


| Basic Information | |
|---|---|
| Family ID | F078228 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MARKFTMSIPESMYEALEVERKKRKLDTIQETIRSILAEYFREE |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.10 % |
| % of genes from short scaffolds (< 2000 bps) | 56.90 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (46.552 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (30.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.759 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (30.172 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF10923 | BrxC_BrxD | 7.76 |
| PF05559 | DUF763 | 4.31 |
| PF01402 | RHH_1 | 1.72 |
| PF01702 | TGT | 1.72 |
| PF00326 | Peptidase_S9 | 1.72 |
| PF14520 | HHH_5 | 0.86 |
| PF16177 | ACAS_N | 0.86 |
| PF00583 | Acetyltransf_1 | 0.86 |
| PF04055 | Radical_SAM | 0.86 |
| PF14076 | DUF4258 | 0.86 |
| PF13263 | PHP_C | 0.86 |
| PF14947 | HTH_45 | 0.86 |
| PF07705 | CARDB | 0.86 |
| PF02697 | VAPB_antitox | 0.86 |
| PF14338 | Mrr_N | 0.86 |
| PF13588 | HSDR_N_2 | 0.86 |
| PF00005 | ABC_tran | 0.86 |
| PF00801 | PKD | 0.86 |
| PF01850 | PIN | 0.86 |
| PF16795 | Phage_integr_3 | 0.86 |
| PF01867 | Cas_Cas1 | 0.86 |
| PF03965 | Penicillinase_R | 0.86 |
| PF13394 | Fer4_14 | 0.86 |
| PF13304 | AAA_21 | 0.86 |
| PF01939 | NucS | 0.86 |
| PF02796 | HTH_7 | 0.86 |
| PF07676 | PD40 | 0.86 |
| PF13649 | Methyltransf_25 | 0.86 |
| PF01916 | DS | 0.86 |
| PF06739 | SBBP | 0.86 |
| PF00857 | Isochorismatase | 0.86 |
| PF04014 | MazE_antitoxin | 0.86 |
| PF01663 | Phosphodiest | 0.86 |
| PF01047 | MarR | 0.86 |
| PF01637 | ATPase_2 | 0.86 |
| PF01351 | RNase_HII | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 4.31 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.72 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 1.72 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.86 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.86 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1373 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.86 |
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.86 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.86 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.86 |
| COG1753 | Predicted antitoxin, CopG family | Defense mechanisms [V] | 0.86 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.86 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.31 % |
| Unclassified | root | N/A | 45.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001580|Draft_10000856 | Not Available | 32720 | Open in IMG/M |
| 3300001854|JGI24422J19971_10050580 | All Organisms → cellular organisms → Archaea → TACK group | 2364 | Open in IMG/M |
| 3300001854|JGI24422J19971_10332565 | Not Available | 595 | Open in IMG/M |
| 3300002908|JGI25382J43887_10253506 | Not Available | 807 | Open in IMG/M |
| 3300003891|Ga0063011_10159135 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1374 | Open in IMG/M |
| 3300004107|Ga0065179_1033423 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300004143|Ga0066630_1061341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_8_14_3_um_filter_45_9 | 965 | Open in IMG/M |
| 3300004265|Ga0051981_10096640 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005236|Ga0066636_10006299 | All Organisms → cellular organisms → Archaea | 7631 | Open in IMG/M |
| 3300005253|Ga0073583_1054291 | Not Available | 617 | Open in IMG/M |
| 3300005573|Ga0078972_1032156 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 5217 | Open in IMG/M |
| 3300005800|Ga0079639_1017000 | Not Available | 1891 | Open in IMG/M |
| 3300005860|Ga0080004_1096597 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1657 | Open in IMG/M |
