic microbial communities from coastal waters of California, USA - Canon-44 | Environmental | Open in IMG/M |
| 3300008693 | Planktonic microbial communities from coastal waters of California, USA - Canon-50 | Environmental | Open in IMG/M |
| 3300008779 | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 30m_>1.6micron | Environmental | Open in IMG/M |
| 3300008791 | Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLane | Environmental | Open in IMG/M |
| 3300008839 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2006 | Environmental | Open in IMG/M |
| 3300008842 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_4068 | Environmental | Open in IMG/M |
| 3300008846 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2054 | Environmental | Open in IMG/M |
| 3300008847 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2927 | Environmental | Open in IMG/M |
| 3300008856 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3062 | Environmental | Open in IMG/M |
| 3300008915 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA1 | Environmental | Open in IMG/M |
| 3300008921 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1 | Environmental | Open in IMG/M |
| 3300008922 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB2 | Environmental | Open in IMG/M |
| 3300008956 | Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLane | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009717 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_236_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009723 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_233_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009732 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009748 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011298 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300016723 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016724 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016729 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016736 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016740 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016751 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016766 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300018774 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 | Environmental | Open in IMG/M |
| 3300018779 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303) | Environmental | Open in IMG/M |
| 3300019046 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408503-ERR1336911) | Environmental | Open in IMG/M |
| 3300019253 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019271 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021303 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022375 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300023676 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023683 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025729 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026390 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026443 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028076 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028102 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030780 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030956 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0005258J37292_102231 | 3300002642 | Marine | GNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0005264J37220_100731 | 3300002644 | Marine | DRGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0005237J37283_10017481 | 3300002685 | Marine | GGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0005273J48911_10000921 | 3300003304 | Marine | NEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0008458J53046_1000341 | 3300003677 | Seawater | GNEIVSGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0008457_10000301 | 3300003681 | Seawater | GVNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0066614_1040201 | 3300004958 | Marine | GNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG* |
