


| Basic Information | |
|---|---|
| Family ID | F070135 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ALNIPLDNNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ |
| Number of Associated Samples | 54 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 10.57 % |
| % of genes near scaffold ends (potentially truncated) | 89.43 % |
| % of genes from short scaffolds (< 2000 bps) | 89.43 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.724 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (30.081 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (32.520 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.41% β-sheet: 20.27% Coil/Unstructured: 74.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 1.63 |
| PF00144 | Beta-lactamase | 1.63 |
| PF00884 | Sulfatase | 1.63 |
| PF03928 | HbpS-like | 1.63 |
| PF13205 | Big_5 | 1.63 |
| PF13356 | Arm-DNA-bind_3 | 0.81 |
| PF03693 | ParD_antitoxin | 0.81 |
| PF13727 | CoA_binding_3 | 0.81 |
| PF04055 | Radical_SAM | 0.81 |
| PF00078 | RVT_1 | 0.81 |
| PF12694 | cpYpsA | 0.81 |
| PF00793 | DAHP_synth_1 | 0.81 |
| PF12625 | Arabinose_bd | 0.81 |
| PF13186 | SPASM | 0.81 |
| PF09037 | Sulphotransf | 0.81 |
| PF02630 | SCO1-SenC | 0.81 |
| PF13533 | Biotin_lipoyl_2 | 0.81 |
| PF13683 | rve_3 | 0.81 |
| PF12850 | Metallophos_2 | 0.81 |
| PF07508 | Recombinase | 0.81 |
| PF00657 | Lipase_GDSL | 0.81 |
| PF00171 | Aldedh | 0.81 |
| PF07396 | Porin_O_P | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.63 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.63 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.63 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.63 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.63 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.63 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.63 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.63 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.81 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| COG4424 | LPS sulfotransferase NodH | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.72 % |
| All Organisms | root | All Organisms | 42.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003847|Ga0055582_1010109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1796 | Open in IMG/M |
| 3300003988|Ga0055475_10080798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300004007|Ga0055476_10012948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2464 | Open in IMG/M |
| 3300004055|Ga0055480_10239544 | Not Available | 734 | Open in IMG/M |
| 3300004064|Ga0055479_10158380 | Not Available | 827 | Open in IMG/M |
| 3300004064|Ga0055479_10247004 | Not Available | 664 | Open in IMG/M |
| 3300004064|Ga0055479_10387381 | Not Available | 528 | Open in IMG/M |
| 3300004065|Ga0055481_10165133 | Not Available | 941 | Open in IMG/M |
| 3300004076|Ga0055522_10024971 | Not Available | 1048 | Open in IMG/M |
| 3300004113|Ga0065183_10370666 | Not Available | 676 | Open in IMG/M |
| 3300004113|Ga0065183_10774501 | Not Available | 510 | Open in IMG/M |
| 3300004148|Ga0055521_10160521 | Not Available | 603 | Open in IMG/M |
| 3300005588|Ga0070728_10341467 | Not Available | 803 | Open in IMG/M |
| 3300005588|Ga0070728_10353698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300005588|Ga0070728_10684820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005588|Ga0070728_10711751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Tahibacter → unclassified Tahibacter → Tahibacter sp. P2K | 514 | Open in IMG/M |
