


| Basic Information | |
|---|---|
| Family ID | F073671 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.50 % |
| % of genes near scaffold ends (potentially truncated) | 5.83 % |
| % of genes from short scaffolds (< 2000 bps) | 21.67 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human (68.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface (93.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 84.44% β-sheet: 0.00% Coil/Unstructured: 15.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00436 | SSB | 13.33 |
| PF03837 | RecT | 5.83 |
| PF10552 | ORF6C | 5.00 |
| PF04381 | RdgC | 5.00 |
| PF04448 | DUF551 | 4.17 |
| PF13649 | Methyltransf_25 | 3.33 |
| PF03406 | Phage_fiber_2 | 3.33 |
| PF14464 | Prok-JAB | 2.50 |
| PF00145 | DNA_methylase | 2.50 |
| PF06289 | FlbD | 2.50 |
| PF10548 | P22_AR_C | 2.50 |
| PF00224 | PK | 2.50 |
| PF07715 | Plug | 1.67 |
| PF03819 | MazG | 1.67 |
| PF00005 | ABC_tran | 1.67 |
| PF11041 | DUF2612 | 1.67 |
| PF14301 | DUF4376 | 1.67 |
| PF00582 | Usp | 0.83 |
| PF08861 | DUF1828 | 0.83 |
| PF04358 | DsrC | 0.83 |
| PF04851 | ResIII | 0.83 |
| PF13392 | HNH_3 | 0.83 |
| PF01168 | Ala_racemase_N | 0.83 |
| PF05100 | Phage_tail_L | 0.83 |
| PF01416 | PseudoU_synth_1 | 0.83 |
| PF13986 | DUF4224 | 0.83 |
| PF12008 | EcoR124_C | 0.83 |
| PF02086 | MethyltransfD12 | 0.83 |
| PF01936 | NYN | 0.83 |
| PF13856 | Gifsy-2 | 0.83 |
| PF03796 | DnaB_C | 0.83 |
| PF01381 | HTH_3 | 0.83 |
| PF05766 | NinG | 0.83 |
| PF01479 | S4 | 0.83 |
| PF05930 | Phage_AlpA | 0.83 |
| PF10828 | DUF2570 | 0.83 |
| PF09003 | Arm-DNA-bind_1 | 0.83 |
| PF10108 | DNA_pol_B_exo2 | 0.83 |
| PF04865 | Baseplate_J | 0.83 |
| PF03592 | Terminase_2 | 0.83 |
| PF05065 | Phage_capsid | 0.83 |
| PF06472 | ABC_membrane_2 | 0.83 |
| PF12821 | ThrE_2 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 13.33 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 13.33 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 5.83 |
| COG2974 | DNA recombination-dependent growth factor RdgC | Replication, recombination and repair [L] | 5.00 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.50 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.50 |
| COG1582 | Swarming motility protein SwrD | Cell motility [N] | 2.50 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.83 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.83 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.83 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.83 |
| COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.83 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.83 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.83 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.83 |
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.33 % |
| Unclassified | root | N/A | 11.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908012|sp300_12631222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 3163 | Open in IMG/M |
| 3300006247|Ga0099374_1000028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 143963 | Open in IMG/M |
| 3300006248|Ga0099387_100003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 182519 | Open in IMG/M |
| 3300006251|Ga0099392_102691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 5803 | Open in IMG/M |
| 3300006254|Ga0099365_1000039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 43402 | Open in IMG/M |
| 3300006259|Ga0099458_100116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 79037 | Open in IMG/M |
| 3300006261|Ga0099521_100001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 564764 | Open in IMG/M |
| 3300006292|Ga0099622_100318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 38321 | Open in IMG/M |
| 3300006319|Ga0099581_100219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 46774 | Open in IMG/M |
| 3300006319|Ga0099581_100223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 46376 | Open in IMG/M |
| 3300006321|Ga0099624_100228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 55379 | Open in IMG/M |
| 3300006348|Ga0099694_100664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 12907 | Open in IMG/M |
| 3300006457|Ga0100214_100163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 22185 | Open in IMG/M |
| 3300006460|Ga0100061_100098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 83170 | Open in IMG/M |
| 3300006477|Ga0100232_117876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1242 | Open in IMG/M |
| 3300006489|Ga0100254_100231 | All Organisms → Viruses | 8135 | Open in IMG/M |
| 3300006678|Ga0100058_100244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 50363 | Open in IMG/M |
| 3300007079|Ga0104033_100373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 24939 | Open in IMG/M |
| 3300007096|Ga0102538_102800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 5920 | Open in IMG/M |
| 3300007125|Ga0102700_1000240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 54424 | Open in IMG/M |
| 3300007125|Ga0102700_1011670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 3237 | Open in IMG/M |
| 3300007128|Ga0102725_100081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 48341 | Open in IMG/M |
