


| Basic Information | |
|---|---|
| Family ID | F084703 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AVEVLPSSLPRELFSTTAPRFLPDKLEPLGFSLSGQLRVAS |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.214 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.821 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF03054 | tRNA_Me_trans | 77.68 |
| PF00459 | Inositol_P | 8.93 |
| PF12073 | DUF3553 | 5.36 |
| PF00216 | Bac_DNA_binding | 1.79 |
| PF01323 | DSBA | 1.79 |
| PF02631 | RecX | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 77.68 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.79 |
| COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.21 % |
| All Organisms | root | All Organisms | 26.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000152|LPjun08P12500mDRAFT_c1055856 | Not Available | 536 | Open in IMG/M |
| 3300000179|LPjun09P16500mDRAFT_c1006248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2342 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1006920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2688 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1014210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300000971|JGI12060J13090_102645 | Not Available | 1028 | Open in IMG/M |
| 3300001126|JGI12156J13080_102544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1153 | Open in IMG/M |
| 3300001459|MCRcombined_1448363 | Not Available | 554 | Open in IMG/M |
| 3300001676|TuiMalila_1026451 | Not Available | 1328 | Open in IMG/M |
| 3300001678|Mariner_1001638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 12078 | Open in IMG/M |
| 3300001679|TahiMoana_1033441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1684 | Open in IMG/M |
| 3300001680|KiloMoana_10032841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2322 | Open in IMG/M |
| 3300001680|KiloMoana_10059489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2176 | Open in IMG/M |
| 3300001769|supr60_1011074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1866 | Open in IMG/M |
| 3300001783|Vondamm_10037113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1579 | Open in IMG/M |
| 3300005398|Ga0066858_10137520 | Not Available | 708 | Open in IMG/M |
| 3300005399|Ga0066860_10069166 | Not Available | 1286 | Open in IMG/M |
| 3300005399|Ga0066860_10225490 | Not Available | 632 | Open in IMG/M |
| 3300005408|Ga0066848_10011052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2660 | Open in IMG/M |
| 3300005425|Ga0066859_10167628 | Not Available | 651 | Open in IMG/M |
| 3300005429|Ga0066846_10051993 | Not Available | 1461 | Open in IMG/M |
| 3300005430|Ga0066849_10257933 | Not Available | 671 | Open in IMG/M |
| 3300005592|Ga0066838_10209496 | Not Available | 544 | Open in IMG/M |
| 3300005605|Ga0066850_10014400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3450 | Open in IMG/M |
| 3300005948|Ga0066380_10279724 | Not Available | 511 | Open in IMG/M |
| 3300005953|Ga0066383_10017174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2458 | Open in IMG/M |
| 3300005953|Ga0066383_10132917 | Not Available | 743 | Open in IMG/M |
| 3300006002|Ga0066368_10016583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2594 | Open in IMG/M |
| 3300006012|Ga0066374_10086185 | Not Available | 897 | Open in IMG/M |
| 3300006012|Ga0066374_10122929 | Not Available | 750 | Open in IMG/M |
| 3300006013|Ga0066382_10021693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2303 | Open in IMG/M |
| 3300006013|Ga0066382_10035765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1778 | Open in IMG/M |
