


| Basic Information | |
|---|---|
| Family ID | F081732 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GEKITTGGLEENKLKKLKGLRFTLPALSIVEAKQMGLGATTCCR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.00 % |
| % of genes near scaffold ends (potentially truncated) | 83.33 % |
| % of genes from short scaffolds (< 2000 bps) | 81.58 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.772 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.735 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.965 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.228 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 31.58 |
| PF10988 | DUF2807 | 14.04 |
| PF13366 | PDDEXK_3 | 8.77 |
| PF05635 | 23S_rRNA_IVP | 5.26 |
| PF01613 | Flavin_Reduct | 3.51 |
| PF04209 | HgmA_C | 2.63 |
| PF02927 | CelD_N | 1.75 |
| PF12840 | HTH_20 | 1.75 |
| PF00425 | Chorismate_bind | 0.88 |
| PF04116 | FA_hydroxylase | 0.88 |
| PF01479 | S4 | 0.88 |
| PF01180 | DHO_dh | 0.88 |
| PF09674 | DUF2400 | 0.88 |
| PF02800 | Gp_dh_C | 0.88 |
| PF13419 | HAD_2 | 0.88 |
| PF17189 | Glyco_hydro_30C | 0.88 |
| PF12784 | PDDEXK_2 | 0.88 |
| PF02469 | Fasciclin | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.51 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.63 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.88 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.88 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.88 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.88 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.88 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.77 % |
| Unclassified | root | N/A | 41.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig57682 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 680 | Open in IMG/M |
| 3300000136|KGI_S1_ANT02_95mDRAFT_c10178379 | Not Available | 512 | Open in IMG/M |
| 3300002077|JGI24744J21845_10098556 | Not Available | 539 | Open in IMG/M |
| 3300002128|JGI24036J26619_10036245 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 945 | Open in IMG/M |
| 3300004054|Ga0063232_10045507 | Not Available | 1141 | Open in IMG/M |
| 3300004779|Ga0062380_10000992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5788 | Open in IMG/M |
| 3300005260|Ga0074072_1155430 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 533 | Open in IMG/M |
| 3300005293|Ga0065715_10168642 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1565 | Open in IMG/M |
| 3300005335|Ga0070666_10447653 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 932 | Open in IMG/M |
| 3300005338|Ga0068868_102156176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 530 | Open in IMG/M |
| 3300005441|Ga0070700_101236392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 625 | Open in IMG/M |
| 3300005526|Ga0073909_10463634 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 607 | Open in IMG/M |
| 3300005543|Ga0070672_100715413 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 877 | Open in IMG/M |
| 3300005543|Ga0070672_101348838 | Not Available | 637 | Open in IMG/M |
| 3300005563|Ga0068855_100116387 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3064 | Open in IMG/M |