| 3300007135|Ga0102639_100004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 192887 | Open in IMG/M |
| 3300007186|Ga0103259_109135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus haemolyticus | 2551 | Open in IMG/M |
| 3300007194|Ga0103269_100346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 39069 | Open in IMG/M |
| 3300007204|Ga0103275_100003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 281336 | Open in IMG/M |
| 3300007278|Ga0104339_104482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 847 | Open in IMG/M |
| 3300007295|Ga0104867_1001063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 15152 | Open in IMG/M |
| 3300007300|Ga0104843_100193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 48138 | Open in IMG/M |
| 3300007314|Ga0104968_100220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 40878 | Open in IMG/M |
| 3300007316|Ga0104922_103052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 8077 | Open in IMG/M |
| 3300007339|Ga0104971_100081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 46570 | Open in IMG/M |
| 3300007648|Ga0105531_100497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 28655 | Open in IMG/M |
| 3300007736|Ga0105757_1000081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 45821 | Open in IMG/M |
| 3300007753|Ga0105778_100652 | All Organisms → cellular organisms → Bacteria | 11686 | Open in IMG/M |
| 3300007869|Ga0111024_101618 | All Organisms → Viruses → Predicted Viral | 4148 | Open in IMG/M |
| 3300007971|Ga0114094_1029419 | Not Available | 610 | Open in IMG/M |
| 3300007996|Ga0111052_101883 | All Organisms → Viruses | 12031 | Open in IMG/M |
| 3300008099|Ga0114261_105895 | All Organisms → Viruses → Predicted Viral | 3407 | Open in IMG/M |
| 3300008125|Ga0114856_1010584 | Not Available | 2963 | Open in IMG/M |
| 3300008128|Ga0114847_114071 | Not Available | 1205 | Open in IMG/M |
| 3300008133|Ga0111365_100238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 48058 | Open in IMG/M |
| 3300008133|Ga0111365_145708 | Not Available | 516 | Open in IMG/M |
| 3300008138|Ga0114843_100165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 43765 | Open in IMG/M |
| 3300008143|Ga0114287_100318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 33416 | Open in IMG/M |
| 3300008147|Ga0114367_101939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 10060 | Open in IMG/M |
| 3300008270|Ga0114159_101031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 4361 | Open in IMG/M |
| 3300008274|Ga0114252_102840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus haemolyticus | 3681 | Open in IMG/M |
| 3300008279|Ga0114263_1001214 | Not Available | 8897 | Open in IMG/M |
| 3300008305|Ga0115183_100074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 41224 | Open in IMG/M |
| 3300008333|Ga0115302_100087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 69251 | Open in IMG/M |
| 3300008333|Ga0115302_101121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 13847 | Open in IMG/M |
| 3300008403|Ga0115182_100602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 15940 | Open in IMG/M |
| 3300008436|Ga0115418_100271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 45100 | Open in IMG/M |
| 3300008472|Ga0115373_1027788 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300008518|Ga0115191_100217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 51604 | Open in IMG/M |
| 3300008556|Ga0111059_102969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 5636 | Open in IMG/M |
| 3300008626|Ga0111364_100202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 43137 | Open in IMG/M |
| 3300008660|Ga0111492_102844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 4027 | Open in IMG/M |
| 3300008732|Ga0113984_103311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 3414 | Open in IMG/M |
| 3300008739|Ga0114021_135554 | Not Available | 675 | Open in IMG/M |
| 3300009954|Ga0133740_10010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 33459 | Open in IMG/M |
| 3300009961|Ga0133745_10165 | All Organisms → Viruses → Predicted Viral | 3567 | Open in IMG/M |
| 3300011967|Ga0119781_116906 | Not Available | 825 | Open in IMG/M |
| 3300011982|Ga0119773_1006132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 3358 | Open in IMG/M |
| 3300014108|Ga0134359_1007993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 1327 | Open in IMG/M |
| 3300014951|Ga0169829_100265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 64437 | Open in IMG/M |
| 3300029479|Ga0244137_100259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 64123 | Open in IMG/M |
| 3300029679|Ga0243220_103444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 4703 | Open in IMG/M |
| 7000000005|SRS022536_LANL_scaffold_112765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 6475 | Open in IMG/M |
| 7000000009|SRS018300_Baylor_scaffold_43448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 3659 | Open in IMG/M |
| 7000000016|SRS023538_Baylor_scaffold_41056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 1455 | Open in IMG/M |
| 7000000025|SRS023617_Baylor_scaffold_29664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18902 | Open in IMG/M |