| 3300005589|Ga0070729_10387133 | Not Available | 776 | Open in IMG/M |
| 3300005589|Ga0070729_10588094 | Not Available | 604 | Open in IMG/M |
| 3300005590|Ga0070727_10334991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300005590|Ga0070727_10578261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005590|Ga0070727_10728910 | Not Available | 556 | Open in IMG/M |
| 3300005590|Ga0070727_10804786 | Not Available | 527 | Open in IMG/M |
| 3300005601|Ga0070722_10209922 | Not Available | 805 | Open in IMG/M |
| 3300005601|Ga0070722_10248321 | Not Available | 747 | Open in IMG/M |
| 3300005609|Ga0070724_10119288 | Not Available | 1139 | Open in IMG/M |
| 3300005609|Ga0070724_10229745 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005943|Ga0073926_10048426 | Not Available | 820 | Open in IMG/M |
| 3300006421|Ga0082247_10081750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium | 526 | Open in IMG/M |
| 3300006467|Ga0099972_11040982 | Not Available | 2440 | Open in IMG/M |
| 3300006467|Ga0099972_13151095 | Not Available | 617 | Open in IMG/M |
| 3300007102|Ga0102541_1199482 | Not Available | 589 | Open in IMG/M |
| 3300009033|Ga0102956_1303425 | Not Available | 551 | Open in IMG/M |
| 3300009145|Ga0102961_1113758 | Not Available | 700 | Open in IMG/M |
| 3300009145|Ga0102961_1205753 | Not Available | 552 | Open in IMG/M |
| 3300010234|Ga0136261_1089532 | Not Available | 662 | Open in IMG/M |
| 3300010392|Ga0118731_100245025 | All Organisms → cellular organisms → Bacteria | 5531 | Open in IMG/M |
| 3300010392|Ga0118731_100762795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300010392|Ga0118731_101952156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
| 3300010392|Ga0118731_103170946 | Not Available | 777 | Open in IMG/M |
| 3300010392|Ga0118731_104873664 | Not Available | 658 | Open in IMG/M |
| 3300010392|Ga0118731_106772704 | Not Available | 748 | Open in IMG/M |
| 3300010392|Ga0118731_107474623 | Not Available | 552 | Open in IMG/M |
| 3300010392|Ga0118731_108197749 | Not Available | 572 | Open in IMG/M |
| 3300010392|Ga0118731_108223756 | Not Available | 1274 | Open in IMG/M |
| 3300010392|Ga0118731_110121966 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Heteroconchia → Euheterodonta → Imparidentia → Neoheterodontei → Myida → Pholadoidea → Teredinidae → Bankia → Bankia setacea | 1055 | Open in IMG/M |
| 3300010392|Ga0118731_110459319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Halioglobus → unclassified Halioglobus → Halioglobus sp. | 654 | Open in IMG/M |
| 3300010392|Ga0118731_110674062 | Not Available | 823 | Open in IMG/M |
| 3300010392|Ga0118731_112349733 | Not Available | 511 | Open in IMG/M |
| 3300010392|Ga0118731_112780268 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010392|Ga0118731_114057751 | Not Available | 548 | Open in IMG/M |
| 3300010392|Ga0118731_114870669 | Not Available | 601 | Open in IMG/M |
| 3300010392|Ga0118731_114959074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1817 | Open in IMG/M |
| 3300010430|Ga0118733_100969073 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300010430|Ga0118733_101284980 | Not Available | 1460 | Open in IMG/M |
| 3300010430|Ga0118733_101996457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1153 | Open in IMG/M |