| 3300005840|Ga0068870_10391622 | Not Available | 902 | Open in IMG/M |
| 3300006169|Ga0082029_1604824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 520 | Open in IMG/M |
| 3300006358|Ga0068871_100780645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 880 | Open in IMG/M |
| 3300006791|Ga0066653_10065610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1556 | Open in IMG/M |
| 3300006844|Ga0075428_102283811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 557 | Open in IMG/M |
| 3300006894|Ga0079215_10319955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 869 | Open in IMG/M |
| 3300006918|Ga0079216_11046064 | Not Available | 636 | Open in IMG/M |
| 3300007004|Ga0079218_10728278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 937 | Open in IMG/M |
| 3300007004|Ga0079218_12963686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 571 | Open in IMG/M |
| 3300007248|Ga0075168_1007086 | Not Available | 645 | Open in IMG/M |
| 3300007651|Ga0102900_1148955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium | 516 | Open in IMG/M |
| 3300009093|Ga0105240_11447469 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 721 | Open in IMG/M |
| 3300009093|Ga0105240_11796966 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 639 | Open in IMG/M |
| 3300009094|Ga0111539_11973457 | Not Available | 677 | Open in IMG/M |
| 3300009095|Ga0079224_100654275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1507 | Open in IMG/M |
| 3300009164|Ga0114975_10373191 | Not Available | 781 | Open in IMG/M |
| 3300009184|Ga0114976_10650944 | Not Available | 531 | Open in IMG/M |
| 3300010160|Ga0114967_10129613 | Not Available | 1425 | Open in IMG/M |
| 3300010352|Ga0116247_11257252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 529 | Open in IMG/M |
| 3300010357|Ga0116249_11507981 | Not Available | 597 | Open in IMG/M |
| 3300010371|Ga0134125_10207023 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300010403|Ga0134123_13649156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 500 | Open in IMG/M |
| 3300011119|Ga0105246_11626424 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 611 | Open in IMG/M |
| 3300011264|Ga0151623_1003712 | Not Available | 1347 | Open in IMG/M |
| 3300011437|Ga0137429_1118763 | All Organisms → cellular organisms → Bacteria → FCB group | 811 | Open in IMG/M |
| 3300011440|Ga0137433_1237661 | All Organisms → cellular organisms → Bacteria → FCB group | 595 | Open in IMG/M |
| 3300011442|Ga0137437_1203169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 688 | Open in IMG/M |
| 3300012018|Ga0119867_1189467 | Not Available | 545 | Open in IMG/M |
| 3300012094|Ga0136638_10180495 | Not Available | 957 | Open in IMG/M |
| 3300012361|Ga0137360_11348883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 615 | Open in IMG/M |
| 3300012533|Ga0138256_10120212 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 2467 | Open in IMG/M |
| 3300012796|Ga0160498_102473 | Not Available | 1604 | Open in IMG/M |
| 3300012892|Ga0157294_10013984 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1459 | Open in IMG/M |