| 3300006019|Ga0066375_10035726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1725 | Open in IMG/M |
| 3300006166|Ga0066836_10930015 | Not Available | 524 | Open in IMG/M |
| 3300006308|Ga0068470_1153219 | Not Available | 1172 | Open in IMG/M |
| 3300006330|Ga0068483_1595383 | Not Available | 543 | Open in IMG/M |
| 3300006341|Ga0068493_10342441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1664 | Open in IMG/M |
| 3300006736|Ga0098033_1142890 | Not Available | 672 | Open in IMG/M |
| 3300006793|Ga0098055_1158776 | Not Available | 868 | Open in IMG/M |
| 3300006902|Ga0066372_10068064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1775 | Open in IMG/M |
| 3300006902|Ga0066372_10108632 | Not Available | 1441 | Open in IMG/M |
| 3300006902|Ga0066372_10307276 | Not Available | 898 | Open in IMG/M |
| 3300006902|Ga0066372_10361051 | Not Available | 832 | Open in IMG/M |
| 3300006902|Ga0066372_10724583 | Not Available | 599 | Open in IMG/M |
| 3300007291|Ga0066367_1014598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2586 | Open in IMG/M |
| 3300007291|Ga0066367_1339352 | Not Available | 595 | Open in IMG/M |
| 3300007770|Ga0105015_1146123 | Not Available | 762 | Open in IMG/M |
| 3300009104|Ga0117902_1479365 | Not Available | 1065 | Open in IMG/M |
| 3300009409|Ga0114993_10563431 | Not Available | 841 | Open in IMG/M |
| 3300009481|Ga0114932_10376385 | Not Available | 844 | Open in IMG/M |
| 3300009593|Ga0115011_11937708 | Not Available | 536 | Open in IMG/M |
| 3300010883|Ga0133547_11426884 | Not Available | 1305 | Open in IMG/M |
| 3300020254|Ga0211669_1038678 | Not Available | 669 | Open in IMG/M |
| 3300020389|Ga0211680_10109812 | Not Available | 1136 | Open in IMG/M |
| 3300020415|Ga0211553_10092769 | Not Available | 1259 | Open in IMG/M |
| 3300020419|Ga0211512_10400726 | Not Available | 618 | Open in IMG/M |
| 3300020425|Ga0211549_10009647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3527 | Open in IMG/M |
| 3300020425|Ga0211549_10096586 | Not Available | 1133 | Open in IMG/M |
| 3300020425|Ga0211549_10190820 | Not Available | 811 | Open in IMG/M |
| 3300020425|Ga0211549_10262907 | Not Available | 693 | Open in IMG/M |
| 3300020426|Ga0211536_10191946 | Not Available | 796 | Open in IMG/M |
| 3300020434|Ga0211670_10349114 | Not Available | 618 | Open in IMG/M |
| 3300020435|Ga0211639_10219121 | Not Available | 788 | Open in IMG/M |
| 3300020443|Ga0211544_10022466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2542 | Open in IMG/M |
| 3300020444|Ga0211578_10021247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2508 | Open in IMG/M |
| 3300020444|Ga0211578_10051468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1565 | Open in IMG/M |
| 3300020458|Ga0211697_10028889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2362 | Open in IMG/M |
| 3300020466|Ga0211714_10600964 | Not Available | 514 | Open in IMG/M |
| 3300020472|Ga0211579_10064539 | Not Available | 2242 | Open in IMG/M |
| 3300020472|Ga0211579_10192140 | Not Available | 1189 | Open in IMG/M |
| 3300021089|Ga0206679_10027235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3611 | Open in IMG/M |
| 3300021345|Ga0206688_10675698 | Not Available | 544 | Open in IMG/M |
| 3300021352|Ga0206680_10384391 | Not Available | 545 | Open in IMG/M |
| 3300021443|Ga0206681_10431930 | Not Available | 507 | Open in IMG/M |
| 3300021791|Ga0226832_10237498 | Not Available | 725 | Open in IMG/M |