| 7000000027|C2568910 | All Organisms → Viruses → Predicted Viral | 2812 | Open in IMG/M |
| 7000000029|SRS042131_WUGC_scaffold_53336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 3948 | Open in IMG/M |
| 7000000033|SRS019333_WUGC_scaffold_16267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 4422 | Open in IMG/M |
| 7000000039|C2361491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 2267 | Open in IMG/M |
| 7000000042|C3788548 | Not Available | 566 | Open in IMG/M |
| 7000000051|C1816283 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 7000000086|C4112281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctVKV3 | 671 | Open in IMG/M |
| 7000000099|C3289035 | Not Available | 1277 | Open in IMG/M |
| 7000000110|SRS011098_Baylor_scaffold_27433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 19634 | Open in IMG/M |
| 7000000128|SRS050244_LANL_scaffold_36247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 541 | Open in IMG/M |
| 7000000132|SRS012285_Baylor_scaffold_55315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 5095 | Open in IMG/M |
| 7000000140|SRS044373_WUGC_scaffold_60621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 8138 | Open in IMG/M |
| 7000000144|C4869098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1454 | Open in IMG/M |
| 7000000159|SRS063288_LANL_scaffold_63181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 4264 | Open in IMG/M |
| 7000000180|SRS017013_Baylor_scaffold_23037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 898 | Open in IMG/M |
| 7000000180|SRS017013_Baylor_scaffold_23698 | All Organisms → Viruses → Predicted Viral | 3678 | Open in IMG/M |
| 7000000195|SRS017209_Baylor_scaffold_24281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4817 | Open in IMG/M |
| 7000000197|SRS017808_Baylor_scaffold_3102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 4103 | Open in IMG/M |
| 7000000203|SRS024441_LANL_scaffold_56521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 3293 | Open in IMG/M |
| 7000000222|SRS057539_LANL_scaffold_23351 | All Organisms → Viruses | 41991 | Open in IMG/M |
| 7000000276|SRS054687_LANL_scaffold_48704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 16425 | Open in IMG/M |
| 7000000295|SRS019219_WUGC_scaffold_66328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 18292 | Open in IMG/M |
| 7000000301|SRS016092_WUGC_scaffold_6431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 45259 | Open in IMG/M |
| 7000000313|SRS058053_LANL_scaffold_56837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1076 | Open in IMG/M |
| 7000000394|SRS019607_WUGC_scaffold_57356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 11791 | Open in IMG/M |
| 7000000402|SRS024580_LANL_scaffold_42492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 7622 | Open in IMG/M |
| 7000000436|SRS015644_WUGC_scaffold_3027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 15425 | Open in IMG/M |
| 7000000457|C3994762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 9696 | Open in IMG/M |
| 7000000488|SRS016529_Baylor_scaffold_4770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 4443 | Open in IMG/M |
| 7000000504|C2689454 | Not Available | 726 | Open in IMG/M |
| 7000000513|C2450981 | Not Available | 903 | Open in IMG/M |
| 7000000519|SRS018357_Baylor_scaffold_41345 | All Organisms → Viruses → Predicted Viral | 3883 | Open in IMG/M |
| 7000000523|SRS019126_WUGC_scaffold_42151 | All Organisms → Viruses | 39231 | Open in IMG/M |
| 7000000537|C1180083 | All Organisms → Viruses → Predicted Viral | 2436 | Open in IMG/M |
| 7000000553|C2408155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 11541 | Open in IMG/M |
| 7000000561|SRS057355_LANL_scaffold_33617 | Not Available | 569 | Open in IMG/M |
| 7000000561|SRS057355_LANL_scaffold_40971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1887 | Open in IMG/M |
| 7000000563|C2625508 | All Organisms → Viruses → Predicted Viral | 2718 | Open in IMG/M |
| 7000000576|C4123271 | All Organisms → cellular organisms → Bacteria | 5737 | Open in IMG/M |
| 7000000599|C2620538 | Not Available | 587 | Open in IMG/M |
| 7000000604|SRS019894_WUGC_scaffold_9248 | All Organisms → Viruses | 43120 | Open in IMG/M |
| 7000000618|C3029880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 2423 | Open in IMG/M |
| 7000000656|C1354017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales | 1135 | Open in IMG/M |
| 7000000658|SRS018969_WUGC_scaffold_56897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1209 | Open in IMG/M |
| 7000000665|SRS016037_WUGC_scaffold_40989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 4388 | Open in IMG/M |
| 7000000665|SRS016037_WUGC_scaffold_43873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae | 4435 | Open in IMG/M |
| 7000000698|C3750397 | Not Available | 864 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human | 68.33% |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human | 15.83% |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human | 6.67% |
| Human Fecal | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal | 1.67% |
| Human Oral Cavity | Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity | 1.67% |
