


| Basic Information | |
|---|---|
| Family ID | F088455 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.495 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.945 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00881 | Nitroreductase | 48.62 |
| PF09084 | NMT1 | 14.68 |
| PF13977 | TetR_C_6 | 7.34 |
| PF03729 | DUF308 | 4.59 |
| PF00440 | TetR_N | 4.59 |
| PF13458 | Peripla_BP_6 | 3.67 |
| PF00005 | ABC_tran | 3.67 |
| PF02311 | AraC_binding | 2.75 |
| PF04879 | Molybdop_Fe4S4 | 1.83 |
| PF05015 | HigB-like_toxin | 0.92 |
| PF00557 | Peptidase_M24 | 0.92 |
| PF00528 | BPD_transp_1 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 14.68 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 14.68 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 4.59 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.50 % |
| Unclassified | root | N/A | 5.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig368888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 2199352025|deepsgr__Contig_52650 | Not Available | 2328 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1347372 | Not Available | 502 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100823929 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100826802 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300000955|JGI1027J12803_108527035 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300004114|Ga0062593_102486433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300004114|Ga0062593_102712511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300004643|Ga0062591_102586430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005332|Ga0066388_104049143 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005363|Ga0008090_10265965 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005363|Ga0008090_14167919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 634 | Open in IMG/M |
| 3300005436|Ga0070713_100591275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300005546|Ga0070696_100720681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300005546|Ga0070696_101344341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300005764|Ga0066903_100490550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2076 | Open in IMG/M |
| 3300005764|Ga0066903_104121453 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005764|Ga0066903_105787006 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005764|Ga0066903_107695706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300006042|Ga0075368_10512536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 536 | Open in IMG/M |
| 3300006051|Ga0075364_11081250 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006051|Ga0075364_11114669 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006844|Ga0075428_101815320 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300009088|Ga0099830_10100840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2155 | Open in IMG/M |
| 3300009148|Ga0105243_10015651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 5734 | Open in IMG/M |
| 3300009181|Ga0114969_10324869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300009792|Ga0126374_11153211 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010358|Ga0126370_11498418 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010362|Ga0126377_13579462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300010366|Ga0126379_11829215 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010366|Ga0126379_13531336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300010398|Ga0126383_12679739 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010398|Ga0126383_13042416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012927|Ga0137416_10274995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1386 | Open in IMG/M |
| 3300012937|Ga0162653_100018506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300012957|Ga0164303_11248420 | Not Available | 547 | Open in IMG/M |
| 3300012987|Ga0164307_10937284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300012988|Ga0164306_11696332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 548 | Open in IMG/M |
| 3300012989|Ga0164305_10140533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1623 | Open in IMG/M |