| 3300022225|Ga0187833_10027101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4336 | Open in IMG/M |
| 3300025199|Ga0208331_122571 | Not Available | 568 | Open in IMG/M |
| 3300025204|Ga0208063_1015735 | Not Available | 1243 | Open in IMG/M |
| 3300025221|Ga0208336_1000557 | Not Available | 14451 | Open in IMG/M |
| 3300025265|Ga0208467_1049502 | Not Available | 642 | Open in IMG/M |
| 3300025863|Ga0208833_1063481 | Not Available | 584 | Open in IMG/M |
| 3300026087|Ga0208113_1033360 | Not Available | 1461 | Open in IMG/M |
| 3300026119|Ga0207966_1017281 | Not Available | 2281 | Open in IMG/M |
| 3300026119|Ga0207966_1029268 | Not Available | 1586 | Open in IMG/M |
| 3300026207|Ga0208895_1121670 | Not Available | 694 | Open in IMG/M |
| 3300026207|Ga0208895_1124964 | Not Available | 683 | Open in IMG/M |
| 3300026208|Ga0208640_1027003 | Not Available | 1536 | Open in IMG/M |
| 3300026268|Ga0208641_1067378 | Not Available | 1065 | Open in IMG/M |
| 3300026269|Ga0208766_1010034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3941 | Open in IMG/M |
| 3300027630|Ga0209432_1125780 | Not Available | 744 | Open in IMG/M |
| 3300028190|Ga0257108_1037306 | Not Available | 1466 | Open in IMG/M |
| 3300028488|Ga0257113_1159648 | Not Available | 675 | Open in IMG/M |
| 3300028489|Ga0257112_10046379 | Not Available | 1617 | Open in IMG/M |
| 3300028489|Ga0257112_10113578 | Not Available | 979 | Open in IMG/M |
| 3300028489|Ga0257112_10137486 | Not Available | 875 | Open in IMG/M |
| 3300028535|Ga0257111_1055454 | Not Available | 1301 | Open in IMG/M |
| 3300031757|Ga0315328_10322582 | Not Available | 901 | Open in IMG/M |
| 3300031757|Ga0315328_10705576 | Not Available | 570 | Open in IMG/M |
| 3300031773|Ga0315332_10908874 | Not Available | 528 | Open in IMG/M |
| 3300031800|Ga0310122_10225054 | Not Available | 857 | Open in IMG/M |
| 3300031800|Ga0310122_10272331 | Not Available | 755 | Open in IMG/M |
| 3300031801|Ga0310121_10600928 | Not Available | 596 | Open in IMG/M |
| 3300031802|Ga0310123_10485123 | Not Available | 781 | Open in IMG/M |
| 3300031803|Ga0310120_10638272 | Not Available | 519 | Open in IMG/M |
| 3300031804|Ga0310124_10118194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1643 | Open in IMG/M |
| 3300031886|Ga0315318_10277898 | Not Available | 960 | Open in IMG/M |
| 3300032032|Ga0315327_10863940 | Not Available | 546 | Open in IMG/M |
| 3300032278|Ga0310345_12016041 | Not Available | 561 | Open in IMG/M |
| 3300032278|Ga0310345_12453998 | Not Available | 503 | Open in IMG/M |
| 3300032360|Ga0315334_10163940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300032360|Ga0315334_10704658 | Not Available | 873 | Open in IMG/M |
| 3300032360|Ga0315334_11750986 | Not Available | 528 | Open in IMG/M |
| 3300032360|Ga0315334_11904396 | Not Available | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.71% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 10.71% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 6.25% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 5.36% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 4.46% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.68% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 2.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.89% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000152 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500m | Environmental | Open in IMG/M |
| 3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000971 | Marine microbial communities from the Deep Pacific Ocean - MP2052 | Environmental | Open in IMG/M |