| Human Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated | 0.83% |
| Human Oral | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral | 0.83% |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human | 0.83% |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human | 0.83% |
| Human Oral | Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral | 0.83% |
| Human Oral | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral | 0.83% |
| Subgingival Plaque | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908012 | Human Subgingival plaque microbiome from visit number 1 of subject 763496533 | Host-Associated | Open in IMG/M |
| 3300006247 | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159005010 | Host-Associated | Open in IMG/M |
| 3300006248 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 246515023 | Host-Associated | Open in IMG/M |
| 3300006251 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159369152 | Host-Associated | Open in IMG/M |
| 3300006254 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339 | Host-Associated | Open in IMG/M |
| 3300006259 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765034022 | Host-Associated | Open in IMG/M |
| 3300006261 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764588959 | Host-Associated | Open in IMG/M |
| 3300006292 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352 | Host-Associated | Open in IMG/M |
| 3300006319 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764062976 | Host-Associated | Open in IMG/M |
| 3300006321 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160380657 | Host-Associated | Open in IMG/M |
| 3300006348 | Human supragingival plaque microbial communities from NIH, USA - visit 2 of subject 158802708 | Host-Associated | Open in IMG/M |
| 3300006457 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473 | Host-Associated | Open in IMG/M |
| 3300006460 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764143897 | Host-Associated | Open in IMG/M |
| 3300006477 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629 | Host-Associated | Open in IMG/M |
| 3300006489 | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809 | Host-Associated | Open in IMG/M |
| 3300006678 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010 | Host-Associated | Open in IMG/M |
| 3300007079 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 809635352 | Host-Associated | Open in IMG/M |
| 3300007096 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005 | Host-Associated | Open in IMG/M |
| 3300007125 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834 | Host-Associated | Open in IMG/M |
| 3300007128 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159207311 | Host-Associated | Open in IMG/M |
| 3300007135 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158458797 | Host-Associated | Open in IMG/M |
| 3300007186 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 246515023 | Host-Associated | Open in IMG/M |
| 3300007194 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656 | Host-Associated | Open in IMG/M |
| 3300007204 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826 | Host-Associated | Open in IMG/M |
| 3300007278 | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassembly | Host-Associated | Open in IMG/M |
| 3300007295 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassembly | Host-Associated | Open in IMG/M |
| 3300007300 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassembly | Host-Associated | Open in IMG/M |
| 3300007314 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 861967750 reassembly | Host-Associated | Open in IMG/M |
| 3300007316 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 reassembly | Host-Associated | Open in IMG/M |
| 3300007339 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassembly | Host-Associated | Open in IMG/M |
| 3300007648 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764588959 reassembly | Host-Associated | Open in IMG/M |
| 3300007736 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005 reassembly | Host-Associated | Open in IMG/M |
| 3300007753 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159591683 reassembly | Host-Associated | Open in IMG/M |
| 3300007869 | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764305738 reassembly | Host-Associated | Open in IMG/M |
| 3300007971 | Human saliva microbial communities from NIH, USA - visit 2, subject 763496533 reassembly | Host-Associated | Open in IMG/M |
| 3300007996 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765620695 reassembly | Host-Associated | Open in IMG/M |
| 3300008099 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 reassembly | Host-Associated | Open in IMG/M |
| 3300008125 | Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994 reassembly | Host-Associated | Open in IMG/M |
| 3300008128 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159713063 reassembly | Host-Associated | Open in IMG/M |
| 3300008133 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassembly | Host-Associated | Open in IMG/M |
| 3300008138 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764892411 reassembly | Host-Associated | Open in IMG/M |