| 3300007776|Ga0105674_1301474 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia | 883 | Open in IMG/M |
| 3300007985|Ga0100381_1162778 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300007999|Ga0105163_1073344 | Not Available | 532 | Open in IMG/M |
| 3300008000|Ga0105162_1017175 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1907 | Open in IMG/M |
| 3300008003|Ga0100391_1058741 | Not Available | 2391 | Open in IMG/M |
| 3300008007|Ga0100386_10517078 | Not Available | 535 | Open in IMG/M |
| 3300008019|Ga0105158_1003587 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanofollis → Methanofollis liminatans | 5327 | Open in IMG/M |
| 3300008019|Ga0105158_1024326 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanofollis → Methanofollis liminatans | 1573 | Open in IMG/M |
| 3300008019|Ga0105158_1061319 | Not Available | 832 | Open in IMG/M |
| 3300008516|Ga0111033_1168288 | Not Available | 2504 | Open in IMG/M |
| 3300009034|Ga0115863_1035745 | All Organisms → cellular organisms → Archaea → TACK group | 6541 | Open in IMG/M |
| 3300009034|Ga0115863_1165819 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2690 | Open in IMG/M |
| 3300009034|Ga0115863_1210569 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2336 | Open in IMG/M |
| 3300009034|Ga0115863_1381474 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon BA1 | 1639 | Open in IMG/M |
| 3300009034|Ga0115863_1637214 | Not Available | 1202 | Open in IMG/M |
| 3300009090|Ga0099827_10714282 | Not Available | 866 | Open in IMG/M |
| 3300009136|Ga0118735_10078861 | Not Available | 1013 | Open in IMG/M |
| 3300009149|Ga0114918_10090385 | Not Available | 1925 | Open in IMG/M |
| 3300009150|Ga0114921_10032585 | Not Available | 3129 | Open in IMG/M |
| 3300009150|Ga0114921_10066544 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2306 | Open in IMG/M |
| 3300009150|Ga0114921_10825276 | Not Available | 688 | Open in IMG/M |
| 3300009488|Ga0114925_11477810 | Not Available | 504 | Open in IMG/M |
| 3300009499|Ga0114930_10026679 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3869 | Open in IMG/M |
| 3300009529|Ga0114919_10329516 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1068 | Open in IMG/M |
| 3300010324|Ga0129297_10009613 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4798 | Open in IMG/M |
| 3300010324|Ga0129297_10193172 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_46_16b | 937 | Open in IMG/M |
| 3300010332|Ga0116200_10282741 | Not Available | 814 | Open in IMG/M |
| 3300012206|Ga0137380_11378831 | Not Available | 590 | Open in IMG/M |
| 3300012207|Ga0137381_10490892 | Not Available | 1072 | Open in IMG/M |
| 3300012207|Ga0137381_11369499 | Not Available | 600 | Open in IMG/M |
| 3300012349|Ga0137387_10571817 | Not Available | 820 | Open in IMG/M |
| 3300012964|Ga0153916_12690313 | Not Available | 561 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10028194 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 4120 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10582955 | Not Available | 664 | Open in IMG/M |
| 3300014913|Ga0164310_10239685 | Not Available | 1096 | Open in IMG/M |
| 3300014914|Ga0164311_10692810 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 581 | Open in IMG/M |
| 3300018077|Ga0184633_10001267 | Not Available | 10380 | Open in IMG/M |
| 3300021469|Ga0190361_1082060 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 985 | Open in IMG/M |
| 3300021472|Ga0190363_1000120 | All Organisms → cellular organisms → Archaea | 43308 | Open in IMG/M |
| 3300021472|Ga0190363_1013780 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3805 | Open in IMG/M |