| 3300012903|Ga0157289_10432978 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012907|Ga0157283_10324421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 544 | Open in IMG/M |
| 3300012956|Ga0154020_10904416 | All Organisms → cellular organisms → Bacteria → FCB group | 688 | Open in IMG/M |
| 3300013097|Ga0136639_10321549 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300013105|Ga0157369_11654400 | Not Available | 651 | Open in IMG/M |
| 3300013296|Ga0157374_10873979 | Not Available | 916 | Open in IMG/M |
| 3300013297|Ga0157378_12710759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 548 | Open in IMG/M |
| 3300013307|Ga0157372_10184004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2419 | Open in IMG/M |
| 3300013307|Ga0157372_11071949 | Not Available | 932 | Open in IMG/M |
| 3300013307|Ga0157372_12117960 | Not Available | 646 | Open in IMG/M |
| 3300013308|Ga0157375_13548499 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 519 | Open in IMG/M |
| 3300014326|Ga0157380_12917364 | Not Available | 544 | Open in IMG/M |
| 3300015189|Ga0167667_1048614 | Not Available | 1014 | Open in IMG/M |
| 3300015371|Ga0132258_11764902 | Not Available | 1560 | Open in IMG/M |
| 3300015373|Ga0132257_100689610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1268 | Open in IMG/M |
| 3300015373|Ga0132257_100903861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1107 | Open in IMG/M |
| 3300015373|Ga0132257_102296075 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300015374|Ga0132255_103037265 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 716 | Open in IMG/M |
| 3300017440|Ga0182214_1083302 | Not Available | 669 | Open in IMG/M |
| 3300017695|Ga0180121_10260182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 653 | Open in IMG/M |
| 3300017789|Ga0136617_10641439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 829 | Open in IMG/M |
| 3300017824|Ga0181552_10302446 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300018063|Ga0184637_10520338 | All Organisms → cellular organisms → Bacteria → FCB group | 688 | Open in IMG/M |
| 3300018476|Ga0190274_10548446 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1169 | Open in IMG/M |
| 3300018476|Ga0190274_13609628 | Not Available | 523 | Open in IMG/M |
| 3300018476|Ga0190274_13792187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 511 | Open in IMG/M |
| 3300018920|Ga0190273_11520120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 593 | Open in IMG/M |
| 3300019361|Ga0173482_10370110 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 656 | Open in IMG/M |
| 3300019362|Ga0173479_10162842 | Not Available | 904 | Open in IMG/M |
| 3300025847|Ga0209607_1110013 | Not Available | 1169 | Open in IMG/M |
| 3300025903|Ga0207680_10429970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 936 | Open in IMG/M |
| 3300025908|Ga0207643_10411676 | Not Available | 856 | Open in IMG/M |
| 3300025961|Ga0207712_10152099 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1789 | Open in IMG/M |
| 3300025972|Ga0207668_10834771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 817 | Open in IMG/M |