| 3300008143 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257 reassembly | Host-Associated | Open in IMG/M |
| 3300008147 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1 reassembly | Host-Associated | Open in IMG/M |
| 3300008270 | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159369152 reassembly | Host-Associated | Open in IMG/M |
| 3300008274 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764042746 reassembly | Host-Associated | Open in IMG/M |
| 3300008279 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 338793263 reassembly | Host-Associated | Open in IMG/M |
| 3300008305 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly | Host-Associated | Open in IMG/M |
| 3300008333 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 508703490 reassembly | Host-Associated | Open in IMG/M |
| 3300008403 | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746 reassembly | Host-Associated | Open in IMG/M |
| 3300008436 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937 reassembly | Host-Associated | Open in IMG/M |
| 3300008472 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159551223 reassembly | Host-Associated | Open in IMG/M |
| 3300008518 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 reassembly | Host-Associated | Open in IMG/M |
| 3300008556 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159591683 reassembly | Host-Associated | Open in IMG/M |
| 3300008626 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809 reassembly | Host-Associated | Open in IMG/M |
| 3300008660 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 604812005 reassembly | Host-Associated | Open in IMG/M |
| 3300008732 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913 reassembly | Host-Associated | Open in IMG/M |
| 3300008739 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003 reassembly | Host-Associated | Open in IMG/M |
| 3300009954 | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 6 | Host-Associated | Open in IMG/M |
| 3300009961 | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 14 | Host-Associated | Open in IMG/M |
| 3300011967 | Human oral microbial communities from Los Angeles, CA, USA - S03-01-D | Host-Associated | Open in IMG/M |
| 3300011982 | Human oral microbial communities from Beijing, China - VLP3 | Host-Associated | Open in IMG/M |
| 3300014108 | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_024 | Host-Associated | Open in IMG/M |
| 3300014951 | Human fecal microbial communities from infant at 12 months in Denmark - 599_12M | Host-Associated | Open in IMG/M |
| 3300029479 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001894-56 | Host-Associated | Open in IMG/M |
| 3300029679 | Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-50_Run5 | Host-Associated | Open in IMG/M |
| 7000000005 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352 | Host-Associated | Open in IMG/M |
| 7000000009 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160380657 | Host-Associated | Open in IMG/M |
| 7000000016 | Human supragingival plaque microbial communities from NIH, USA - visit 2 of subject 158802708 | Host-Associated | Open in IMG/M |
| 7000000025 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010 | Host-Associated | Open in IMG/M |
| 7000000027 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764143897 | Host-Associated | Open in IMG/M |
| 7000000029 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809 | Host-Associated | Open in IMG/M |
| 7000000033 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473 | Host-Associated | Open in IMG/M |
| 7000000039 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159369152 | Host-Associated | Open in IMG/M |
| 7000000042 | Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629 | Host-Associated | Open in IMG/M |
| 7000000051 | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809 | Host-Associated | Open in IMG/M |
| 7000000086 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159227541 | Host-Associated | Open in IMG/M |
| 7000000099 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005 | Host-Associated | Open in IMG/M |
| 7000000110 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158458797 | Host-Associated | Open in IMG/M |
| 7000000128 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834 | Host-Associated | Open in IMG/M |
| 7000000132 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158337416 | Host-Associated | Open in IMG/M |
| 7000000140 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656 | Host-Associated | Open in IMG/M |
| 7000000144 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 246515023 | Host-Associated | Open in IMG/M |
| 7000000159 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 809635352 | Host-Associated | Open in IMG/M |
| 7000000180 | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532 | Host-Associated | Open in IMG/M |
| 7000000195 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 | Host-Associated | Open in IMG/M |
| 7000000197 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 | Host-Associated | Open in IMG/M |
| 7000000203 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 | Host-Associated | Open in IMG/M |