| 3300022221|Ga0224506_10190521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_8_14_3_um_filter_45_9 | 950 | Open in IMG/M |
| 3300022223|Ga0224501_10379996 | Not Available | 703 | Open in IMG/M |
| 3300022544|Ga0212120_1012238 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2728 | Open in IMG/M |
| 3300022546|Ga0212122_1002309 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 10102 | Open in IMG/M |
| 3300022546|Ga0212122_1012880 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2911 | Open in IMG/M |
| 3300022546|Ga0212122_1043085 | Not Available | 1073 | Open in IMG/M |
| 3300022546|Ga0212122_1086856 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 603 | Open in IMG/M |
| 3300024263|Ga0209978_10005099 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 6035 | Open in IMG/M |
| 3300024263|Ga0209978_10062992 | Not Available | 1881 | Open in IMG/M |
| 3300024353|Ga0209979_1031237 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2836 | Open in IMG/M |
| 3300024433|Ga0209986_10299712 | Not Available | 761 | Open in IMG/M |
| 3300024433|Ga0209986_10477416 | Not Available | 553 | Open in IMG/M |
| 3300025016|Ga0210014_1153806 | Not Available | 683 | Open in IMG/M |
| 3300025021|Ga0210017_1005668 | Not Available | 9926 | Open in IMG/M |
| 3300025022|Ga0210056_1003517 | All Organisms → cellular organisms → Archaea | 12722 | Open in IMG/M |
| 3300025092|Ga0209822_1045363 | Not Available | 964 | Open in IMG/M |
| 3300025139|Ga0210021_1157465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_8_14_3_um_filter_45_9 | 916 | Open in IMG/M |
| 3300025143|Ga0209314_10006465 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4773 | Open in IMG/M |
| 3300025845|Ga0210053_1046300 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300026297|Ga0209237_1013389 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4851 | Open in IMG/M |
| 3300027742|Ga0209121_10001152 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 27649 | Open in IMG/M |
| 3300027742|Ga0209121_10031555 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3097 | Open in IMG/M |
| 3300027863|Ga0207433_10217438 | Not Available | 1428 | Open in IMG/M |
| 3300027893|Ga0209636_10016754 | All Organisms → cellular organisms → Archaea | 7460 | Open in IMG/M |
| 3300027893|Ga0209636_10063200 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3635 | Open in IMG/M |
| 3300027893|Ga0209636_10323967 | Not Available | 1345 | Open in IMG/M |
| 3300027893|Ga0209636_10718003 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 780 | Open in IMG/M |
| 3300027893|Ga0209636_11241057 | Not Available | 522 | Open in IMG/M |
| 3300031463|Ga0272448_1074326 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2338 | Open in IMG/M |
| 3300031539|Ga0307380_11314150 | Not Available | 552 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1273100 | Not Available | 592 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1334897 | Not Available | 509 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1040597 | Not Available | 2218 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1238174 | Not Available | 681 | Open in IMG/M |
| 3300031707|Ga0315291_10999520 | Not Available | 704 | Open in IMG/M |
| 3300031707|Ga0315291_11070160 | Not Available | 672 | Open in IMG/M |
| 3300031772|Ga0315288_10004552 | All Organisms → cellular organisms → Archaea | 17668 | Open in IMG/M |
| 3300031862|Ga0315280_10001936 | All Organisms → cellular organisms → Archaea | 34458 | Open in IMG/M |
| 3300031862|Ga0315280_10013903 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 9470 | Open in IMG/M |
| 3300031862|Ga0315280_10017550 | All Organisms → cellular organisms → Archaea | 8001 | Open in IMG/M |