| 3300015245|Ga0137409_10881223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300016341|Ga0182035_10311919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1294 | Open in IMG/M |
| 3300016341|Ga0182035_12126620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300016357|Ga0182032_11707552 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300016371|Ga0182034_10062739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2512 | Open in IMG/M |
| 3300016445|Ga0182038_11727174 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018074|Ga0184640_10273065 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300019362|Ga0173479_10244422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300020005|Ga0193697_1091575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
| 3300021170|Ga0210400_10749054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 802 | Open in IMG/M |
| 3300021560|Ga0126371_13734468 | Not Available | 513 | Open in IMG/M |
| 3300022534|Ga0224452_1247280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300025916|Ga0207663_10896831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 709 | Open in IMG/M |
| 3300026067|Ga0207678_10225488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300026306|Ga0209468_1095143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300026494|Ga0257159_1069484 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026844|Ga0208760_102183 | Not Available | 564 | Open in IMG/M |
| 3300027903|Ga0209488_10110921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2060 | Open in IMG/M |
| 3300028714|Ga0307309_10206734 | Not Available | 519 | Open in IMG/M |
| 3300028717|Ga0307298_10060988 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300028718|Ga0307307_10158651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300028755|Ga0307316_10221398 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028771|Ga0307320_10225889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 735 | Open in IMG/M |
| 3300028778|Ga0307288_10080833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1161 | Open in IMG/M |
| 3300028814|Ga0307302_10432418 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031544|Ga0318534_10057041 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300031545|Ga0318541_10678808 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031547|Ga0310887_10666586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300031549|Ga0318571_10056246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1187 | Open in IMG/M |
| 3300031549|Ga0318571_10273591 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031572|Ga0318515_10109492 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300031680|Ga0318574_10456735 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031680|Ga0318574_10769040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300031681|Ga0318572_10089490 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300031681|Ga0318572_10688782 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031719|Ga0306917_10664061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 819 | Open in IMG/M |
| 3300031724|Ga0318500_10069921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1540 | Open in IMG/M |
| 3300031744|Ga0306918_10157573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1683 | Open in IMG/M |
| 3300031763|Ga0318537_10036075 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300031765|Ga0318554_10051331 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300031765|Ga0318554_10084336 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300031769|Ga0318526_10263984 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031780|Ga0318508_1132546 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031793|Ga0318548_10014038 | All Organisms → cellular organisms → Bacteria | 3231 | Open in IMG/M |
| 3300031794|Ga0318503_10199533 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031796|Ga0318576_10412194 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031797|Ga0318550_10448621 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031821|Ga0318567_10548457 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031860|Ga0318495_10175995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 964 | Open in IMG/M |