| Ga0066614_1044121 | 3300004958 | Marine | GGNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0079049_10504121 | 3300006377 | Marine | GNEISGLKLATDLRLERIYHCRITDVGEDDDLRIIIRKSVGG* |
| Ga0079050_10290412 | 3300006385 | Marine | EISGLKLATDLRLERIYHCRITDVGEDDDLRIIIRKSVGG* |
| Ga0079050_14292901 | 3300006385 | Marine | ISGLKLATDLRLKRIYHCRITDVGEGYDLRVTIHKSIGG* |
| Ga0005505_10304921 | 3300006706 | Deep Ocean | GNEISGLKLATDLRLKRIYHCRITDVGEDYVLRIIILKSIGG* |
| Ga0005504_12783582 | 3300006718 | Deep Ocean | LKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0079232_16000062 | 3300006732 | Marine | GNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0079257_13823121 | 3300007325 | Marine | EISGLKLATDLRLKRIYHCRITDVGEDYVLRIIILKSIGG* |
| Ga0079243_10118322 | 3300007326 | Marine | EISGLKLATDLRLKRIYHCRITDVGEEYVLRMIILKSIGV* |
| Ga0103924_141191 | 3300008550 | Coastal Water | SSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103942_108612 | 3300008562 | Coastal Water | SLGGNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG* |
| Ga0103930_15131 | 3300008564 | Coastal Water | TSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103918_113022 | 3300008602 | Coastal Water | PSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103916_11261 | 3300008603 | Coastal Water | SLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103945_114672 | 3300008671 | Coastal Water | ASLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103938_117002 | 3300008675 | Coastal Water | TSLGGNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG* |
| Ga0103943_124881 | 3300008693 | Coastal Water | SLGGNEISGLKLATGLGLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103594_103341 | 3300008779 | Ocean Water | SLGGNEISGLKLATDLRLKRIYHCWNTDVGEGHDLRIISHKSIGG* |
| Ga0103696_10329471 | 3300008791 | Ocean Water | GLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0103887_101651 | 3300008839 | Surface Ocean Water | KFRYPPDLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG* |
| Ga0103890_100902 | 3300008842 | Surface Ocean Water | KNEISGLKLATDLRLKRIYHCRTTDVGEDYVLRIIILKSIGG* |
| Ga0103894_1002941 | 3300008846 | Surface Ocean Water | KKKKLQSPRGNEISGLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG* |
| Ga0103895_101262 | 3300008847 | Surface Ocean Water | GNEISGLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG* |
| Ga0103902_1008091 | 3300008856 | Surface Ocean Water | EISGLKLATDLRPKRIYHCRVTDVGEDYVLRIIILKSIGG* |
| Ga0103480_1032051 | 3300008915 | Bay Water | GGNEISGLKLATDLRLKRIYHCRSTDVGEDNDLRIIIRKSIGG* |
| Ga0103486_10095751 | 3300008921 | Bay Water | GGICTCEISGLKLATDLRLKRIYHCRITDVGEGHDLRIIIHKSIGG* |
| Ga0103487_10148201 | 3300008922 | Bay Water | EISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0104261_10367431 | 3300008956 | Ocean Water | RSLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0115550_12319781 | 3300009076 | Pelagic Marine | MYSGNQSSLGGNEISGLKLATELRLKRNYHCRITDVGEDYDLRVIISKSIGGY |
| Ga0115101_11236651 | 3300009592 | Marine | GNKISGLKLATDLRLKRTYHCRITDVGQDYDLRIIISKSIGVYTVKTIS* |