| 3300031862|Ga0315280_10063688 | Not Available | 2962 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10019975 | All Organisms → cellular organisms → Bacteria | 3909 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10106468 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1369 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10141704 | Not Available | 1132 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10183677 | Not Available | 951 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10241101 | All Organisms → cellular organisms → Archaea | 788 | Open in IMG/M |
| (restricted) 3300031898|Ga0315312_1004628 | All Organisms → cellular organisms → Archaea | 8289 | Open in IMG/M |
| (restricted) 3300031898|Ga0315312_1016680 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3542 | Open in IMG/M |
| 3300031952|Ga0315294_10001764 | All Organisms → cellular organisms → Archaea | 23663 | Open in IMG/M |
| 3300031952|Ga0315294_10350841 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1399 | Open in IMG/M |
| 3300031999|Ga0315274_10061698 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 5000 | Open in IMG/M |
| 3300031999|Ga0315274_11213959 | Not Available | 745 | Open in IMG/M |
| 3300032020|Ga0315296_10626652 | Not Available | 549 | Open in IMG/M |
| 3300032046|Ga0315289_10399053 | Not Available | 1369 | Open in IMG/M |
| 3300032046|Ga0315289_10408225 | Not Available | 1347 | Open in IMG/M |
| 3300032069|Ga0315282_10003000 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales | 30535 | Open in IMG/M |
| 3300032069|Ga0315282_10003431 | All Organisms → cellular organisms → Archaea | 28459 | Open in IMG/M |
| 3300032069|Ga0315282_10003577 | All Organisms → cellular organisms → Archaea | 27852 | Open in IMG/M |
| 3300032070|Ga0315279_10035462 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 4977 | Open in IMG/M |
| 3300032118|Ga0315277_10000375 | All Organisms → cellular organisms → Archaea | 71697 | Open in IMG/M |
| 3300032118|Ga0315277_10363434 | Not Available | 1499 | Open in IMG/M |
| 3300032516|Ga0315273_11523353 | Not Available | 821 | Open in IMG/M |
| 3300033991|Ga0334965_0000593 | All Organisms → cellular organisms → Archaea | 28592 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 30.17% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 10.34% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring | 9.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 6.90% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 5.17% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 5.17% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 4.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.31% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.59% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 2.59% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.72% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.72% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.72% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.86% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.86% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.86% |
| Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.86% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.86% |
| Thermal Hot Spring | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring | 0.86% |
| Sulfidic Aquatic | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003891 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing sample CP Core 1 1cm | Environmental | Open in IMG/M |
| 3300004107 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/8/14 3 um filter (version 2) | Environmental | Open in IMG/M |