| 3300001126 | Marine microbial communities from the Deep Atlantic Ocean - MP0440 | Environmental | Open in IMG/M |
| 3300001459 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - All Sites - lt1k | Environmental | Open in IMG/M |
| 3300001676 | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001678 | Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA | Environmental | Open in IMG/M |
| 3300001679 | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001680 | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001769 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Background Supr60 | Environmental | Open in IMG/M |
| 3300001783 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Vondamm Sites | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005425 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 | Environmental | Open in IMG/M |
| 3300005429 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
| 3300005953 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007770 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300020254 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555924-ERR599085) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
| 3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
| 3300020434 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555944-ERR599071) | Environmental | Open in IMG/M |
| 3300020435 | Marine microbial communities from Tara Oceans - TARA_B100000586 (ERX556070-ERR599086) | Environmental | Open in IMG/M |
| 3300020443 | Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944) | Environmental | Open in IMG/M |
| 3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025199 | Marine microbial communities from the Deep Pacific Ocean - MP1648 (SPAdes) | Environmental | Open in IMG/M |
| 3300025204 | Marine microbial communities from the Deep Atlantic Ocean - MP0203 (SPAdes) | Environmental | Open in IMG/M |
| 3300025221 | Marine microbial communities from the Deep Atlantic Ocean - MP0372 (SPAdes) | Environmental | Open in IMG/M |
| 3300025265 | Marine microbial communities from the Deep Pacific Ocean - MP2098 (SPAdes) | Environmental | Open in IMG/M |
| 3300025863 | Marine microbial communities from the Deep Pacific Ocean - MP1788 (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026207 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 (SPAdes) | Environmental | Open in IMG/M |
| 3300026208 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300027630 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPjun08P12500mDRAFT_10558561 | 3300000152 | Marine | SHFRDRTFXFCDAVEVLPSSHPQGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS* |
| LPjun09P16500mDRAFT_10062484 | 3300000179 | Marine | VYERKFCDAVEVLPSSHPQGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS* |
| LPjun09P12500mDRAFT_10069201 | 3300000222 | Marine | TFKFCDAVEVLPSSPPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS* |
| LPjun09P12500mDRAFT_10142101 | 3300000222 | Marine | AVEVLPSSHPQGMFSTPVPHFLPVELTPLGLSSTGQLRVAS* |
| JGI12060J13090_1026452 | 3300000971 | Deep Ocean | LPSSLPQGLFSTTDPCFLPGKLEPLGFSPPGQLRVAS* |
| JGI12156J13080_1025443 | 3300001126 | Deep Ocean | SSLPQGLFSTTDPCFLPGKLEPLGFSSPGQLRVAS* |
| MCRcombined_14483631 | 3300001459 | Hydrothermal Vent Plume | SHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS* |
| TuiMalila_10264512 | 3300001676 | Black Smokers Hydrothermal Plume | TFKFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGLSLPGQLRVAS* |