| 3300010430|Ga0118733_102098488 | Not Available | 1122 | Open in IMG/M |
| 3300010430|Ga0118733_103465274 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010430|Ga0118733_104328505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300010430|Ga0118733_104573125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300010430|Ga0118733_104931061 | Not Available | 707 | Open in IMG/M |
| 3300010430|Ga0118733_105684996 | Not Available | 655 | Open in IMG/M |
| 3300010430|Ga0118733_106090295 | Not Available | 632 | Open in IMG/M |
| 3300010430|Ga0118733_106338887 | Not Available | 618 | Open in IMG/M |
| 3300010430|Ga0118733_106582467 | Not Available | 606 | Open in IMG/M |
| 3300010430|Ga0118733_108037524 | Not Available | 546 | Open in IMG/M |
| 3300010430|Ga0118733_108177085 | Not Available | 541 | Open in IMG/M |
| 3300010430|Ga0118733_109105013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae | 512 | Open in IMG/M |
| 3300010993|Ga0139329_120377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300014305|Ga0075349_1171908 | Not Available | 518 | Open in IMG/M |
| 3300019704|Ga0193979_1013270 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300019736|Ga0194019_1061889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Methylonatrum → Methylonatrum kenyense | 538 | Open in IMG/M |
| 3300019748|Ga0194018_1034125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300019753|Ga0194010_1121993 | Not Available | 504 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10031264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Halioglobus → unclassified Halioglobus → Halioglobus sp. | 1238 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10560140 | Not Available | 549 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10165150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 849 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10360881 | Not Available | 592 | Open in IMG/M |
| 3300025599|Ga0210074_1125475 | Not Available | 678 | Open in IMG/M |
| 3300025814|Ga0210101_1087007 | Not Available | 824 | Open in IMG/M |
| 3300025883|Ga0209456_10000820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 15792 | Open in IMG/M |
| 3300025883|Ga0209456_10327349 | Not Available | 630 | Open in IMG/M |
| 3300025883|Ga0209456_10327436 | Not Available | 630 | Open in IMG/M |
| 3300027758|Ga0209379_10024332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Bathymodiolus japonicus methanotrophic gill symbiont | 2494 | Open in IMG/M |
| 3300027758|Ga0209379_10273944 | Not Available | 569 | Open in IMG/M |
| 3300027758|Ga0209379_10280844 | Not Available | 560 | Open in IMG/M |
| 3300027790|Ga0209273_10035288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2368 | Open in IMG/M |
| 3300027790|Ga0209273_10114119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300027820|Ga0209578_10055914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas | 2005 | Open in IMG/M |
| 3300027828|Ga0209692_10435594 | Not Available | 555 | Open in IMG/M |
| 3300027917|Ga0209536_100341085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1874 | Open in IMG/M |
| 3300027978|Ga0209165_10333693 | Not Available | 505 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10148711 | Not Available | 1035 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10228090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300028598|Ga0265306_10526911 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin11 | 649 | Open in IMG/M |