| 3300004143 | Groundwater microbial communities from aquifer - Crystal Geyser CG01_land_8/20/14_3.00 | Environmental | Open in IMG/M |
| 3300004265 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/10/14 3 um filter | Environmental | Open in IMG/M |
| 3300005236 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 | Environmental | Open in IMG/M |
| 3300005253 | Marine sediment microbial community near Loki's castle | Environmental | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005800 | Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13 | Environmental | Open in IMG/M |
| 3300005860 | Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPADES assembly) | Environmental | Open in IMG/M |
| 3300007776 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007985 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-05 | Environmental | Open in IMG/M |
| 3300007999 | Hot spring microbial communities from Jinze hot spring, China to study Microbial Dark Matter (Phase II) - JNZ 110809A | Environmental | Open in IMG/M |
| 3300008000 | Hot spring microbial communities from Jinze hot spring, China to study Microbial Dark Matter (Phase II) - JNZ 20120812A | Environmental | Open in IMG/M |
| 3300008003 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 | Environmental | Open in IMG/M |
| 3300008007 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-10 | Environmental | Open in IMG/M |
| 3300008019 | Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_matched | Environmental | Open in IMG/M |
| 3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010332 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300021469 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-4-5_MG | Environmental | Open in IMG/M |
| 3300021472 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-6-7_MG | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022544 | Jinze_combined assembly | Environmental | Open in IMG/M |
| 3300022546 | LHC4_combined assembly | Environmental | Open in IMG/M |
| 3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025016 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-19 (SPAdes) | Environmental | Open in IMG/M |
| 3300025021 | Groundwater microbial communities from aquifer - Crystal Geyser CG08_land_8/20/14_0.20 (SPAdes) | Environmental | Open in IMG/M |
| 3300025022 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes) | Environmental | Open in IMG/M |
| 3300025092 | Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_matched (SPAdes) | Environmental | Open in IMG/M |
| 3300025139 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025143 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025845 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300031463 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031898 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_1000085624 | 3300001580 | Hydrocarbon Resource Environments | MAEKFTMSVPDAMKKALEVEQGKRKLDTVQETIRSILAEYFAGK* |
| JGI24422J19971_100505802 | 3300001854 | Marine Sediment | MSIPEAMRKGLEKEKERRKLDTIQETIRSILAEYFKSNS* |
| JGI24422J19971_103325652 | 3300001854 | Marine Sediment | MAEKFTMSVPESMYQALEKERKKRKLGTIQETIRFILAE |
| JGI25382J43887_102535061 | 3300002908 | Grasslands Soil | MAAKFTMSVPSAMKVALEEERRRRKLDSIQETIRSILSEYFSGLSKR* |
| Ga0063011_101591352 | 3300003891 | Hot Spring Sediments | MSKFTMSIPEAMKKALEEERKRRCLDTIQETIRSITSEYFVQKKE* |
| Ga0065179_10334232 | 3300004107 | Groundwater | LPKFTMSLSEEMMKAIKEEKKKRKLGSIQETIRSILAEYFAKKS* |
| Ga0066630_10613411 | 3300004143 | Groundwater | LPKFTMSLSEEMMKAIKEEKKKRKLGSIQETIRSILAEYFAK |
| Ga0051981_100966402 | 3300004265 | Groundwater | MSLSEEMMKAIKEEKKKRKLGSIQETIRSILAEYFAKKS* |
| Ga0066636_100062994 | 3300005236 | Groundwater | LPKFTMSLSEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS* |