| Mariner_10016381 | 3300001678 | Black Smokers Hydrothermal Plume | VLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS* |
| TahiMoana_10334414 | 3300001679 | Black Smokers Hydrothermal Plume | AVEVLPSSHLRGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS* |
| KiloMoana_100328414 | 3300001680 | Black Smokers Hydrothermal Plume | AVEVLPSSLPRELFSTTAPRFLPDKLEPLGFSLSGQLRVAS* |
| KiloMoana_100594891 | 3300001680 | Black Smokers Hydrothermal Plume | AVEVLPSSHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS* |
| supr60_10110741 | 3300001769 | Hydrothermal Vent Plume | VLPSSHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS* |
| Vondamm_100371131 | 3300001783 | Hydrothermal Vent Plume | AVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS* |
| Ga0066858_101375201 | 3300005398 | Marine | AVEVLPSSLPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS* |
| Ga0066860_100691661 | 3300005399 | Marine | VCDAVEVLPSSLPQGLFSTTDPCFLPGKLEPLGFSSPGQLRVAS* |
| Ga0066860_102254901 | 3300005399 | Marine | VCDAVEVLPSSLPQGLFSTTDPCFLPGKLEPLGFSPPGQLRVAS* |
| Ga0066848_100110524 | 3300005408 | Marine | EVLPSSLPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS* |
| Ga0066859_101676282 | 3300005425 | Marine | FCDAVEVLPSSPPRELFSTTAPRFLPDKLEPLGFSLPGQLRVAS* |
| Ga0066846_100519932 | 3300005429 | Marine | FCDAVEVLPSSPPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAP* |
| Ga0066849_102579331 | 3300005430 | Marine | HFRDRTFKFCDAVEVLPSSHPQGLFSTTAPRFLPDELEPLGFSSPGQLRVAS* |
| Ga0066838_102094961 | 3300005592 | Marine | SLPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS* |
| Ga0066850_100144006 | 3300005605 | Marine | SHFRDRTFKFCDAVEVLPSSHPQGLFSTTAPRFLPDELEPLGFSSPGQLRVAS* |
| Ga0066380_102797242 | 3300005948 | Marine | FCDAVEVLPSSHPQGMFSTAVPRFLPDKLEPLGLSLPGQLRVAS* |
| Ga0066383_100171744 | 3300005953 | Marine | VLPSSLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS* |
| Ga0066383_101329172 | 3300005953 | Marine | PSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS* |
| Ga0066368_100165831 | 3300006002 | Marine | FCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS* |
| Ga0066374_100861852 | 3300006012 | Marine | RTFNFCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS* |
| Ga0066374_101229291 | 3300006012 | Marine | VEVLPSSLPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS* |
| Ga0066382_100216931 | 3300006013 | Marine | SLPRELFSTTAPRFLPDKLEPLGFSLSGQLRVAS* |
| Ga0066382_100357654 | 3300006013 | Marine | RTFKFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGLSLPGQLRVAS* |
| Ga0066375_100357264 | 3300006019 | Marine | RTFKFCDAVEVLPSSLPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS* |
| Ga0066836_109300151 | 3300006166 | Marine | YRTFKFCDAVEVLPSSQSREMFSTAVSRFLPFKLEPLGFSLNGQLRVAS* |
| Ga0068470_11532192 | 3300006308 | Marine | VLPSPQLRGMFSTAVPRFLPYKLEPLGFSLPGQLRVAS* |
| Ga0068483_15953831 | 3300006330 | Marine | PSSHLRGMFSTAVPRFLPDKLGPLGFSLSGQLRVAS* |
| Ga0068493_103424413 | 3300006341 | Marine | FNFCDAVEVLPSPPPRGLFSTTSPHFLPDKLEPLGFSLPGQLRVAS* |
| Ga0098033_11428902 | 3300006736 | Marine | PSSQPRGMFSTAVPRFLPVELKPLGLSPTGQLRVAS* |
| Ga0098055_11587761 | 3300006793 | Marine | MNKKGKGIKNQRLSSFRYLTFKFCDAVEVLPSSQSREMFSTAVSRFLPFKLEPLGQSRD* |
| Ga0066372_100680644 | 3300006902 | Marine | YRTFNFCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGFSLPGQLRVAY* |
| Ga0066372_101086322 | 3300006902 | Marine | RYRTFNFCDAVEVLPSSPPRGLFSTTSPHFLPDKLEPLSFSLPGQLRVAS* |
| Ga0066372_103072762 | 3300006902 | Marine | FKFCDAVEVLPSSPLRELFSTTAPRFLPGKLEPLGLSLPGQLRVAS* |