| 3300031879|Ga0306919_10236098 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300031879|Ga0306919_11537439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031890|Ga0306925_11607946 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031890|Ga0306925_11882488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300031894|Ga0318522_10285059 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031896|Ga0318551_10164938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1214 | Open in IMG/M |
| 3300031897|Ga0318520_10506078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300031910|Ga0306923_12208394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 552 | Open in IMG/M |
| 3300031912|Ga0306921_11737654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031941|Ga0310912_10150709 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300031981|Ga0318531_10204157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 891 | Open in IMG/M |
| 3300032010|Ga0318569_10047944 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300032010|Ga0318569_10279978 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300032039|Ga0318559_10313937 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032051|Ga0318532_10216577 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300032055|Ga0318575_10187896 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300032064|Ga0318510_10284515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300032091|Ga0318577_10564155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300033289|Ga0310914_11318355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300033290|Ga0318519_10776460 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300033433|Ga0326726_10680681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.75% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.92% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026844 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_06094760 | 2140918008 | Soil | RGIGFILIRAMEANKVRDIMALTLLLFAFAVTVNTLLLAAEHRMQRK |
| deepsgr_00593510 | 2199352025 | Soil | MLIRAMEAHKVLDIMALTLLLFGFATAANMLLLAVERRLHRR |
| ICChiseqgaiiDRAFT_13473722 | 3300000033 | Soil | GYSLVRAMDTHQVLEIMALTFLLFAFAALANGLLLLLERQVR* |
| INPhiseqgaiiFebDRAFT_1008239291 | 3300000364 | Soil | MLIRAMEAHTVLDIMALTLLLFAFAASANALLLVIERRVHRQ* |
| INPhiseqgaiiFebDRAFT_1008268022 | 3300000364 | Soil | LIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRQ* |
| JGI1027J12803_1085270352 | 3300000955 | Soil | DQGLGFMLIRAMEAHTVLDIMALTLLLFAFAASANALLLVIERRVHRQ* |
| Ga0062593_1024864332 | 3300004114 | Soil | MLIRAMEAHKVLDIMALTLLLFGFATAANMLLLAVERRLHRR* |
| Ga0062593_1027125111 | 3300004114 | Soil | DRGIGFMLIRAMEANNVLDIMSLTLLLFIFAGVANTILLAVERRVHHGNQ* |
| Ga0062591_1025864301 | 3300004643 | Soil | LIRAMEAHKVLDIMALTLLLFGFAAAANMLLLAVERRLHRR* |
| Ga0066388_1040491431 | 3300005332 | Tropical Forest Soil | DQGLGFMLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHGR* |
| Ga0008090_102659651 | 3300005363 | Tropical Rainforest Soil | QGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR* |
| Ga0008090_141679192 | 3300005363 | Tropical Rainforest Soil | LVRAMEAHKVTDIMALTLLLFAFAAGANALLMAVEHRIHRR* |
| Ga0070713_1005912751 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR* |
| Ga0070696_1007206812 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GFMLIRAMEAHKVLDIMALTLLLFGFAAAANMALLALERRLQRR* |
| Ga0070696_1013443412 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGFMLIRAMEAHKVLDIMALTLLLFGFAIAANMLLLAVERRLHRR* |
| Ga0066903_1004905503 | 3300005764 | Tropical Forest Soil | MLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHGR* |
| Ga0066903_1041214531 | 3300005764 | Tropical Forest Soil | RAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ* |
| Ga0066903_1057870061 | 3300005764 | Tropical Forest Soil | GFMLIRAMEAHKVLDIMALTLLLFGFAALANALLLAVERGVHPR* |
| Ga0066903_1076957061 | 3300005764 | Tropical Forest Soil | SDQGLGFILIRAMEAHKVLDIMALTLLLFAFAALANTLLLAVERRMRPQ* |
| Ga0075368_105125361 | 3300006042 | Populus Endosphere | MLIRAMEQHIVVDIMAVTLFLFAVAGIANALLLTIERRLQWK* |
| Ga0075364_110812502 | 3300006051 | Populus Endosphere | IRAMEAHKVLDIMALTLLLFAFAALANALLLAVERRVHPR* |
| Ga0075364_111146691 | 3300006051 | Populus Endosphere | AMEAHKVLDIMALTLLLFGFAALANALLLAVERRVHPG* |