| 7000000222 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 861967750 | Host-Associated | Open in IMG/M |
| 7000000276 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339 | Host-Associated | Open in IMG/M |
| 7000000295 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765034022 | Host-Associated | Open in IMG/M |
| 7000000301 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764588959 | Host-Associated | Open in IMG/M |
| 7000000313 | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005 | Host-Associated | Open in IMG/M |
| 7000000394 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765620695 | Host-Associated | Open in IMG/M |
| 7000000402 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159591683 | Host-Associated | Open in IMG/M |
| 7000000436 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809 | Host-Associated | Open in IMG/M |
| 7000000457 | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159571453 | Host-Associated | Open in IMG/M |
| 7000000488 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 2 | Host-Associated | Open in IMG/M |
| 7000000504 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913 | Host-Associated | Open in IMG/M |
| 7000000513 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003 | Host-Associated | Open in IMG/M |
| 7000000519 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356 | Host-Associated | Open in IMG/M |
| 7000000523 | Human palatine tonsils microbial communities from NIH, USA - visit 2, subject 763496533 | Host-Associated | Open in IMG/M |
| 7000000537 | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159369152 | Host-Associated | Open in IMG/M |
| 7000000553 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764042746 | Host-Associated | Open in IMG/M |
| 7000000561 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675 | Host-Associated | Open in IMG/M |
| 7000000563 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 | Host-Associated | Open in IMG/M |
| 7000000576 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257 | Host-Associated | Open in IMG/M |
| 7000000599 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1 | Host-Associated | Open in IMG/M |
| 7000000604 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764892411 | Host-Associated | Open in IMG/M |
| 7000000618 | Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994 | Host-Associated | Open in IMG/M |
| 7000000656 | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746 | Host-Associated | Open in IMG/M |
| 7000000658 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764305738 | Host-Associated | Open in IMG/M |
| 7000000665 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 | Host-Associated | Open in IMG/M |
| 7000000698 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159551223 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| sp300_01223590 | 2124908012 | Subgingival Plaque | MSSNQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR |
| Ga0099374_100002888 | 3300006247 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0099387_100003100 | 3300006248 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0099392_1026913 | 3300006251 | Human | MNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0099365_100003960 | 3300006254 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKVQK* |
| Ga0099458_10011675 | 3300006259 | Human | MNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKGQK* |
| Ga0099521_100001149 | 3300006261 | Human | MESLLRLRVVNNKQTEHELSELYEKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0099622_1003183 | 3300006292 | Human | MSKEQAEHELAELYEPERSLEKALERVRERIRETINYTNKNKAAR* |
| Ga0099581_10021910 | 3300006319 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0099581_10022365 | 3300006319 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKV* |
| Ga0099624_10022816 | 3300006321 | Human | MASSLMYFIRSMRMGSLSRLKMNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0099694_10066412 | 3300006348 | Human | MTNNKQAEHELAELHEKERSLEKALELVRERIRELVNYTDKNKEQK* |
| Ga0100214_10016337 | 3300006457 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKSAR* |
| Ga0100061_10009812 | 3300006460 | Human | MKKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKG* |
| Ga0100232_1178762 | 3300006477 | Human | MEKEHAEHELSELHEKERSLEKALEIVREKIRELVNYTDKNKVQK* |
| Ga0100254_1002319 | 3300006489 | Human | MNREQVEHELAELHEKERSLEKAIELVREKIRELVNYTDKNKG* |
| Ga0100058_10024421 | 3300006678 | Human | MNKEQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0104033_10037336 | 3300007079 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0102538_10280012 | 3300007096 | Human | LGERMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK* |
| Ga0102700_100024021 | 3300007125 | Human | MNKEQAEHELAELHEKERSLEKALEIVREKIRELINYTDKNKG* |
| Ga0102700_10116701 | 3300007125 | Human | MEKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0102725_10008166 | 3300007128 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGRK* |
| Ga0102639_10000459 | 3300007135 | Human | MNKEQVEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0103259_1091355 | 3300007186 | Human | MESLLRLRMTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0103269_10034658 | 3300007194 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKG* |