| 3300028598|Ga0265306_10701205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300028598|Ga0265306_10768410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria | 533 | Open in IMG/M |
| 3300028599|Ga0265309_10006665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5494 | Open in IMG/M |
| 3300028599|Ga0265309_10044004 | Not Available | 2459 | Open in IMG/M |
| 3300028599|Ga0265309_10331090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 985 | Open in IMG/M |
| 3300028600|Ga0265303_10039959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3260 | Open in IMG/M |
| 3300028600|Ga0265303_10204392 | Not Available | 1511 | Open in IMG/M |
| 3300028600|Ga0265303_10274632 | Not Available | 1310 | Open in IMG/M |
| 3300028600|Ga0265303_10612613 | Not Available | 883 | Open in IMG/M |
| 3300028600|Ga0265303_10794840 | Not Available | 776 | Open in IMG/M |
| 3300028600|Ga0265303_11299775 | Not Available | 606 | Open in IMG/M |
| 3300032136|Ga0316201_10040318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae | 4040 | Open in IMG/M |
| 3300032136|Ga0316201_10433948 | Not Available | 1130 | Open in IMG/M |
| 3300032136|Ga0316201_11608242 | Not Available | 537 | Open in IMG/M |
| 3300032251|Ga0316198_10755666 | Not Available | 518 | Open in IMG/M |
| 3300032252|Ga0316196_10366370 | Not Available | 620 | Open in IMG/M |
| 3300032258|Ga0316191_10089538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 2257 | Open in IMG/M |
| 3300032258|Ga0316191_10357248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300032258|Ga0316191_10545488 | Not Available | 843 | Open in IMG/M |
| 3300032258|Ga0316191_11138992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 564 | Open in IMG/M |
| 3300032259|Ga0316190_10640241 | Not Available | 708 | Open in IMG/M |
| 3300032260|Ga0316192_10317704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300032262|Ga0316194_10190820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae | 1313 | Open in IMG/M |
| 3300032262|Ga0316194_10459045 | Not Available | 804 | Open in IMG/M |
| 3300032272|Ga0316189_10157851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1812 | Open in IMG/M |
| 3300032272|Ga0316189_11163309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300033429|Ga0316193_10116581 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300033429|Ga0316193_10656583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300033429|Ga0316193_10769301 | Not Available | 767 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 30.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 15.45% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 9.76% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 8.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 8.94% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 5.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.88% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.25% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.44% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.81% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.81% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.81% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003847 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 | Environmental | Open in IMG/M |