| 3300026041|Ga0207639_10999839 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Panacibacter → Panacibacter ginsenosidivorans | 783 | Open in IMG/M |
| 3300026088|Ga0207641_11694841 | Not Available | 634 | Open in IMG/M |
| 3300026089|Ga0207648_10000820 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 35151 | Open in IMG/M |
| 3300026089|Ga0207648_10948978 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300026095|Ga0207676_11677682 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 634 | Open in IMG/M |
| 3300026142|Ga0207698_11834650 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026306|Ga0209468_1056775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1321 | Open in IMG/M |
| 3300027831|Ga0209797_10009811 | All Organisms → cellular organisms → Bacteria → FCB group | 4487 | Open in IMG/M |
| 3300027993|Ga0247749_1041836 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 545 | Open in IMG/M |
| 3300029951|Ga0311371_11479569 | Not Available | 758 | Open in IMG/M |
| 3300030606|Ga0299906_10731527 | All Organisms → cellular organisms → Bacteria → FCB group | 740 | Open in IMG/M |
| 3300031086|Ga0074002_10029700 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031852|Ga0307410_11953320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 523 | Open in IMG/M |
| 3300031995|Ga0307409_101550274 | Not Available | 690 | Open in IMG/M |
| 3300034009|Ga0334944_058991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 729 | Open in IMG/M |
| 3300034019|Ga0334998_0294598 | Not Available | 966 | Open in IMG/M |
| 3300034160|Ga0370510_0139737 | Not Available | 742 | Open in IMG/M |
| 3300034175|Ga0334939_0111789 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 868 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.31% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.54% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.54% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.77% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.89% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.89% |
| Leaf Surface | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Leaf Surface | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.89% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.89% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000136 | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5m | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007248 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 D RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011264 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012796 | Enriched soil microbial communities from UW Madison campus, WI, USA - DID2878_E24_Xylan MG | Environmental | Open in IMG/M |
| 3300012844 | Enriched soil microbial communities from UW Madison campus, WI, USA - HID1975M_E11 MG | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015024 | Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite) | Environmental | Open in IMG/M |
| 3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031086 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031372 | Leaf surface microbial communities from wheat plants in UC Gill Tract Community Farm, Albany, California, United States - DLSL W.R1 (v2) | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