| Ga0115102_104684241 | 3300009606 | Marine | GNEISGLKLATDLRLKRVYHCQITDVGEDDDLRIIIRKSIGG* |
| Ga0115102_109039611 | 3300009606 | Marine | GNEISGLKLATGLGLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
| Ga0115100_100369151 | 3300009608 | Marine | GLKLATDLRLKRVYRCRITDVGEDDDLRIIIRKSIGG* |
| Ga0123375_144641 | 3300009717 | Marine | EISGLKLATDLRLKRIYHCWITDVGEGYDLRIIIHKSIGG* |
| Ga0123374_1130871 | 3300009723 | Marine | GNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSVGG* |
| Ga0123373_1769391 | 3300009732 | Marine | EISGLKLATDLRLKRVYHCRIPDVGEDDDLRIIIRKSIGG* |
| Ga0123370_10153971 | 3300009748 | Marine | EISGLKLATDLRLKRIYHCRSTDVVEDNDLRIIIHKSIGG* |
| Ga0138362_10765091 | 3300011298 | Marine | GNEISGLKLATDLRLKRIYHCRITDVGEGHDLRVIIHKNVGG* |
| Ga0182085_13485571 | 3300016723 | Salt Marsh | EISGLKLATDLRLKRMYHCWITDVGEGYDLRIIIHKSIGAQKSPNL |
| Ga0182048_10222401 | 3300016724 | Salt Marsh | EISGLKLATDLRLKRIYRCRITDVGEGHDLRIIIHKSIGEQGFPQ |
| Ga0182048_10811721 | 3300016724 | Salt Marsh | EISGLKLATDLRLKRIYHCRITDVGEGRDLRIIIHKSIARSGGTNI |
| Ga0182048_11784341 | 3300016724 | Salt Marsh | EISGLKLATDLRLKRIYHCRITDVGEGHDLRIIIRKSIGVLRE |
| Ga0182048_13660652 | 3300016724 | Salt Marsh | NEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGGTKLLKLL |
| Ga0182045_11892091 | 3300016726 | Salt Marsh | EISGLKLATDLRLKRNYHCRITDVGEGYDLRIIIHKSIGAVAWS |
| Ga0182056_11247081 | 3300016729 | Salt Marsh | NEISGLKLATDLRLKRIYHCRITDVGEGHDRRIIIHKSIGGE |
| Ga0182057_12086821 | 3300016732 | Salt Marsh | MLVDSNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0182042_12186092 | 3300016733 | Salt Marsh | NEISGLKLATDLRLKRTYHCRITDVGEGYDLRIIIHKSIGGLFELIFLTFV |
| Ga0182092_14660051 | 3300016734 | Salt Marsh | EISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSVGDSP |
| Ga0182092_15090463 | 3300016734 | Salt Marsh | NEISGLKLATDLRLKRIYHCRITDVGEGHDLRIIIHKSIGALVDDCA |
| Ga0182092_15096302 | 3300016734 | Salt Marsh | NEISGLKLATDLRLKRIYHCRITDVGEDDDLRIIIRKSIGAAQ |
| Ga0182049_10202031 | 3300016736 | Salt Marsh | VTGTIKREHEISGLKLATDLRLKRIYHCRITDVGEGHDLRIIIRKSIGG |
| Ga0182076_13295771 | 3300016739 | Salt Marsh | EISGLKLAADLRLKRIYHCWITDVGEGYDLRIIIHKSIGAAFGHGLVDPK |
| Ga0182096_13749191 | 3300016740 | Salt Marsh | VKIDKNEVKRCEISGLKLATDLRLKRTYHCRITDVGEGYDLRIIIHKSIG |
| Ga0182043_10638892 | 3300016748 | Salt Marsh | NEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGGLFILRLMII |
| Ga0182062_10117882 | 3300016751 | Salt Marsh | EISGLKLATGLRLKRTYHCRITDVGEGYDLRIIIHKSIGAM |
| Ga0182062_11377213 | 3300016751 | Salt Marsh | NEISGLKLATDLRLKRTYHCRITDVGEGYDLRIIIHKSIGALARIAKRSR |
| Ga0182091_13406043 | 3300016766 | Salt Marsh | MGLGEISGLKLATDLRLKRTYHCRITDVGEGYDLRIIIHKSIGG |
| Ga0182091_14332381 | 3300016766 | Salt Marsh | EISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGALLS |
| Ga0181572_109179051 | 3300018049 | Salt Marsh | LGGNEISGLKLATDLRLKRIYHCRITDVGEGHDLRIIIHKSIGG |
| Ga0181567_109649891 | 3300018418 | Salt Marsh | GNEISGLKLATDLRLKRIYHCRITDVGDGYDLRIIIHKSIGG |
| Ga0188867_10059841 | 3300018642 | Freshwater Lake | LGGNEISGLKLATDLRQKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0193570_10269511 | 3300018774 | Marine | QSSLGGNEISGLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG |
| Ga0193149_10615901 | 3300018779 | Marine | NEISGLKLGTDLRLKRIYHCRITDVGEGRDLRIIIHKSIGG |
| Ga0193546_100380661 | 3300019046 | Marine | GGNEISGLKLATGLRLKRIYHCRITDVGEGHDLRIIIHKSIGG |
| Ga0182064_14606761 | 3300019253 | Salt Marsh | EISGLKLATDLRLKRMYHCWITDVGEGYDLRIIIHKSIGVLVFF |