| 3300004055 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 | Environmental | Open in IMG/M |
| 3300004064 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 | Environmental | Open in IMG/M |
| 3300004065 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 | Environmental | Open in IMG/M |
| 3300004076 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006421 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010993 | ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300019704 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_0-1_MG | Environmental | Open in IMG/M |
| 3300019736 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_5-6_MG | Environmental | Open in IMG/M |
| 3300019748 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_4-5_MG | Environmental | Open in IMG/M |
| 3300019753 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MG | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055582_10101093 | 3300003847 | Pelagic Marine | MFSCDGSGSYALNIPLDNNGQFKLQVYADGFAPTIQTFEEFKTTNNVRMARAVECQ* |
| Ga0055475_100807981 | 3300003988 | Natural And Restored Wetlands | PLDTNGQFKLQVYADGFAPTIQRFDEFQATNDVRMARAVECQ* |
| Ga0055476_100129483 | 3300004007 | Natural And Restored Wetlands | SYALNIPLDTNGQFKLQVYADGFAPTIRTFDEFQATNDVRMARAVECQ* |
| Ga0055480_102395442 | 3300004055 | Natural And Restored Wetlands | SGNYNLHIPLDSNGQYKLQVYADGFAPYIVQKDMTQLTNTIRLAKASECS* |
| Ga0055479_101583801 | 3300004064 | Natural And Restored Wetlands | QHMYSCDLLGSYALNIPLDSNGQYKLQVYADGFAPMIQKFDEFKTLNDVRMTRAVEC* |
| Ga0055479_102470041 | 3300004064 | Natural And Restored Wetlands | YALNIPLDSNGQYKLQVYADGFAPITQKFDEFSTSSDVRMARAVECQ* |
| Ga0055479_103873811 | 3300004064 | Natural And Restored Wetlands | NIPLDNSGQFKLQVYADGFAPTIQIFDEFKTTNNVRMARAAECQ* |
| Ga0055481_101651331 | 3300004065 | Natural And Restored Wetlands | DRNGQFKLQVYADGFAPTIQVFDEFSPVNIVRMARAVECQ* |
| Ga0055522_100249711 | 3300004076 | Natural And Restored Wetlands | NGTGSYALNIPLDSNGQFKLQVYADGFAPTIQTFDEYQAKNDVRMTRAAECQAP* |
| Ga0065183_103706662 | 3300004113 | Pelagic Marine | SCDGTGSYALNIPLDNNGQFKLQVYADGFAPTIQTFDEFQAINDVRMARAVECQ* |
| Ga0065183_107745012 | 3300004113 | Pelagic Marine | LVNGQFTFSCDASGSYALNIPLDTNGQVKLQVYGDGFAPTVLTFDEFSPNNDVRMARAVECQ* |
| Ga0055521_101605211 | 3300004148 | Natural And Restored Wetlands | LNIPLDSNGQFKLQVYADGFAPTIQTFDEFSAVNDVRMTRAAECQAP* |
| Ga0070728_103414671 | 3300005588 | Marine Sediment | PLDENGQYKLQVYADGFVPSIQVFDEFQTVNDVRMTRAAECQ* |
| Ga0070728_103536981 | 3300005588 | Marine Sediment | GSYALNIPLDNNGQFKLQVYADGFAPTIQTFDEFQPINDVRMARAVECQ* |
| Ga0070728_106848201 | 3300005588 | Marine Sediment | KLQVYADGFAPVIQTFDAFQATNDIRMARAVECQAP* |
| Ga0070728_107117512 | 3300005588 | Marine Sediment | MFSCEGSGSYALNIPLDNDGQFKLQVYADGFAPMIQTFDEFKTTNNVRMARAVECQ* |
| Ga0070729_103871331 | 3300005589 | Marine Sediment | LDANGQFKLQVYADGFAPTIQTFDEFSLINDVRMARVVECQ* |
| Ga0070729_105880941 | 3300005589 | Marine Sediment | SGSYALNIPLDTNGQFKLQVYADGFAPTIQVFDEFRAINDVRMARAAECQ* |
| Ga0070727_103349911 | 3300005590 | Marine Sediment | YALNIPLDANGQFKLQVYADGFAPTVLRFDEFSVDNDVRMARAAECQ* |
| Ga0070727_105782611 | 3300005590 | Marine Sediment | LNIPLDNNGQFKLQVYADGFAPVIQTFDAFQATNDIRMARAVECQAP* |
| Ga0070727_107289101 | 3300005590 | Marine Sediment | NIPLDANGQFKLQVYADGFAPAIQRFDEFKPTTVVGMTRAVECQ* |
| Ga0070727_108047862 | 3300005590 | Marine Sediment | DNNGQYKLQVYADGFAPTIQLFDEFTPDVEVRLARAAECQ* |