| Ga0073583_10542912 | 3300005253 | Marine Sediment | MVKFSMSVPQAMQDALDEEQKQRRLDNTQETIRSILAEYFRGCARKF* |
| Ga0078972_10321561 | 3300005573 | Hot Spring | MAKKFTMSIPDAMHAALEKERQKRKLGTIQELIRFIIAEYLKEKST* |
| Ga0079639_10170001 | 3300005800 | Thermal Hot Spring | MAKKFTMSIPEAMYIALEKERQKRKLGTIQELIRFILADYLKEKST* |
| Ga0080004_10965972 | 3300005860 | Sulfidic Aquatic | MSKKFTMSVPDSMNRALQKECQKRRLGTIQETIRSILAEYFKEEGNNTSSN* |
| Ga0105674_13014742 | 3300007776 | Diffuse Vent Fluid, Hydrothermal Vents | MADKFTMSLPNSMKDALNIEMKKRKCDTFQETIRSILSEYFRNQGRV* |
| Ga0100381_11627781 | 3300007985 | Aquifer | EMMKAIKEEKKKRKLGSIQETIRSILAEYFAKKS* |
| Ga0105163_10733442 | 3300007999 | Hot Spring | MAKKFTMSMPDDMYAALEKERQKRKLGTIQELIRFIISDYFKEKTT* |
| Ga0105162_10171752 | 3300008000 | Hot Spring | MAKKFTMSMPDDMYAALEKERQRRKLGTIQELIRFIISDYFKEKTT* |
| Ga0100391_10587413 | 3300008003 | Aquifer | MSLSEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS* |
| Ga0100386_105170781 | 3300008007 | Aquifer | FTMSLSEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS* |
| Ga0105158_10035872 | 3300008019 | Hot Spring | MAKKFTMSIPDAMYAALERERQKRKLGTIQELVRFIIAEYLKEKGT* |
| Ga0105158_10243262 | 3300008019 | Hot Spring | VAKKFTMSIPDAMYAALEKERQKRKLGTIQEIIRFIIAEYLKEKSS* |
| Ga0105158_10613191 | 3300008019 | Hot Spring | VAKKFTMSIPDAMYAALEKERQKRKLGTIQELIRFIIAEYLKEKGI* |
| Ga0111033_11682884 | 3300008516 | Marine Sediment | MAKFTMSVPEAMNGALEKEKEQRRLDTIQETIRSILSEYFRHKEIKS* |
| Ga0115863_10357455 | 3300009034 | Sediment, Intertidal | MPMPKFTMAIPKAMKKALEEEKKRRKLGTIQATIRSILAEHFGKD* |
| Ga0115863_11658194 | 3300009034 | Sediment, Intertidal | MKMAKFTMSVPEAMKKALEEEKERRKLGTIQETIRSIL |
| Ga0115863_12105691 | 3300009034 | Sediment, Intertidal | MKMTKFTMSLPEAMKKALDEEKERRKLGTIQETIRSILAEYFKSKGENL* |
| Ga0115863_13814743 | 3300009034 | Sediment, Intertidal | MAKFTMSIPEAMKEALEKERELRKLGTIQETIRSILGGYFRSKERVKIVSA* |
| Ga0115863_16372143 | 3300009034 | Sediment, Intertidal | MRMAKFTMSVPEAMKEALEKEREQRKLDTVQEAIRSILAEYFREQGSQG* |
| Ga0099827_107142822 | 3300009090 | Vadose Zone Soil | MAAKFTMSVPGAMKVALEEERRRRKLDSIQETIRSILSEYFSGLSKR* |
| Ga0118735_100788612 | 3300009136 | Marine Sediment | MAKFTMSIPEAMKEALEGEKERRRLDTIQETIRSILAEYFRNKGP* |
| Ga0114918_100903856 | 3300009149 | Deep Subsurface | MAKFTMSVPAAMQEALERERERRRLGTLQETIRNILAEYFKEQG* |
| Ga0114921_100325853 | 3300009150 | Deep Subsurface | MAKFTMSVPEAMKEALEREKERRRLDTIQEAIRSILAEYFRDKIL* |
| Ga0114921_100665442 | 3300009150 | Deep Subsurface | MGMTKFTMSVPEAMKEALEEEMEKRKLDTIQQTMRAILSDYFAAKG* |
| Ga0114921_108252761 | 3300009150 | Deep Subsurface | IPEAMKEALEKERELRKLGSTQETIRSILGDYFRSKERGKET* |
| Ga0114925_114778101 | 3300009488 | Deep Subsurface | MSVPEAMNGALEKEKEQRRLDTIQETIRSILSEYFRDKEIKS* |
| Ga0114930_100266798 | 3300009499 | Deep Subsurface | MAKFTMSIPEAMKTALEKEIERRKLDTVQEAIRSILADYFRDQ* |
| Ga0114919_103295162 | 3300009529 | Deep Subsurface | MKMTKFTMSIPEAMREALEKERELRKLGSTQETIRSILSDYFRSKERGKET* |
| Ga0129297_100096133 | 3300010324 | Lake Sediment | MARKFTMSIPESMYEALEVERKKRKLDTIQETIRSILAEYFREETRSS* |
| Ga0129297_101931724 | 3300010324 | Lake Sediment | MGMVKFTMSLPEAMKKALEEEMKKRKLDSIQETIRSILSEYFSKAKE* |
| Ga0116200_102827412 | 3300010332 | Marine Hydrothermal Vent | MAKKFTMSLPEEMYLALEKERRKRKLGTIQELIRFIIAEHLKEKSD* |
| Ga0137380_113788312 | 3300012206 | Vadose Zone Soil | MALKFTMSVPAAMKGALDEERKRRKLDTIQDTIRSILAEYFAGKR* |
| Ga0137381_104908921 | 3300012207 | Vadose Zone Soil | RRARTGILPMALKFTMSVPAAMKGALDEERKRRKLDTIQDTIRSILAEYFAGKR* |
| Ga0137381_113694991 | 3300012207 | Vadose Zone Soil | MAEKFTMSVPGAMKAVLEEEKKRRKLDTLQDTIRSILSEYFAVRSKR* |