| Ga0182065_13036301 | 3300019271 | Salt Marsh | EISGLKLATGLRLKRIYHCRITDVGEGHDLRIIIRKSIGATIV |
| Ga0182065_15059461 | 3300019271 | Salt Marsh | MVTTDTDLRLKRVYHCRITDVGEDDDLRIIIHKSIG |
| Ga0182067_14700852 | 3300019276 | Salt Marsh | NEISGLKLATDLRLKRIYHCRITDVGEGYDLRIIIHKSIGAFVASAP |
| Ga0182058_13137101 | 3300019283 | Salt Marsh | EISGLKLATDLRLKRIYHCWITDVGEDDDIRIIIRKSIGASQEILKIL |
| Ga0206128_11715302 | 3300020166 | Seawater | SLGGNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0211577_100832454 | 3300020469 | Marine | MANLVYIRSQSSLGGNEISGLKLATDLRLKRIYHCRITDVGEGHDLRVIIHKNVGG |
| Ga0206694_10802971 | 3300021291 | Seawater | NEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGS |
| Ga0210308_10391161 | 3300021303 | Estuarine | GNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG |
| Ga0210296_10097311 | 3300021305 | Estuarine | GNEISGLKLATGLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0206695_14363691 | 3300021348 | Seawater | GNEISGLKLATDLRLKRVYHCRITDVGEDNDLRIIIRKSIGG |
| Ga0206690_104662942 | 3300021355 | Seawater | LKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0210313_10406041 | 3300022375 | Estuarine | GGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0255771_13107441 | 3300022900 | Salt Marsh | SSLGGNEISGLKLATDLRLKRIYHCRITDVGEGHDRRIIIHKSIGG |
| Ga0232114_1315201 | 3300023676 | Seawater | KISGLKLATDLRLKRTYHCRITDVGQDYDLRIIISKSIGVYTVKTIS |
| Ga0228681_10463141 | 3300023683 | Seawater | ISGLKLATDLRLKRTYHCRITDVGQDYDLRIIISKSIGVYTVKTIS |
| Ga0228668_10521291 | 3300024180 | Seawater | NEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0209771_10329174 | 3300025701 | Marine | LNQSSLGGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0209558_11853152 | 3300025729 | Marine | SSLGGNEISGLKLATDLRLKRIYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0247558_1280892 | 3300026390 | Seawater | GNEISGLKLATDLRLKRVYHCRITDVGEDGDLRISIRKSIGG |
| Ga0247569_10990321 | 3300026421 | Seawater | GNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIVIRKSIGG |
| Ga0247591_10665632 | 3300026434 | Seawater | EISGLKLATDLRLKRVYRCRITDVGEDDDLRIIIRKSIGGFKIFFNK |
| Ga0247559_11173772 | 3300026443 | Seawater | GNEISGLKLVTDLRLKRIYHCWITDVGEGYDLRIIIHKSIGG |
| Ga0247607_10870562 | 3300026447 | Seawater | GNKISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG |
| Ga0247607_10871731 | 3300026447 | Seawater | GNEISGLKLATDLRLKRTYHCRITDVGQDYDLRIIISKSIGVYTVKTIS |
| Ga0247588_11117162 | 3300026465 | Seawater | EISGLKLATDLRLKRVYHCRITDVGEDNDLRIIIRKSIGG |
| Ga0247571_10932931 | 3300026495 | Seawater | EISGLKLGGDLWIKRVYHCGTTDDGEDDDLRIIIRKSIGALFFQVW |
| Ga0247571_11645642 | 3300026495 | Seawater | GGNEISGLKLATDLRLKRVYHCRITDVGEDDYLWIIIRKSIGGQIVKANS |
| Ga0247605_11737301 | 3300026503 | Seawater | GNKISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG |
| Ga0247590_11699791 | 3300026513 | Seawater | LGGNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIIRKSIGG |
| Ga0247562_10186832 | 3300028076 | Seawater | GNEISGLKLATDLRLKRIYHCRIIDVGEDYDLRTIIRKSIGG |
| Ga0247586_10503221 | 3300028102 | Seawater | EISGLKLATDLMLRRVYHWRITDVGEDDDLRIIIRKSIGG |
| Ga0247584_10568551 | 3300028110 | Seawater | GNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGAQI |
| Ga0247572_11688831 | 3300028290 | Seawater | EISGLKLATDLRLKPNYHCRITDVGEDYDLRIIIRKSIGG |
| Ga0073988_100105661 | 3300030780 | Marine | GNEISGLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG |
| Ga0073944_114045392 | 3300030956 | Marine | GNEISGLKLATGLRLKRVYHCRVTDVGEDDDLRIIIRKSIGG |
| Ga0316587_11059921 | 3300033529 | Rhizosphere | GNEISGLKLATDLRLKRIYHCRITDVGEGHDRRIIIHKSIGG |
| ⦗Top⦘ |