| Ga0070722_102099221 | 3300005601 | Marine Sediment | QFKLQVYADGFAPTIQVFDEFRAINDVRMARAAECQ* |
| Ga0070722_102483211 | 3300005601 | Marine Sediment | KLQVYADGFAPITQRFDEFQARNNVRMARAVECQ* |
| Ga0070724_101192882 | 3300005609 | Marine Sediment | NGQYKLQVYADGFVPSIQVFDEFQTVNDVRMTRAAECQ* |
| Ga0070724_102297451 | 3300005609 | Marine Sediment | MFSCEGSGSYALNIPLDNDGQFKLQVYADGFAPMIQTFDEFKTTNNVRM |
| Ga0073926_100484262 | 3300005943 | Sand | GNYALEFPLDSNGQFQLQVYADGFAPTVQTFDESDTGGDVRMAPSAECQ* |
| Ga0082247_100817501 | 3300006421 | Sediment | QFKLQVYADGFAPYTSHFDDSKVVNDVRMARAAECN* |
| Ga0099972_110409824 | 3300006467 | Marine | DGSGSYALNIPLDTNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ* |
| Ga0099972_131510951 | 3300006467 | Marine | PLDTNGQFKLQVYADNFAPAIQTFDEFSPVNDVRMTHATECQ* |
| Ga0102541_11994821 | 3300007102 | Marine Sediment | NIPLDSNGQFKLQVYADGFAPTIQTFDEFHAMNDVRMARSSECQVQ* |
| Ga0102956_13034252 | 3300009033 | Soil | MQTYADGFAPTIRIFEEFSASNDMRMARAVECQAP* |
| Ga0102961_11137581 | 3300009145 | Soil | PLDNNGQFKLQVYADGFAPTIKSFDEFNPVNDIRMARAAECQ* |
| Ga0102961_12057531 | 3300009145 | Soil | QLQVYADGFAPTIQTFDEFHAMNDVRMARSSECQVQ* |
| Ga0136261_10895322 | 3300010234 | Freshwater | XYALNIPLDTNGQFKLQVYADGFAPITQKFDEFSAINDVRMARSVECQ* |
| Ga0118731_1002450254 | 3300010392 | Marine | LNIPLDTNGQFKLQVYADGFAPTIQVFDEFRAINDVRMARAAECQ* |
| Ga0118731_1007627952 | 3300010392 | Marine | IPLDTNGQFKLQVYADGFAPTIQNFDEFQAINDVRMPRATECQ* |
| Ga0118731_1019521561 | 3300010392 | Marine | ALNIPLDNNGQFKLQVYADGFAPTIQTFDEFQAVNDVRMARATECQTP* |
| Ga0118731_1031709461 | 3300010392 | Marine | NIPLDENGQFKLQVNADGFVPSIQRFDEFQTVNDVRMTRAAECQ* |
| Ga0118731_1048736642 | 3300010392 | Marine | NGQYNLQVYAAGFAPLVQRFDEFSPDLEVRLARATECQ* |
| Ga0118731_1067727041 | 3300010392 | Marine | PLDSNGQFKLQVYADGFAPTIQVFDMTQVTNKVRMARARECQTQ* |
| Ga0118731_1074746231 | 3300010392 | Marine | ALNIPLDTNGQFKLQVYADGSAPTILNFDEFSAVNDVRMARAVECQ* |
| Ga0118731_1081977491 | 3300010392 | Marine | KLQVYADGFAPTIQTFDEFKTTNDVRMARAAECQ* |
| Ga0118731_1082237561 | 3300010392 | Marine | ANGQFKLQVYADGFAPAIQRFDEFKPTTVVGMTRAVECQ* |
| Ga0118731_1101219663 | 3300010392 | Marine | QFKLQVYADGFAPTIQTYDEFKTTNNVRMARAAECQ* |
| Ga0118731_1104593191 | 3300010392 | Marine | GSYSLNIPLDNNGQFKLQVYADGFAPITQRFDDSSVMNDVRLARAAECQ* |
| Ga0118731_1106740621 | 3300010392 | Marine | NGQFKLQVYADGFAPTIQVLDKFQVDNDVRMARAAECQAQ* |
| Ga0118731_1123497331 | 3300010392 | Marine | FGFTCDSTGTYAATIPLDANGQYKLQVYADGFAPTIQHFDEFTTNVEVRLARAAECQ* |
| Ga0118731_1127802681 | 3300010392 | Marine | DGTGSYNLNIPLDGNGQYNLQVYAAGFAPLVQRFDEFSPDLDVRLARATECQ* |
| Ga0118731_1140577511 | 3300010392 | Marine | GQFKLQVYADGSAPTIQTFDEFNTVNDVRMARATECQ* |
| Ga0118731_1148706692 | 3300010392 | Marine | SCDATGSYALNIPLDANGQFKLQVYADGFAPAIQRFDEFKPTTVVGMTRAVECQ* |
| Ga0118731_1149590743 | 3300010392 | Marine | YKLQVYADGFAPMVQRFDEFSPDVVVRLARAAECQ* |
| Ga0118733_1009690733 | 3300010430 | Marine Sediment | GTGSYNLNIPLDGNGQYNLQVYAAGFAPLVQRFDEFSPDLDVRLARATECQ* |
| Ga0118733_1012849801 | 3300010430 | Marine Sediment | QFKLQVYADNFAPAIQTFDEFSPVNDVRMTHATECQ* |
| Ga0118733_1019964571 | 3300010430 | Marine Sediment | DGSGSYALNIPLDSNGQFKSQVYADGFAPTIQTFDEFSADNDVRMARSGECQAP* |
| Ga0118733_1020984881 | 3300010430 | Marine Sediment | GTGSYSGNIPLDANGQYKLQVYAEGFAPLVQAFDEFSPTVEVRLARATECQ* |
| Ga0118733_1034652741 | 3300010430 | Marine Sediment | GNYALNIPLDSNGQFKLQVYADGFAPMVQRFDEFSPDVEVRLARAAECQ* |
| Ga0118733_1043285052 | 3300010430 | Marine Sediment | GQFKLQVYADGFAPTIQRFDEFSPINDVRMARAVECQ* |