| Ga0137387_105718171 | 3300012349 | Vadose Zone Soil | MAAKFTMSVPGAMKVALEEERRRRKLDSIQETIRSILSEYF |
| Ga0153916_126903131 | 3300012964 | Freshwater Wetlands | MAEKFTMVVPAAMAKALDEERKKRALDNLQETIRSICSDYFRNREKR* |
| (restricted) Ga0172366_100281944 | 3300013128 | Sediment | MAKKFTMSIPESMYRALDKEREKRKLDTIQETIRFILAEYLKEEKIK* |
| (restricted) Ga0172366_105829551 | 3300013128 | Sediment | MVKFTMSLPKAMKEALEKERQRRKMDTLQETIRSILAEY |
| Ga0164310_102396852 | 3300014913 | Marine Sediment | VAKKFTMSLPEAMYEALEKERVKRKLSSIQETIRFILAEYLKGKNS* |
| Ga0164311_106928101 | 3300014914 | Marine Sediment | MSLPESMFRALEEERKKRRLDNIQETIRSILAEYFKEKASKRVI* |
| Ga0184633_100012675 | 3300018077 | Groundwater Sediment | MATKFTMSVPAAMKAALEEERRRRKLDSNQDTIRSIMSDYFARLAK |
| Ga0190361_10820602 | 3300021469 | Hydrothermal Vent Microbial Mat | VITRVVILMSRKFTMSLPKEMYRALEEERRKRKLDTIQETIRSILAEYFRKKEKM |
| Ga0190363_100012029 | 3300021472 | Hydrothermal Vent Microbial Mat | MSRKFTMSLPKEMYRALEEERRKRKLDTIQETIRSILAEYFRKKEKM |
| Ga0190363_10137803 | 3300021472 | Hydrothermal Vent Microbial Mat | VAKKFTMSLPEAMYEALEKERVKRKLSSIQETIRFILAEYLKGKNS |
| Ga0224506_101905212 | 3300022221 | Sediment | MSLSEEMMKAIEEEKKKRKLGSIQETIRSILAEYFAKKS |
| Ga0224501_103799962 | 3300022223 | Sediment | MSVPEAMEKALEEEKKRRKLGTIQETIRSILAEYFHQKE |
| Ga0212120_10122382 | 3300022544 | Hot Spring | MAKKFTMSMPDDMYAALEKERQRRKLGTIQELIRFIISDYFKEKTT |
| Ga0212122_10023096 | 3300022546 | Hot Spring | MAKKFTMSIPDAMYAALERERQKRKLGTIQELVRFIIAEYLKEKGT |
| Ga0212122_10128802 | 3300022546 | Hot Spring | VAKKFTMSIPDAMYAALEKERQKRKLGTIQEIIRFIIAEYLKEKSS |
| Ga0212122_10430851 | 3300022546 | Hot Spring | VAKKFTMSIPDAMYAALEKERQKRKLGTIQELIRFIIAEYLKEKGI |
| Ga0212122_10868562 | 3300022546 | Hot Spring | VAKKFTMSIPDAMYAALEKERQKRKLGTIQELIRFIIAEYLKEKGT |
| Ga0209978_100050998 | 3300024263 | Deep Subsurface | MGMTKFTMSVPEAMKEALEEEMEKRKLDTIQQTMRAILSDYFAAKG |
| Ga0209978_100629921 | 3300024263 | Deep Subsurface | MSVPEAMKEALEREKERRRLDTIQEAIRSILAEYFRDKIL |
| Ga0209979_10312375 | 3300024353 | Deep Subsurface | MAKFTMSIPEAMKTALEKEIERRKLDTVQEAIRSILADYFRDQ |
| Ga0209986_102997122 | 3300024433 | Deep Subsurface | MRARKGEDRRMAKFSMTVTRAMEEALHKEREQRKLNTLQETIRSILGEYFRAQR |
| Ga0209986_104774161 | 3300024433 | Deep Subsurface | TKFTMSIPEAMREALEKERELRKLGSIQETIRSILGDYFRSKERGKET |
| Ga0210014_11538061 | 3300025016 | Aquifer | SEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS |
| Ga0210017_10056688 | 3300025021 | Groundwater | MSLSEEMMKAIKEEKKKRKLGSIQETIRSILAEYFAKKS |
| Ga0210056_100351713 | 3300025022 | Groundwater | MSLSEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS |
| Ga0209822_10453631 | 3300025092 | Hot Spring | FTMSIPDAMYAALEKERQKRKLGTIQELIRFIIAEYLKEKGI |
| Ga0210021_11574651 | 3300025139 | Aquifer | MSLSEEMMKAIKEEKKKRKLGSIQETIRSILAEYF |
| Ga0209314_100064653 | 3300025143 | Lake Sediment | MARKFTMSIPESMYEALEVERKKRKLDTIQETIRSILAEYFREETRSS |
| Ga0210053_10463002 | 3300025845 | Aquifer | LPKFTMSLSEEMMKAIKEEKKKRKLGFIQETIRSILAEYFAKKS |
| Ga0209237_10133893 | 3300026297 | Grasslands Soil | MAAKFTMSVPSAMKVALEEERRRRKLDSIQETIRSILSEYFSGLSKR |
| Ga0209121_1000115212 | 3300027742 | Marine | MAKKFTMSVPNSMYEALERERKKRRLGTIQQTIRFLLAEYMKEKNS |
| Ga0209121_100315552 | 3300027742 | Marine | MPEKFTMSIPEAMHKALEEERKNRKLDNVQETIRAILSEYFKKQG |
| Ga0207433_102174382 | 3300027863 | Hot Spring | MAKKFTMSIPDAMHAALEKERQKRKLGTIQELIRFIIAEYLKEKST |
| Ga0209636_100167548 | 3300027893 | Marine Sediment | MMKFTMSIPEAMRKGLEKEKERRKLDTIQETIRSILAEYFKSNS |
| Ga0209636_100632004 | 3300027893 | Marine Sediment | TMSIPEAMRKGLEKEKERRKLDTIQETIRSILAEYFKSNS |
| Ga0209636_103239672 | 3300027893 | Marine Sediment | MAKKFTMSVPQSMHQALEKERVKRKLGTIQETIRFILAEYLKEKDS |
| Ga0209636_107180032 | 3300027893 | Marine Sediment | MAKKFTMSTPDSMYQALEKECKKRKLGTIQETIRFILAEYLKEKNN |