| Ga0066372_103610511 | 3300006902 | Marine | KTERFSHFRDRTFKFCDAVEVLPSSPLRELFSTTAPRFLPGKLEPLGLSLPGQLRVAS* |
| Ga0066372_107245832 | 3300006902 | Marine | RTFKFCDAVEVLPSSPPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS* |
| Ga0066367_10145985 | 3300007291 | Marine | CDAVEVLPSSPPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS* |
| Ga0066367_13393521 | 3300007291 | Marine | PSSHPQGMFSTAVPRFLPDKLEPLGLFLPGQLRVAS* |
| Ga0105015_11461231 | 3300007770 | Marine | HFRVRTLKVCDAVEVLPSSLPQGLFSTTAPRFLPFRLEPLGFSLNGQLRVAS* |
| Ga0117902_14793651 | 3300009104 | Marine | FCDAVEVLPSSPPRELFSTTAPRFLPCKLEPFGLSLPGQLRVAP* |
| Ga0114993_105634311 | 3300009409 | Marine | ELLSSPPRELFSSTYSHFLPVKLEPLGFSLTGQLRVAS* |
| Ga0114932_103763852 | 3300009481 | Deep Subsurface | DAVEVLPSSLSQEMFSTAFSHFLPFKLEPLGFSLNGQLRVAS* |
| Ga0115011_119377081 | 3300009593 | Marine | VALKKTERFSHFRDRTFKFCDAVEVLPSSHPQGLFSTTAPHFLPDELEPLGFSSPGQLRVAS |
| Ga0133547_114268841 | 3300010883 | Marine | GVVFKNQRFSHFRDRTFNFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGFSLPGQLRVAP* |
| Ga0211669_10386782 | 3300020254 | Marine | LQVIKNQRFSHFRDRTFNFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGFSLPGQLRVAS |
| Ga0211680_101098121 | 3300020389 | Marine | DAVEVLPSSLPQGLFSTTNPCFLPGKLEPLGFSSPGQLRVAS |
| Ga0211553_100927691 | 3300020415 | Marine | SSFRYRTFNFCDAVEVLPSSPPRGLFSTTSPHFLPDKLEPLGFSLPGQLRVAS |
| Ga0211512_104007262 | 3300020419 | Marine | TFKFCDAVEVLPSSLSQEMFSTAVSCFLPFKLEPLGFSLNGQLRVAS |
| Ga0211549_100096471 | 3300020425 | Marine | PSSPPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0211549_100965861 | 3300020425 | Marine | YRTFNFCDAVEVLPSSLPQGLFSTTSPHFLPDKLEPFGFSLPGQLRVAS |
| Ga0211549_101908201 | 3300020425 | Marine | AVEVLPSSPPRELFSTTAPRFLPYKLEPFGFSLSGQLRVAS |
| Ga0211549_102629071 | 3300020425 | Marine | PSSQLRGMFSTAVPRFLPGKLGPLGLSLPGQLRVAS |
| Ga0211536_101919462 | 3300020426 | Marine | TFKFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGFSLPGQLRVAS |
| Ga0211670_103491141 | 3300020434 | Marine | VLPSSPPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0211639_102191211 | 3300020435 | Marine | VYERKFCDAVEVLPSSHPQGMFSTAVPHFLPDKLEPLGFSLPGQLR |
| Ga0211544_100224661 | 3300020443 | Marine | VLPSSLPRKLFSTTAPRFLPYKLEPFGLSLSGQLRVAS |
| Ga0211578_100212474 | 3300020444 | Marine | CDAVEVLPSSPPRELFSTTAPRFLPDKLEPLGFSLPGQLRVAS |
| Ga0211578_100514683 | 3300020444 | Marine | CDAVEVLPSSPPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS |
| Ga0211697_100288894 | 3300020458 | Marine | PSSLPRELFSTTAPRFLPGKLEPLGLSLSGQLRVAS |
| Ga0211714_106009641 | 3300020466 | Marine | TFKFCDAVEVLPSSPPQEMFSTAVSRFLPFKLEPLGFSLNGQLRVAS |
| Ga0211579_100645391 | 3300020472 | Marine | VEVLPSSLSQEMFSTAFSHFLPLKLEPLGFSLNGQLRVAS |
| Ga0211579_101921401 | 3300020472 | Marine | IKNQRFSRFPYRTFKFCDAVEVLPSPLPQEMFSTAVSRFLPFKIEPLGFSLNGQLRVAS |
| Ga0206679_100272351 | 3300021089 | Seawater | VEVLPSSQSREMFSTAVSRFLPFKLEPLGFSLNGQLRVAS |
| Ga0206688_106756981 | 3300021345 | Seawater | AVEVLPSSQPRGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS |
| Ga0206680_103843911 | 3300021352 | Seawater | VEVLPSSHPQGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS |
| Ga0206681_104319301 | 3300021443 | Seawater | SSLPQELFSTTAPCFLPGKLEPLGFSLPGQLRVAS |
| Ga0226832_102374981 | 3300021791 | Hydrothermal Vent Fluids | SPLPRELFSTTAPRFLPDNLEPLGLFLPGQLRVAS |
| Ga0187833_100271017 | 3300022225 | Seawater | CDAVEVLPSSLPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS |
| Ga0208331_1225711 | 3300025199 | Deep Ocean | EVLPSSHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0208063_10157351 | 3300025204 | Deep Ocean | DAVEVLPSSLPQGLFSTTDPCFLPGKLEPLGFSPPGQLRVAS |
| Ga0208336_10005571 | 3300025221 | Deep Ocean | DRTFKFCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0208467_10495021 | 3300025265 | Deep Ocean | SSLPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS |
| Ga0208833_10634811 | 3300025863 | Deep Ocean | FCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0208113_10333601 | 3300026087 | Marine | VLPSSLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS |
| Ga0207966_10172814 | 3300026119 | Marine | AVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS |
| Ga0207966_10292683 | 3300026119 | Marine | AVEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0208895_11216702 | 3300026207 | Marine | TFNFCDAVEVLPSPLPRELFSTTAPRFLPGKLEPLGFSLPGQLRVAP |
| Ga0208895_11249641 | 3300026207 | Marine | EVLPSSRPQGMFSTAVPRFLPDKLEPLGFSLPGQLRVAS |
| Ga0208640_10270031 | 3300026208 | Marine | VEVLPSSPPRELFSTTAPRFLPDKLGPLGFSLPGQLRVAS |
| Ga0208641_10673782 | 3300026268 | Marine | CDAVEVLPSSHPQGLFSTTAPRFLPDELEPLGFSSPGQLRVAS |
| Ga0208766_10100341 | 3300026269 | Marine | TFKFCDAVEVLPSSQSREMFSTAVSRFLPFKLEPLGFSLNGQLRVAS |
| Ga0209432_11257802 | 3300027630 | Marine | EVLPSSLPRELFSTTAPRFLPDKLEPLGFSLSGQLRVAS |
| Ga0257108_10373061 | 3300028190 | Marine | FCDAVEVLPSPLPRELFSTTAPRFLPDKLEPLGLSLPGQLRVAS |
| Ga0257113_11596481 | 3300028488 | Marine | EVLPSSPPRELFSTTAPRFLPDKLKPLGLSLPGQLRVAS |
| Ga0257112_100463791 | 3300028489 | Marine | SHFRDRTFNFCDAVEVLPSSLPRELFSTTAPRFLPDKLEPLGFSLSGQLRVAS |
| Ga0257112_101135781 | 3300028489 | Marine | EVLPSSPPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS |
| Ga0257112_101374861 | 3300028489 | Marine | NQRFSHFRDRTFNFCDAVEVLPSSPPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0257111_10554541 | 3300028535 | Marine | NKPKFTHPKVYEQKFCDAVEVLPSSPLRELFSTTAPRFLPGKLEPLGLSLSGQLRVAS |
| Ga0315328_103225821 | 3300031757 | Seawater | VLPSSHPQGLFSTTAPRFLPDELEPLGFSSPGQLRVAS |
| Ga0315328_107055761 | 3300031757 | Seawater | SSLPQELFSTTAPCFLPGKLEPLGFSLSGQLRVAS |
| Ga0315332_109088741 | 3300031773 | Seawater | FNFCDAVEVLPSSPPRGLFSTTSPHFLPDKLEPLGFSLPGQLRVAS |
| Ga0310122_102250541 | 3300031800 | Marine | MGSFKKTERFSHFRDRTFKFCDAVEVLPSSLPQGMFSTAVPCFLPDELEPLGFSSSGQLRVAS |
| Ga0310122_102723311 | 3300031800 | Marine | VEVLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0310121_106009281 | 3300031801 | Marine | EVLPSPLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0310123_104851232 | 3300031802 | Marine | AVEVLPSSLPQELFSTTAPCFLPGKLEPLGFSLPGQLRVAS |
| Ga0310120_106382721 | 3300031803 | Marine | RTFKFCDAVEVLPSSHPQGMFSTAVPRFLPDKLEPLGLSLPGQLRVAS |
| Ga0310124_101181943 | 3300031804 | Marine | QRFSHFRDRTFNFCDAVEVLPSSLPRELFSTTAPRFLPGKLEPLGFSLPGQLRVAP |
| Ga0315318_102778981 | 3300031886 | Seawater | EVLPSSHPQGMFSTAVPHFLPDKLEPLGLSLPGQLRVAS |
| Ga0315327_108639401 | 3300032032 | Seawater | DRTFKFCDAVEVLPSSHPQGMFSTAIPHFLPDKLEPLGLSLPGQLRVAS |
| Ga0310345_120160411 | 3300032278 | Seawater | VEVLPSSRPQGMFSTPVPHFLPVELIPLGLSSTGQLRVAS |
| Ga0310345_124539981 | 3300032278 | Seawater | SSHPRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS |
| Ga0315334_101639401 | 3300032360 | Seawater | VEVLPSSPPRKLFSTTAPRFLPYKLEPLGFSSSGQLRVAS |
| Ga0315334_107046581 | 3300032360 | Seawater | DEVLPSSLPQGLFSTTDPCFLPGKLEPLGFFPPGQLRVAS |
| Ga0315334_117509861 | 3300032360 | Seawater | VEVLPSSPPRELFSTTAPRFLPYKLEPLGFSLPGQLRVAS |
| Ga0315334_119043961 | 3300032360 | Seawater | CDAVEVLPSSLPRELFSTTAPRFLPYKLEPLGFSLSGQLRVAS |
| ⦗Top⦘ |