| 3300034175 | Biocrust microbial communities from Mojave Desert, California, United States - 35SMC | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_11001210 | 2124908045 | Soil | LTLLEGEKITIGGFDENKLKKLKGLRFTFPSLSIVEAKQTGLGATTCCR |
| KGI_S1_ANT02_95mDRAFT_101783791 | 3300000136 | Marine | FVVLFKPLRDGENINVGGFEPKILKKLKGLRFTWPSLSIVLAKAMGLGPIAESKSL* |
| NpDRAFT_102352141 | 3300000929 | Freshwater And Marine | HIGGFELNKLKKLNGLKFTFPALSMVEAKQMGLGAMAYCK* |
| JGI24744J21845_100985562 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | REGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR* |
| JGI24036J26619_100362451 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | TLREGENIRIGGLVENKLKKLNGLRLILPALSMVEAKQTGLGATTCCR* |
| Ga0063232_100455072 | 3300004054 | Freshwater Lake | THIGGLELNKLKKLNGLKFTFPALSTVEAKQMGLGAMAYCK* |
| Ga0062380_100009921 | 3300004779 | Wetland Sediment | EGENITMGGLVENKLKKLKGLRFTLPALSMVDAKQIGLGAITCCR* |
| Ga0074072_11554302 | 3300005260 | Soil | LTRRDGEKMTIGGFDENILKKLKGLRFTFPSLSMVDAKQMGLGPITCCK* |
| Ga0065715_101686421 | 3300005293 | Miscanthus Rhizosphere | LEGEKMTIGGCIENKLKKLKGLRFTPPSLFIVEAKQIGLGPMICCK* |
| Ga0070666_104476532 | 3300005335 | Switchgrass Rhizosphere | SRTLREGEKMIMGGWDEKRLKKLKGLRFTCPFLSTVLARQIGRGAIACCSQF* |
| Ga0068868_1021561762 | 3300005338 | Miscanthus Rhizosphere | LVVLFLTLLDGEKTTIGGLVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR* |
| Ga0070700_1012363921 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVLFLTLLDGEKTTIGGWVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR* |
| Ga0073909_104636341 | 3300005526 | Surface Soil | GLIEKRLKKLNGLRLMFPSLSIVLAKQTGRGAMAC* |
| Ga0070672_1007154132 | 3300005543 | Miscanthus Rhizosphere | LVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR* |
| Ga0070672_1013488382 | 3300005543 | Miscanthus Rhizosphere | LSLILLEGAKITMGGLDEKRLKKLKGLRFTFPAASIVLAKQIGLGAMAC* |
| Ga0068855_1001163871 | 3300005563 | Corn Rhizosphere | RDGEKTHIGGLVLTILKKLNGLRFTLPCLSTVEAKQMGRGAMAYCK* |
| Ga0068870_103916221 | 3300005840 | Miscanthus Rhizosphere | EGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR* |
| Ga0082029_16048241 | 3300006169 | Termite Nest | EGENTTMGGLVEKRLKKLKGLRFTFPSLSIVEAKQMGRGATRCCR* |
| Ga0068871_1007806452 | 3300006358 | Miscanthus Rhizosphere | LSLTLRDGEKITIGGLEENKLKKLNGLRFMLPVLSIVEAKQTGLGATICCR* |
| Ga0066653_100656103 | 3300006791 | Soil | TFSNVCLVVLSLILLAGEKMTIGGLDENKLKKLKGVRFTFPSLSIVDAKQIGRGAITCWR |
| Ga0075428_1022838112 | 3300006844 | Populus Rhizosphere | LTGEKITIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR* |
| Ga0079215_103199551 | 3300006894 | Agricultural Soil | RDGEKITIGGLEENKLKKLKGLRFILPALSIVEAKQTGLGATTCCR* |
| Ga0079216_110460642 | 3300006918 | Agricultural Soil | GLVEKRLKKLKGLRFTFPSLSMVLAKHIGLGAIACCR* |
| Ga0079218_107282782 | 3300007004 | Agricultural Soil | LLEGEKITIGGLEENKLKKLNGLRFTFPALSMVEAKQTGRGATTCCR* |
| Ga0079218_129636861 | 3300007004 | Agricultural Soil | TLLAGEKITTGGFEENMLKKLKGLRLTLPFLSMVLAKQTGLGAMTCWR* |