| Ga0118733_1045731251 | 3300010430 | Marine Sediment | FKLQVYADGFAPVTQKYDDRSVMNDVRMARAAECQ* |
| Ga0118733_1049310613 | 3300010430 | Marine Sediment | KYMFSCDGTGSYELNILLDSNGQFKLQVYADGFAPAIQTFDEFQAINDVRMARAVECQ* |
| Ga0118733_1056849961 | 3300010430 | Marine Sediment | KLQVYADGFAPYTARFDENKVANDAQMAPASECN* |
| Ga0118733_1060902951 | 3300010430 | Marine Sediment | IPLDNNGQFKLQVYADGFAPSIRKFDEFKTTNIVRMARAVECQ* |
| Ga0118733_1063388871 | 3300010430 | Marine Sediment | NYNMNIPLDANGQFKLQVYADGFAPYTSRFDESRLVNDVLMARASECK* |
| Ga0118733_1065824671 | 3300010430 | Marine Sediment | DNNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ* |
| Ga0118733_1080375242 | 3300010430 | Marine Sediment | IPLDNNGQFKLQVYADGFAPSIRTFDEFKTTNIVRMARAVECQ* |
| Ga0118733_1081770851 | 3300010430 | Marine Sediment | CDGTGTYAANIPLDANGQYKLQVYAQGFAPMVQRFDEFTPNVEARLARAAECQ* |
| Ga0118733_1091050132 | 3300010430 | Marine Sediment | VFSCNGSGTYSMNIPLDNNGQFKLQVYADGFAPITQKFDDSSLTNDVRLARAAECQ* |
| Ga0139329_1203771 | 3300010993 | Sediment | GTGNYGLNIPLDTNGQFKLQVYADGFAPITQKFDEFSANNDVRMARAVECQ* |
| Ga0075349_11719081 | 3300014305 | Natural And Restored Wetlands | GNYFLNIPLDGNGQFKLQVYADGFAPKVKSFDEFKRVNDVRLARASECN* |
| Ga0193979_10132701 | 3300019704 | Sediment | RYALNIPLDSKGQFKLQVYADGFAPSIGTFDEFKTTNIVRMARAIECQ |
| Ga0194019_10618891 | 3300019736 | Sediment | YALNIPLDSKGQFKLQVYADGFAPSIGTFDEFKTTNIVRMARAIECQ |
| Ga0194018_10341251 | 3300019748 | Sediment | GNYALNIPLDSNGQFKLQVYADGFAPITQKFDEFSANNDVRMARAVECQ |
| Ga0194010_11219931 | 3300019753 | Sediment | GSYSLKIPLDKNGQFKLQVYADGFAPSIQTFDEYKTTNDVRMARAVECL |
| (restricted) Ga0255042_100312642 | 3300024340 | Seawater | DDNGQFKLQVYADGFAPYTARFDENKVANDVRMARASECK |
| (restricted) Ga0255046_105601401 | 3300024519 | Seawater | SCDGTGSYDLHIPLNSNGQYKLQVYADGFAPAIQRFDEFSTNNTVKMTRAAECQAP |
| (restricted) Ga0255045_101651503 | 3300024528 | Seawater | SSGSYSLNIPLDNNGQFKLQVYADGFAPITQKFDDSSLTNDVRLARAAECQ |
| (restricted) Ga0255045_103608812 | 3300024528 | Seawater | NGQFKLQVYADGFAPSIRTFDEFKTTNIVRMARAIECQ |
| Ga0210074_11254751 | 3300025599 | Natural And Restored Wetlands | NIPLDNNGQFKLQVYADGFAPMIQTFDEFKASNNVRMARAVECQ |
| Ga0210101_10870071 | 3300025814 | Natural And Restored Wetlands | GQHMYSCDLLGSYALNIPLDSNGQYKLQVYADGFAPMIQKFDEFKTLNDVRMTRAVEC |
| Ga0209456_100008208 | 3300025883 | Pelagic Marine | MFSCDGSGSYALNIPLDNNGQFKLQVYADGFAPTIQTFEEFKTTNNVRMARAVECQ |
| Ga0209456_103273491 | 3300025883 | Pelagic Marine | FKLQVYADGFAPTIQTLDEFKTTNNVRMARAVERQ |
| Ga0209456_103274362 | 3300025883 | Pelagic Marine | YMFSCDGSGSYALNIPLDANGQFKLQVYADGFAAAIQVFDEFRAINDVRMTRAVECQ |
| Ga0209379_100243322 | 3300027758 | Marine Sediment | MFSCEGSGSYALNIPLDNDGQFKLQVYADGFAPMIQTFDEFKTTNNVRMARAVE |
| Ga0209379_102739443 | 3300027758 | Marine Sediment | DTNGQFKLQVYADGFAPTIQTFDEFQAINDVRMARAVECQ |
| Ga0209379_102808441 | 3300027758 | Marine Sediment | SYALNVPLDTNGQFKLQVYADGFAPTIQTFDEFKTTNNVRMARAVECQ |
| Ga0209273_100352883 | 3300027790 | Marine Sediment | MFSCEGSGSYALNIPLDNDGQFKLQVYADGFAPMIQTFDEFKTTNNVRMARAVECQ |
| Ga0209273_101141191 | 3300027790 | Marine Sediment | GQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ |
| Ga0209578_100559141 | 3300027820 | Marine Sediment | ALNIPLDNNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ |
| Ga0209692_104355942 | 3300027828 | Marine Sediment | SYAANIPLDANGQFKLQVYADGFAPTIQTFDEFSLINDVRMARVVECQ |