| Ga0103275_100003124 | 3300007204 | Human | MSSNQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0104339_1044821 | 3300007278 | Human | MNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV* |
| Ga0104867_100106313 | 3300007295 | Human | MEKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGNNNETKF* |
| Ga0104843_10019310 | 3300007300 | Human | MNKETEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKV* |
| Ga0104968_10022057 | 3300007314 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK* |
| Ga0104922_1030526 | 3300007316 | Human | MEKEQAEHELAELHAQERSLEKALELVREKIRELINYADKNKGQK* |
| Ga0104971_10008164 | 3300007339 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK* |
| Ga0105531_10049743 | 3300007648 | Human | MEKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKVHK* |
| Ga0105757_100008115 | 3300007736 | Human | MNKEQTEHELAELHEKERSLEKALELVREKIRELVNCTDKNKAAR* |
| Ga0105778_10065211 | 3300007753 | Human | MNKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0111024_1016184 | 3300007869 | Human | MNKETEHELAELYAQERSLEKALELVREKIRELVNYMDKNKEQK* |
| Ga0114094_10294191 | 3300007971 | Human | MNKEQAEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0111052_10188310 | 3300007996 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKVYK* |
| Ga0114261_1058957 | 3300008099 | Human | MNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0114856_10105849 | 3300008125 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK* |
| Ga0114847_1140713 | 3300008128 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0111365_10023855 | 3300008133 | Human | MNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK* |
| Ga0111365_1457082 | 3300008133 | Human | KEQTEHELAELHEKEQSLEKALEIVREKIRELINYTNKNKAAR* |
| Ga0114843_10016562 | 3300008138 | Human | MEKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK* |
| Ga0114287_1003189 | 3300008143 | Human | MEKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK* |
| Ga0114367_1019397 | 3300008147 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK* |
| Ga0114159_1010312 | 3300008270 | Human | MNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTNKNKV* |
| Ga0114252_1028406 | 3300008274 | Human | MNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK* |
| Ga0114263_100121410 | 3300008279 | Human | MNKETEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKV* |
| Ga0115183_1000747 | 3300008305 | Human | MEKETEHELAELHEKERSLEKTLELVREKIRELVNYTNKNKGQK* |
| Ga0115302_10008727 | 3300008333 | Human | MNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0115302_10112118 | 3300008333 | Human | MNKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKGNNNGAKF* |
| Ga0115182_10060219 | 3300008403 | Human | MNKEQAEHELAELHEKERSLEKALELVRERIRETINYTNKNKAAR* |
| Ga0115418_10027156 | 3300008436 | Human | MNKEQLEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKV* |
| Ga0115373_10277882 | 3300008472 | Human | MNKEAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0115191_10021750 | 3300008518 | Human | MEKEQAEHELAELHAQERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0111059_1029693 | 3300008556 | Human | MNKEQAEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKEQK* |
| Ga0111364_10020255 | 3300008626 | Human | MNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKV* |
| Ga0111492_10284413 | 3300008660 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK* |
| Ga0113984_1033117 | 3300008732 | Human | MGKEQLERELAGLHEKERSLEKALELVREKIRELVNYTDKNKG* |
| Ga0114021_1355543 | 3300008739 | Human | MNKEQAEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKGQK* |
| Ga0133740_1001035 | 3300009954 | Human Oral Cavity | MNKEHVEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0133745_101655 | 3300009961 | Human Oral Cavity | MEKEQAKHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK* |
| Ga0119781_1169063 | 3300011967 | Human Oral | MTNNKQAEHELAELHGKERSLEKALELVREKIRELINYTNKNKAAR* |
| Ga0119773_10061326 | 3300011982 | Human Oral | MEKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0134359_10079934 | 3300014108 | Human Oral | MNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTDKNKEQK* |
| Ga0169829_10026582 | 3300014951 | Human Host-Associated | MNKEQAEHELAELHEQERSLEKALELVREKIRELVNYTDKNKVQK* |
| Ga0244137_10025956 | 3300029479 | Human Fecal | MNKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV |
| Ga0243220_1034446 | 3300029679 | Human Fecal | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| SRS022536_LANL_scaffold_112765__gene_248323 | 7000000005 | Human | MSKEQAEHELAELYEPERSLEKALERVRERIRETINYTNKNKAAR |
| SRS018300_Baylor_scaffold_43448__gene_60719 | 7000000009 | Human | MNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK |
| SRS023538_Baylor_scaffold_41056__gene_63404 | 7000000016 | Human | MTNNKQAEHELAELHEKERSLEKALELVRERIRELVNYTDKNKEQK |
| SRS023617_Baylor_scaffold_29664__gene_39658 | 7000000025 | Human | MNKEQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| C2568910__gene_152009 | 7000000027 | Human | MKKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKG |
| SRS042131_WUGC_scaffold_53336__gene_89072 | 7000000029 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKV |
| SRS019333_WUGC_scaffold_16267__gene_16489 | 7000000033 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKSAR |
| C2361491__gene_144294 | 7000000039 | Human | MNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| C3788548__gene_136808 | 7000000042 | Human | MEKEHAEHELSELHEKERSLEKALEIVREKIRELVNYTDKNKVQK |
| C1816283__gene_26542 | 7000000051 | Human | MNREQVEHELAELHEKERSLEKAIELVREKIRELVNYTDKNKG |
| C4112281__gene_133372 | 7000000086 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK |
| C3289035__gene_127235 | 7000000099 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK |
| SRS011098_Baylor_scaffold_27433__gene_34929 | 7000000110 | Human | MNKEQVEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR |
| SRS050244_LANL_scaffold_36247__gene_42415 | 7000000128 | Human | MEKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKV |
| SRS012285_Baylor_scaffold_55315__gene_70631 | 7000000132 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR |
| SRS044373_WUGC_scaffold_60621__gene_82574 | 7000000140 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKG |
| C4869098__gene_221338 | 7000000144 | Human | MTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| SRS063288_LANL_scaffold_63181__gene_109841 | 7000000159 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV |
| SRS017013_Baylor_scaffold_23037__gene_27330 | 7000000180 | Human | MNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV |
| SRS017013_Baylor_scaffold_23698__gene_28922 | 7000000180 | Human | MEKEQAEHELAELHEQERSLEKALELVREKIRELVNYTNKNKG |
| SRS017209_Baylor_scaffold_24281__gene_31182 | 7000000195 | Human | MEKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGNNNETKF |
| SRS017808_Baylor_scaffold_3102__gene_3131 | 7000000197 | Human | MNKETEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKV |
| SRS024441_LANL_scaffold_56521__gene_77795 | 7000000203 | Human | MEKEQAEHELAELHAQERSLEKALELVREKIRELINYADKNKGQK |
| SRS057539_LANL_scaffold_23351__gene_29452 | 7000000222 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| SRS054687_LANL_scaffold_48704__gene_44341 | 7000000276 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKVQK |
| SRS019219_WUGC_scaffold_66328__gene_101238 | 7000000295 | Human | MNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKGQK |
| SRS016092_WUGC_scaffold_6431__gene_8416 | 7000000301 | Human | VNNKQTEHELSELYEKERSLEKALELVREKIRELINYTNKNKAAR |
| SRS058053_LANL_scaffold_56837__gene_58024 | 7000000313 | Human | MNKEQTEHELAELHEKERSLEKALELVREKIRELVNCTDKNKAAR |
| SRS019607_WUGC_scaffold_57356__gene_80981 | 7000000394 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKVYK |
| SRS024580_LANL_scaffold_42492__gene_51415 | 7000000402 | Human | MNKEQAEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKEQK |
| SRS015644_WUGC_scaffold_3027__gene_4361 | 7000000436 | Human | MNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKV |
| C3994762__gene_180581 | 7000000457 | Human | MEKETEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR |
| SRS016529_Baylor_scaffold_4770__gene_4986 | 7000000488 | Human | MEKETEHELAELHEKERSLEKTLELVREKIRELVNYTNKNKGQK |
| C2689454__gene_80150 | 7000000504 | Human | MGKEQLERELAGLHEKERSLEKALELVREKIRELVNYTDKNKG |
| C2450981__gene_164689 | 7000000513 | Human | MNKEQAEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKGQK |
| SRS018357_Baylor_scaffold_41345__gene_42681 | 7000000519 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNK |
| SRS019126_WUGC_scaffold_42151__gene_65113 | 7000000523 | Human | MNKEQAEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKEQK |
| C1180083__gene_34156 | 7000000537 | Human | MNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTNKNKV |
| C2408155__gene_106003 | 7000000553 | Human | MNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| SRS057355_LANL_scaffold_33617__gene_26636 | 7000000561 | Human | HELAELHEKERSLEKALELVREKIRELVNYTDKNKRG |
| SRS057355_LANL_scaffold_40971__gene_35529 | 7000000561 | Human | HELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| C2625508__gene_110055 | 7000000563 | Human | MNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV |
| C4123271__gene_196745 | 7000000576 | Human | MEKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| C2620538__gene_110836 | 7000000599 | Human | MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK |
| SRS019894_WUGC_scaffold_9248__gene_8827 | 7000000604 | Human | MEKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK |
| C3029880__gene_213861 | 7000000618 | Human | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| C1354017__gene_75520 | 7000000656 | Human | MNKEQAEHELAELHEKERSLEKALELVRERIRETINYTNKNKAAR |
| SRS018969_WUGC_scaffold_56897__gene_45916 | 7000000658 | Human | TEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK |
| SRS016037_WUGC_scaffold_40989__gene_65752 | 7000000665 | Human | QAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| SRS016037_WUGC_scaffold_43873__gene_74084 | 7000000665 | Human | QAEHELAELHAQERSLEKALELVREKIRELINYTNKNKAAR |
| C3750397__gene_184451 | 7000000698 | Human | MNKEAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR |
| ⦗Top⦘ |