| Ga0075168_10070862 | 3300007248 | Wastewater Effluent | VVLSLTLLAGENITTGGLEENRLKKLKGLRFTFPALSMVEAKQMGLGAIACCR |
| Ga0102915_11288151 | 3300007562 | Estuarine | MLNKLKKLNGLKLIFPSASIVEAKHIGLGAIACCK* |
| Ga0102878_10260911 | 3300007624 | Estuarine | IGGFELNKLKKLNGLKFTFPALSIVEAKQMGLGAIAYCK* |
| Ga0102876_11811201 | 3300007642 | Estuarine | MLNKLKKLKGLRFTWPFKSIVEAKQIGLGAIAYCKYC |
| Ga0102900_11489552 | 3300007651 | Estuarine | VVLSLTLQDGEKIQIGGFMLNKLKKLKGLKFTFPSKSIVDAKQIGL |
| Ga0102899_10192391 | 3300007706 | Estuarine | QIGGFELNKLKKLNGLKFTFPALSMVEAKQMGLGAMAYCK* |
| Ga0105240_114474691 | 3300009093 | Corn Rhizosphere | TLRDGEKITIGGLVENKLKKLNGLRFMFPALSIVDAKQTGLGATTCWR* |
| Ga0105240_117969661 | 3300009093 | Corn Rhizosphere | DGEKTQTGGLVPNKLKKLNGLRFILPALSTVEAKQMGRGAMAYCR* |
| Ga0111539_119734571 | 3300009094 | Populus Rhizosphere | MGGLDENKLKKLKGLRFTLPALSMVEAKQIGLGAITCCR* |
| Ga0079224_1006542751 | 3300009095 | Agricultural Soil | DGENMTMGGLVEKRLKKLKGLRLTFPARSIVDAKHIGRGAITCCR* |
| Ga0114968_100025021 | 3300009155 | Freshwater Lake | KKLKGLKFTFPSKSIVDAKQIGLGAIAYCKYCCIS* |
| Ga0114975_103731911 | 3300009164 | Freshwater Lake | TSVTFCSVCLMKLSLTLCAGEKTTIGGLAENKLKKLYGLKFMLPSKSIVDAKQMGRGAMACCK* |
| Ga0114976_106509441 | 3300009184 | Freshwater Lake | TLLAGEKMKVTGFEPKMLKKLKGERFTSPLLSMVLAKQIGLGATEVSKAL* |
| Ga0105249_127078422 | 3300009553 | Switchgrass Rhizosphere | EKRLKKLKGLRFTFPFLSIVEAKQTGLGATTCCK* |
| Ga0114967_101296132 | 3300010160 | Freshwater Lake | VVLFLNLLDGEKITIGGCIEKILKKLKGLRLTSPEASIVLAKAMGLGAMACCR* |
| Ga0116247_112572521 | 3300010352 | Anaerobic Digestor Sludge | MTMGGWEENILKKLNGLRFTLPALSIVEAKQMGLGAITCWR* |
| Ga0116249_115079811 | 3300010357 | Anaerobic Digestor Sludge | CLMVLSLTLLEAEKINIGGLAEKRLKKLKGLKFPCPSLSMVLAKQIGLGAIECWR* |
| Ga0134125_102070234 | 3300010371 | Terrestrial Soil | SLTLREGEKTQTAGLVLNKLKKLNGLRFMLPPLSMVDAKQTGRGAMAYWR* |
| Ga0134123_136491562 | 3300010403 | Terrestrial Soil | LSLTLRDGEKITIGGLEENKLKKLKGLRFMFPALSIVDAKQTGLGATTCCR* |
| Ga0105246_116264242 | 3300011119 | Miscanthus Rhizosphere | MGGLEENKLKKLKGLRLTFPALSIVDAKQTGRGATTCCR* |
| Ga0151623_10037122 | 3300011264 | Sediment | LSLTLLDGEKMTMGGLDENKLKKLKGLRFTFPSLSIVEAKQTGRGATICCR* |
| Ga0137429_11187632 | 3300011437 | Soil | LLAGEKITTGGWEENKLKKLNGLRFTFPTLSIVEAKQIGRGAMICCR* |
| Ga0137433_12376612 | 3300011440 | Soil | GGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR* |
| Ga0137437_12031691 | 3300011442 | Soil | CLVVLSLILLEGEKIAIGGLEENKLKKLKGLRLTLPALSIVDAKHTGLGATTCKR* |
| Ga0119867_11894671 | 3300012018 | Activated Sludge | LLAGENIAIGGLLPKILKKLKGDKLGFPSASMVDAKHIGRGAIAPNK* |
| Ga0136638_101804951 | 3300012094 | Polar Desert Sand | LVVLSLTLLEGEKIAIGGLILNKLKKLKGLKLTLPFKSIVLAKHTGLGAIACCK* |
| Ga0137360_113488831 | 3300012361 | Vadose Zone Soil | TFCNVCLVVLFLILLADEKITTGGLEENKLKKLKGLRFTLPALSTVDAKQMGLGATRCCR |
| Ga0138256_101202123 | 3300012533 | Active Sludge | EKTTIGGLDENRLKKLNGLKLILPASSMVLAKQIGLGAIAC* |
| Ga0160498_1024733 | 3300012796 | Soil | LSLTLRAGEKIHIGGLVLNILKKLKGLRLMCPSVSMVEAKQMGLGAMAYCR* |
| Ga0160475_1194332 | 3300012844 | LLVTEKTHIGGFILTTLKKLNGLKLILPYLSIVDAKHIGRGAMAACK* | |
| Ga0157294_100139843 | 3300012892 | Soil | NLLEGEKITIGGCIENKLKKLKGLRFTPPSLFIVEAKQIGLGPMICCK* |