| Ga0209536_1003410854 | 3300027917 | Marine Sediment | SYAMNIPLDTNGQFKLQVYADGFAPITQKFDEFSTSNDVRMARAVECQ |
| Ga0209165_103336932 | 3300027978 | Marine Sediment | DANGQFKLQVNAAGFAPISQTFDEFQTINDVRLARVAECLPQ |
| (restricted) Ga0233414_101487111 | 3300028045 | Seawater | CDSSGSYALNIPLDNNGQFKLQVYADGFAPTIQTFDEFSVVNDVRMARATECQ |
| (restricted) Ga0233414_102280901 | 3300028045 | Seawater | ALNIPLDNNGQFKLQVYADGFAPTIQTFDEFKTTNNVRMARAAECQ |
| Ga0265306_105269112 | 3300028598 | Sediment | FKLQVYADGFAPTIQTFDEFSLINDVRMARVVECQ |
| Ga0265306_107012052 | 3300028598 | Sediment | QFTFSCNGSGSYALNIPLDNNGQFKLQVYADGFAPTIQTFDEFQAINDVRMARASECQ |
| Ga0265306_107684102 | 3300028598 | Sediment | FKLQVYADGFAPTIQLFDEFQVINDVRMARAAECL |
| Ga0265309_100066655 | 3300028599 | Sediment | NIPLDTNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ |
| Ga0265309_100440043 | 3300028599 | Sediment | MFSCDGSGSYAQNIPLDANGQFKLQVYTDGFAPTIQVFDEFSAVNDVRMTHNTECQ |
| Ga0265309_103310902 | 3300028599 | Sediment | ANIPLDANGQYKLQVYAEGFAPTVQVFDEFSPDNDVRLARAAEC |
| Ga0265303_100399595 | 3300028600 | Sediment | FSCAGSGSYALNIPLDASGQFKLQVYADGFAPTIQTFDEFQAVNDVRMARAVECQ |
| Ga0265303_102043922 | 3300028600 | Sediment | MFSCDGSGSYAQNIPLDANGQFKLQVYTDGYAPTIQVFDEFSAVNDVRMTHNTECQ |
| Ga0265303_102746323 | 3300028600 | Sediment | NGQFKLQVYADGFAPTIQTFDEFQAINDVRMARAVECQ |
| Ga0265303_106126133 | 3300028600 | Sediment | ALNIPLDSNGQFKLQVYADGFAPMIQTFDEFKTTNDVRMARATECQ |
| Ga0265303_107948401 | 3300028600 | Sediment | LNIPLDTNGQFKLQVYADSFAPTIRTFDEFQAINDVRMARASECQ |
| Ga0265303_112997751 | 3300028600 | Sediment | DGSGSYALNIPLDTNGQFKLQVYADGFAPMVQRFDEFSPDVEVRLARAAECQ |
| Ga0316201_100403181 | 3300032136 | Worm Burrow | KLQVYADGFAPTIQTFDEFQAINAVRMARAQECQAL |
| Ga0316201_104339483 | 3300032136 | Worm Burrow | MNIPLDSNVQFKLQVYADGFAPTIQKFNEFKTTNNVRMARAAECH |
| Ga0316201_116082421 | 3300032136 | Worm Burrow | SLNIPLDNNGQFKLQVYADGFAPTIQTFDEFQAINDVRMARAAECQ |
| Ga0316198_107556661 | 3300032251 | Sediment | KFSCDSTGSYAMNIPLDNNGQFKLQVYADGFAPVTQTFDELQAVNDVRMARATECQ |
| Ga0316196_103663701 | 3300032252 | Sediment | MASLNIPLDTNGQFKLQVYADGFAPITQKFDEFSASNDVRMARAVECQ |
| Ga0316191_100895382 | 3300032258 | Worm Burrow | VFSCDDTGSYAMNIPLDSNVQFKLQVYADGFAPTIQKFNEFKTTNNVRMARAAECH |
| Ga0316191_103572481 | 3300032258 | Worm Burrow | LDTNGQFKLQVYADGFAPITQKFDEFSTSNDVRMARAVECQ |
| Ga0316191_105454882 | 3300032258 | Worm Burrow | MASLNIPLDTNGQFKLQVYADGFAPITQKFDEFSTSNDVRMARA |
| Ga0316191_111389922 | 3300032258 | Worm Burrow | NGQFKLQVYADGFAPTIQTFDEFQAVNDVRMARAAECQTP |
| Ga0316190_106402413 | 3300032259 | Worm Burrow | MNIPLDNNGQFKLQVYADGFAPTIQIFDEFKAMNDVRMARASECQ |
| Ga0316192_103177041 | 3300032260 | Worm Burrow | SYALNIPLDNDGQFKLQVYADGFAPTIQTFDEFQAMNDVRMAQAVECQVP |
| Ga0316194_101908201 | 3300032262 | Sediment | NDGQFKLQVYADGFAPTIQTFDEFQAMNDVRMAQAVECQVP |
| Ga0316194_104590452 | 3300032262 | Sediment | MASLNIPLDTNGQFKLQVYADGFAPITQKFDEFSTSNDVRMARAVECQ |
| Ga0316189_101578511 | 3300032272 | Worm Burrow | AANIPLDANGQYKLQVYAQGFAPMVQRFDEFTPNVEARLARAAECQ |
| Ga0316189_111633091 | 3300032272 | Worm Burrow | PLDTNGQFKLQVYADGFAPTIQTFDEFQAINNVRMARASECQ |
| Ga0316193_101165811 | 3300033429 | Sediment | MCMASLNIPLDTNGQFKLQVYADGFAPITQKFDEFSASNDVRMARAVECQ |
| Ga0316193_106565831 | 3300033429 | Sediment | VNERACDGTGSYFLKIPLDNNGQFKLQVYADGFAPSIRTFDEFKTTNIVRMARAVECQ |
| Ga0316193_107693011 | 3300033429 | Sediment | NIPLDTNGQFKLQIYADGFAPTIQTFDEFQTINNVRMARATECQ |
| ⦗Top⦘ |