| Ga0209636_112410571 | 3300027893 | Marine Sediment | MKGKFTMSLSKTMLEALENERKLRKLRSLQETIRFILAEYFREKNE |
| Ga0272448_10743262 | 3300031463 | Sediment | MSKKFTMSVPDSMYRALQKECQKRRLGTIQETIRSILAEYFKEEGNNTSSN |
| Ga0307380_113141502 | 3300031539 | Soil | MAKFTMSVPSAMQEALERERQRRRLGTLQETMRAILSEYFKEQSPKD |
| (restricted) Ga0315308_12731001 | 3300031587 | Sediment | MPMAKFTMSVPGAMEKALEEEMERRKLGTIQETIRSILAEYFGQKEKT |
| (restricted) Ga0315308_13348972 | 3300031587 | Sediment | MGLAKFTMSVPDAMKEALEKERIRRKLGTIQETMRSILAEYFKEQS |
| (restricted) Ga0315309_10405973 | 3300031604 | Sediment | MARKFTMSIPESMYEALEVERKKRKLDTIQETIRSILAEYFREE |
| (restricted) Ga0315309_12381741 | 3300031604 | Sediment | MPMAKFTMSVPEAMEKALEEEMERRKLDTIQETIRSILAEYFGQRKNVSSH |
| Ga0315291_109995201 | 3300031707 | Sediment | SLPDAMEEALEKECARRKLDTVQETIRSILAEYFKGQGSESQK |
| Ga0315291_110701601 | 3300031707 | Sediment | MRMVKFTMSLPDAMKEALEKECARRKLDTVQETIRSILAEYFKGQGSESQK |
| Ga0315288_1000455213 | 3300031772 | Sediment | MAKFTMSVPEAMGKALERERDRRRLDTIQETIRSILAEYFRDK |
| Ga0315280_100019369 | 3300031862 | Sediment | MRMVKFTMSLPDAMKEALEKERIRRKLDTLQETIRSILAEYFKEQR |
| Ga0315280_100139035 | 3300031862 | Sediment | MAKKFTMSIPESMYRALDKEREKRKLDTIQETIRFILAEYLKEEKIK |
| Ga0315280_100175506 | 3300031862 | Sediment | MPKFTMSIPEAMKKALEEEMRRRRLDTVQETIRSILSEYFGQKEK |
| Ga0315280_100636882 | 3300031862 | Sediment | MAKRFTMSVPEAMYNALLKEARERRLDTIQETIRSILAEYFSEKRNFQ |
| (restricted) Ga0315310_100199754 | 3300031876 | Sediment | MPMAKFTMSIPEAMEKALEEEMKCRKLDTIQETIRSILSEYFGQK |
| (restricted) Ga0315310_101064682 | 3300031876 | Sediment | MARKFTMSLPRSMHEALETERKRRKLDTIQETIRSILAEYFKNRNKGTL |
| (restricted) Ga0315310_101417042 | 3300031876 | Sediment | MVKFTMSLPEAMKEALEKERVRRKLDTVQETIRSVLAEYFRDQR |
| (restricted) Ga0315310_101836772 | 3300031876 | Sediment | MGMAKFTMSVPDAMKEALEKERIRRKLDTIQETMRSILAEYFKEQS |
| (restricted) Ga0315310_102411012 | 3300031876 | Sediment | MKMVKFTMSLPDAMKEALEKERVRRKLDNLQETIRSILAEYFKGQS |
| (restricted) Ga0315312_100462812 | 3300031898 | Sediment | LARKFTMSVPDSMDNALEEERKKRKLDDIQETIRSILSEYFRDKSHGGKS |
| (restricted) Ga0315312_10166804 | 3300031898 | Sediment | MSKKFTMSVPDSMYRALEVEREGRKLDTLQQTIRSILAEYFSRKPKST |
| Ga0315294_1000176415 | 3300031952 | Sediment | MAKKFTMSIPDSMNRALEKEQEKRKLGTIQETIRFILSEYFKTNN |
| Ga0315294_103508412 | 3300031952 | Sediment | MAKKFTMSVPDSMNRALEKEKEKRKLGTIQEVIRFILAEYLEDRDS |
| Ga0315274_100616983 | 3300031999 | Sediment | MSIPDSMNKALEKEREKKKLGTIQETIRFILADYLNDKNT |
| Ga0315274_112139591 | 3300031999 | Sediment | MKMAKFTMSLPEAMNKALEEEKERRKLGTIQETIRSILAEYF |
| Ga0315296_106266521 | 3300032020 | Sediment | MKMAKFTMSLPEAMNKALEEEEERRKLGTIQETIRSILAEYFKSKGENP |
| Ga0315289_103990531 | 3300032046 | Sediment | MAKKFTMSIPDSMNKALEKEQERRKLGTIQETIRFILADYLKDKNNHIR |
| Ga0315289_104082251 | 3300032046 | Sediment | MAKFTMSVPEAMGKALEKERDRRRLDTIQETIRSILA |
| Ga0315282_1000300026 | 3300032069 | Sediment | MSLPDAMKEALEKECTRRRLDTLQETIRSILAEYFKEQGLEPPDRPR |
| Ga0315282_1000343112 | 3300032069 | Sediment | MARKFTMSLPESMHQAVETERKRRKLDTVQETIRSILAEYFRDRNKEMF |
| Ga0315282_100035778 | 3300032069 | Sediment | MAKKFTMSIPDSMNKAIEKEREKRKLGTVQETIRFILAEYLKERNS |
| Ga0315279_100354624 | 3300032070 | Sediment | MAKKFTMSIPDSMNKALEKEQEKRKLGTVQETIRFILADYLKDKNNHIR |
| Ga0315277_100003759 | 3300032118 | Sediment | MAEKFTMSVPDAMKAALEDERKRRKLDTLQDTIRSILSEYFAGKAKR |
| Ga0315277_103634341 | 3300032118 | Sediment | SIPDAMEKALQNEMRRRKLDTFQETIRSILSEYFASHQ |
| Ga0315273_115233532 | 3300032516 | Sediment | MAEKFTMSVPDAMKKALEIERERRKLDTVQETIRSILSEYFAAK |
| Ga0334965_0000593_24675_24806 | 3300033991 | Sediment | MVKFTMSLPEAMKKALEEEMKKRRLDSIQETIRSVLAEYFSKV |
| ⦗Top⦘ |