| Ga0157289_104329782 | 3300012903 | Soil | VVLSLTLRAGEKITIGGLEENKLKKLKGLKFTFPALSTVEAKHMGRGPM |
| Ga0157283_103244212 | 3300012907 | Soil | EKITIGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR* |
| Ga0154020_109044161 | 3300012956 | Active Sludge | LLAGENITTGGLEENRLKKLKGLRFTFPALSMVAAKQIGLGAIACCR* |
| Ga0136639_103215491 | 3300013097 | Polar Desert Sand | TIGGFDENKLKKLKGLRFSNPSLSIVEAKQTGRGAMACCR* |
| Ga0157369_116544002 | 3300013105 | Corn Rhizosphere | SSVCLVVLSLTLREGEKISTGGVEENILKKLKGLRFIRPFLSMVLAKHTGRGATAYCR* |
| Ga0157374_108739792 | 3300013296 | Miscanthus Rhizosphere | EGEKITMGGLEENKLKKLKGLKLIFPSLSMVEAKHIGLGAIACCRKFCTSVI* |
| Ga0157378_127107591 | 3300013297 | Miscanthus Rhizosphere | SLNLRDGEKITIGGWVENKLKKLKGLRFTCPFLSMVEAKQTGLGAITCCR* |
| Ga0157372_101840044 | 3300013307 | Corn Rhizosphere | GEKIAIGGLLVKKLKKLKGLRFTFPFKSIVDAKQMGRGAIA* |
| Ga0157372_110719492 | 3300013307 | Corn Rhizosphere | MVVLFLTLLDGEKIAIGGLLVKKLKKLKGLRFTFPFKSIVDAKQMGRGAIA |
| Ga0157372_121179601 | 3300013307 | Corn Rhizosphere | LVVLFLTLRDGEKITIGGLVENKLKKLNGLRFTFPAASIVEAKHMGRG |
| Ga0157375_135484991 | 3300013308 | Miscanthus Rhizosphere | RLDGENIQIGGFVLNILKKLKGLKLIFPSKSIVDAKQIGRGAIAYCK* |
| Ga0157380_129173641 | 3300014326 | Switchgrass Rhizosphere | GEKITMGGLIENKLKKLKGDRFMFPTLSIVDAKHMGRGAMACCRKF* |
| Ga0167669_10916813 | 3300015024 | Glacier Forefield Soil | TTIGGLDEKRLKKLNGDKFTFPSLSIVDAKQIGRGAIAC* |
| Ga0167667_10486141 | 3300015189 | Glacier Forefield Soil | LTLLAGENITTGGLLEKRLKKLKGDRFTFPALSIVDAKHIGRGATAC* |
| Ga0132258_117649023 | 3300015371 | Arabidopsis Rhizosphere | RRTGENITIGGVVENKLKKLKGLKLTCPILSTVDAKHIGLGAMAC* |
| Ga0132257_1006896101 | 3300015373 | Arabidopsis Rhizosphere | TRLAGEKTTTGGRVENRLKKLNGLRFTFPSRSIVEAKQMGRGATTC* |
| Ga0132257_1009038611 | 3300015373 | Arabidopsis Rhizosphere | LSLNLLEGEKTTIGGWVENKLKKLKGLRFTWPFLSIVEAKQTGLGAIICCR* |
| Ga0132257_1022960752 | 3300015373 | Arabidopsis Rhizosphere | VELSLTLLDGEKITIGGLDENILKKLKGLRLTFPALSMVEAKQIGLGATMC* |
| Ga0132255_1008109521 | 3300015374 | Arabidopsis Rhizosphere | EKRLKKLNGLRFTFPLLSIVEAKQIGLGAIACCK* |
| Ga0132255_1030372652 | 3300015374 | Arabidopsis Rhizosphere | LLTGEKTTIGGLEENMLKKLNGLRLTLPSLSIVDAKQIGRGAITCCR* |
| Ga0182214_10833021 | 3300017440 | Switchgrass Phyllosphere | LSLTRLDGEKTHIGGLVLNILKKLKGLKFTLPDLSIVEAKQIGRGAIAYCK |
| Ga0180121_102601821 | 3300017695 | Polar Desert Sand | CLVVLSLILLEGEKITTGGFEENKLKKLKGLRFTLPALSIVDAKQIGLGAIACWR |
| Ga0136617_106414392 | 3300017789 | Polar Desert Sand | LAGEKITIGGTEENILKKLKGLRFTCPFLSIVEAKQMGLGATTCCR |
| Ga0181552_103024462 | 3300017824 | Salt Marsh | LLREGEKIKIGGLKLKILKKLNGLRFTFPWALIDVTKAIGRGATEEINS |
| Ga0184637_105203381 | 3300018063 | Groundwater Sediment | GEKITTGGLEENKLKKLKGLRFTLPALSIVEAKQMGLGATTCCR |
| Ga0190274_105484463 | 3300018476 | Soil | EKITTGGLEENMLKKLNGLRFTFPSLSIVEAKHIGLGAITCCR |
| Ga0190274_136096281 | 3300018476 | Soil | CLVVLSRNRRTGENITIGGVVENKLKKLKGLKLTSPFLSIVEAKHIGLGAMAC |
| Ga0190274_137921871 | 3300018476 | Soil | LFRTLLAGEKITIGGLEENILKKLKGLRFTLPAASMVEAKQTGRGPITCCR |
| Ga0190273_115201201 | 3300018920 | Soil | SLTLLAGEKMHSGGLVLNMLKKLNGLRLILPALSIVVAKQIGRGAMAY |