| Ga0075428_1018153201 | 3300006844 | Populus Rhizosphere | GLGFMLIRAMEAHKVLDIMALTLLLFGFAALANALLLAVERRVHPR* |
| Ga0099830_101008403 | 3300009088 | Vadose Zone Soil | EAHKVLDIVALTLLLFAFAAIANGLLLVVERRMHQR* |
| Ga0105243_100156518 | 3300009148 | Miscanthus Rhizosphere | RAMEEHKVLDIMALTLLLFGFATAANMLLLAVERRLHRR* |
| Ga0114969_103248692 | 3300009181 | Freshwater Lake | GFMLIRAMEAHKVTDIMALAFLLFAAATAIGAGLLAVERRFHG* |
| Ga0126374_111532112 | 3300009792 | Tropical Forest Soil | AMEAHKVLDIMALTLLLFAFAASANALLLLVERRVHRQ* |
| Ga0126370_114984181 | 3300010358 | Tropical Forest Soil | QGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR* |
| Ga0126377_135794622 | 3300010362 | Tropical Forest Soil | QGLGFMLIRAMEAHKVLDIMALTLLLFAFAALANALLLAIERRVHPR* |
| Ga0126379_118292152 | 3300010366 | Tropical Forest Soil | EANKVLDIMALTLLLFAFAAVANALLLALERRAHRQ* |
| Ga0126379_135313362 | 3300010366 | Tropical Forest Soil | LGFMLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ* |
| Ga0126383_126797391 | 3300010398 | Tropical Forest Soil | LIRAMEAHKVLDIMALTLLLFAFAALANTLLLAVERHMRPQ* |
| Ga0126383_130424161 | 3300010398 | Tropical Forest Soil | IRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRAHRR* |
| Ga0137416_102749951 | 3300012927 | Vadose Zone Soil | RAMEAHKVLDIMALTLLLFAFAVAANMLLLAVERRVHRR* |
| Ga0162653_1000185061 | 3300012937 | Soil | QVNKAIEAMEAHKVLDIMALTLLLFGFAIAANMLLLAVERRLHRR* |
| Ga0164303_112484202 | 3300012957 | Soil | HKVIDIMALTLLLFAFAAAANMALLAVERRVHRQ* |
| Ga0164307_109372841 | 3300012987 | Soil | GLGFMLIRAMEAHKVLDIMALTLLLFGFAATANMLLLAVERRMHRR* |
| Ga0164306_116963321 | 3300012988 | Soil | RAMEAHKVLDIMALTLLLFGFATAANMMLLAVERRLHRR* |
| Ga0164305_101405333 | 3300012989 | Soil | GFMLIRAMEAHKVLDIMALTLLLFGFAIAANMLLLAVERRLHRR* |
| Ga0137409_108812231 | 3300015245 | Vadose Zone Soil | GFVLIRATESHNVLDIMALTLLLFAFATASNGLLLLLEHQVRRHA* |
| Ga0182035_103119191 | 3300016341 | Soil | RGIGFILARAMEAHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0182035_121266202 | 3300016341 | Soil | EAHKVLDIMALTLLLFAFAASANALLLLVERRVHRQ |
| Ga0182032_117075522 | 3300016357 | Soil | FMLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ |
| Ga0182034_100627391 | 3300016371 | Soil | AHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0182038_117271742 | 3300016445 | Soil | GFMLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ |
| Ga0184640_102730651 | 3300018074 | Groundwater Sediment | MLIRAMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRMHRR |
| Ga0173479_102444222 | 3300019362 | Soil | QGLGFMLIRAMEAHKVLDIMALTLLLFGFAAAANIALLALERRLHRR |
| Ga0193697_10915751 | 3300020005 | Soil | RAMEAHKVLDIMALTLLLFGFAIAANMLLLAVERRLHRR |
| Ga0210400_107490543 | 3300021170 | Soil | AMDANRVPDIMALTLILFTCAATANLLLLALEHRLQRR |
| Ga0126371_137344681 | 3300021560 | Tropical Forest Soil | MLIRAMENHQVADIMAVTLFLFMIAGIANAGLLAIERRLQWK |
| Ga0224452_12472801 | 3300022534 | Groundwater Sediment | LIRAMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRMRRRSVFSS |
| Ga0207663_108968311 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QGLGFMLIRAMEAHKVLDIMALTLLLFGFAATANMLLLAVERRMHRR |
| Ga0207678_102254881 | 3300026067 | Corn Rhizosphere | EAHKVLDIMALTLLLFGFATAANMLLLAVERRLHRR |
| Ga0209468_10951431 | 3300026306 | Soil | EAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRQ |
| Ga0257159_10694842 | 3300026494 | Soil | EAHKVLDIVALTLLLFAFSAIANGLLLVVERRVHRQ |
| Ga0208760_1021832 | 3300026844 | Soil | AMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRLHRR |
| Ga0209488_101109214 | 3300027903 | Vadose Zone Soil | MEAHKVIDIMALTLLLFAFAAAANMLLLAVERRMHTQ |
| Ga0307309_102067341 | 3300028714 | Soil | FMLIRAMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRMRRR |
| Ga0307298_100609882 | 3300028717 | Soil | AHKVLDIMALTLLLFAFAAAANMLLLAVERRMRRR |
| Ga0307307_101586511 | 3300028718 | Soil | LIRAMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRMRRR |
| Ga0307316_102213981 | 3300028755 | Soil | LGFILIRAMEAHKVLDIMALTLLLFAFAAFANALLLVVERRVHRR |
| Ga0307320_102258892 | 3300028771 | Soil | IRAMEAHKVLDIMALTLLLFGFAIAANMLLLAVERRLHRR |
| Ga0307288_100808332 | 3300028778 | Soil | QGLGFMLIRAMEAHKVLDIMALTLLLFGFAAAANMLLLAVERRLHRR |
| Ga0307302_104324182 | 3300028814 | Soil | MEAHNVLDIMALTLLLFAFAAFANALLLAVERRMHRR |