| Ga0173482_103701101 | 3300019361 | Soil | GGLEENKLKKLNGLRFILPALSMVEAKQTGLGATTCCR |
| Ga0173479_101628422 | 3300019362 | Soil | LTLLAGEKITIGGFDENKLKKLKGLRFTLPALSIVDAKQIGLGAITCCR |
| Ga0222622_102977311 | 3300022756 | Groundwater Sediment | GGFVENKLKKLNGLRFTSPFLLIVDAKQIGRGAITC |
| Ga0207656_106675891 | 3300025321 | Corn Rhizosphere | GLDENMLKKLKGLKFTFPSLSIVDAKQIGRGAITCCK |
| Ga0209607_11100132 | 3300025847 | Anaerobic Digestor Sludge | LVVLSLTLREGEKITTGGFDENRLKKLKGLRFTCPSLSIVDAKHIGLGAMICWR |
| Ga0207680_104299702 | 3300025903 | Switchgrass Rhizosphere | FIELSRTLREGEKMIMGGWDEKRLKKLKGLRFTCPFLSTVLARQIGRGAIACCSQF |
| Ga0207643_104116762 | 3300025908 | Miscanthus Rhizosphere | PLREGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR |
| Ga0207712_101520991 | 3300025961 | Switchgrass Rhizosphere | LILLTGEKITIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR |
| Ga0207668_108347711 | 3300025972 | Switchgrass Rhizosphere | TIGGLVEKRLKKLKGLRFTLPALSIVLAKQTGLGATTCCR |
| Ga0207639_109998391 | 3300026041 | Corn Rhizosphere | LSLTLRDGEKITTGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR |
| Ga0207641_116948412 | 3300026088 | Switchgrass Rhizosphere | TRLDGEKIITGGFTENKLKKLKGLRLTFPSLSTVLARQMGRGAIACCK |
| Ga0207648_100008201 | 3300026089 | Miscanthus Rhizosphere | SLRDGEKITIGGWVENKLKKLKGLRFTCPFLSMVEAKQTGLGAITCCR |
| Ga0207648_109489781 | 3300026089 | Miscanthus Rhizosphere | LREGEKTTIGGWVENKLKKLKGLRFTWPFLSIVEAKQIGLGAITCCR |
| Ga0207676_116776822 | 3300026095 | Switchgrass Rhizosphere | EKITMGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR |
| Ga0207698_118346501 | 3300026142 | Corn Rhizosphere | EGEKTTIGGRVEKRLKKLKGLRFTFPSLSIVLAKQIGRGAMACCSQCWVSCTDI |
| Ga0209468_10567752 | 3300026306 | Soil | SNVCLVVLSLILLAGEKMTIGGLDENKLKKLKGVRFTFPSLSIVDAKQIGRGAITCWR |
| Ga0209797_100098111 | 3300027831 | Wetland Sediment | ENITMGGLVENKLKKLKGLRFTLPALSMVDAKQIGLGAITCCR |
| Ga0247749_10418362 | 3300027993 | Soil | TIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR |
| Ga0311371_114795691 | 3300029951 | Palsa | DGEKTQVGGLEPNKLKKLKGLRFTLPFLSTVEAKHIGRGAMAYCR |
| Ga0299906_107315271 | 3300030606 | Soil | VLFLTRRDGEKIITGGLEENKLKKLKGLRFTLPSLSIVLAKQIGLGAITCCR |
| Ga0074002_100297002 | 3300031086 | Soil | LLAGENIRIGGFEENKLKKLKGERFIFPSLSVVDAKQTGRGAMAC |
| Ga0302347_10759862 | 3300031372 | Leaf Surface | GLVLNILKKLKGLKFIFPSASIVEAKQIGRGAMAYCR |
| Ga0307410_119533201 | 3300031852 | Rhizosphere | VVLSRTLRDGEKITMGGFVENRLKKLKGLRLTVPCLSMVDAKQMGRGATRCCK |
| Ga0307409_1015502741 | 3300031995 | Rhizosphere | LVVLSLTRREGEKTQIGGQMLNKLKKLKGLKLTLPSLSIVEAKQIGRGAIAYCR |
| Ga0334944_058991_504_662 | 3300034009 | Sub-Biocrust Soil | VLSLTRLEGEKITMGGLEENILKKLKGLRFTFPSLSMVEAKQTGLGAMICCR |
| Ga0334998_0294598_820_966 | 3300034019 | Freshwater | TLLAGEKTTIGGLDENKLKKLNGLRFICPSLSMVEAKHIGRGAMECCR |
| Ga0370510_0139737_30_191 | 3300034160 | Untreated Peat Soil | VVLSLTRLAGEKITTGGLEENKLKKLKGLRFTWPTLSIVDAKQIGLGAIACCR |
| Ga0334939_0111789_47_205 | 3300034175 | Biocrust | VLSLTRLEGEKTTIGGLEENILKKLKGLRFTFLSLSIVDAKQIGRGAITCCR |
| Ga0335013_0256014_1_129 | 3300034284 | Freshwater | NLVGFEPKILKKLNGLKFGLPSLSIVLAKQMGLGAIAVNKVL |
| ⦗Top⦘ |