| Ga0318534_100570411 | 3300031544 | Soil | LGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318541_106788081 | 3300031545 | Soil | MLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ |
| Ga0310887_106665862 | 3300031547 | Soil | IRAMEAHKVLDIMALTLLLFGFATAANMLLLAVERRRHRR |
| Ga0318571_100562462 | 3300031549 | Soil | IRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318571_102735912 | 3300031549 | Soil | GLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVAERRVHRR |
| Ga0318515_101094923 | 3300031572 | Soil | QGLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0318574_104567353 | 3300031680 | Soil | LIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318574_107690402 | 3300031680 | Soil | DQGLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRQ |
| Ga0318572_100894901 | 3300031681 | Soil | DQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318572_106887822 | 3300031681 | Soil | AMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0306917_106640612 | 3300031719 | Soil | SDQGLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRQ |
| Ga0318500_100699213 | 3300031724 | Soil | MEAHKVLDIMALTLLLFAFAASANSLLLVVERRVHRQ |
| Ga0306918_101575734 | 3300031744 | Soil | EAHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0318537_100360751 | 3300031763 | Soil | FMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318554_100513314 | 3300031765 | Soil | AHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318554_100843363 | 3300031765 | Soil | ASDQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318526_102639841 | 3300031769 | Soil | AMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0318508_11325462 | 3300031780 | Soil | SDQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318548_100140381 | 3300031793 | Soil | MLIRAWEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318503_101995333 | 3300031794 | Soil | ASDQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318576_104121941 | 3300031796 | Soil | RAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318550_104486211 | 3300031797 | Soil | FMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318567_105484573 | 3300031821 | Soil | QGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318495_101759951 | 3300031860 | Soil | MEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0306919_102360983 | 3300031879 | Soil | AHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0306919_115374392 | 3300031879 | Soil | GLGFMLIRAMEAHKVLDIMALTLLLFAFAASANALLLVVERRVHRQ |
| Ga0306925_116079461 | 3300031890 | Soil | GLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0306925_118824882 | 3300031890 | Soil | GLGFMLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRQ |
| Ga0318522_102850592 | 3300031894 | Soil | MLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318551_101649381 | 3300031896 | Soil | DQGLGFMLIRAMEAHKVLDIMALTLLLFAFAASANSLLLVVERRVHRQ |
| Ga0318520_105060782 | 3300031897 | Soil | LARAMEAHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0306923_122083941 | 3300031910 | Soil | SDQGIGFILIRAMEAHKVTDIMALTLLLFAFAAVANMLLLGLERHTHRR |
| Ga0306921_117376542 | 3300031912 | Soil | MEEHKVTDIMALTLLLFAFAASANALLMAVEHRIHRH |
| Ga0310912_101507091 | 3300031941 | Soil | AMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318531_102041571 | 3300031981 | Soil | EAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318569_100479443 | 3300032010 | Soil | RAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0318569_102799781 | 3300032010 | Soil | LGFMLIRAMEAHKVLDIIALTLLLFAFAAIANVLLLVVERRVHRR |
| Ga0318559_103139371 | 3300032039 | Soil | MLIRAMEAHKVLDIVALTLLLFAFAAIANGLLLVVERRVHRR |
| Ga0318532_102165771 | 3300032051 | Soil | SDQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318575_101878963 | 3300032055 | Soil | DQGLGFMLIRAMEAHKVLDIIALTLLLFAFAAIANALLLVVERRVHRR |
| Ga0318510_102845151 | 3300032064 | Soil | DRGIGFILARAMEAHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0318577_105641551 | 3300032091 | Soil | GLGFMLIRAMEAHKVLDIMALTLLLFAFAASANALLLLVERRVHRQ |
| Ga0310914_113183551 | 3300033289 | Soil | IGFILARAMEAHKVTDIMALTLLLFAFAAGANALLMAVDHRIHRH |
| Ga0318519_107764603 | 3300033290 | Soil | RAMEAHKVLDIIALSLLLFAFAAIANALLLVVERRVHRR |
| Ga0326726_106806811 | 3300033433 | Peat Soil | GFILIRAMEAHKVLDIMALTLLLFAFAAAANMLLLAVERRVHH |
| ⦗Top⦘ |