


| Basic Information | |
|---|---|
| Family ID | F068879 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 47 residues |
| Representative Sequence | NRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.16 % |
| % of genes from short scaffolds (< 2000 bps) | 84.68 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (83.064 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.161 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (89.516 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF05016 | ParE_toxin | 7.26 |
| PF03544 | TonB_C | 4.03 |
| PF05168 | HEPN | 3.23 |
| PF01909 | NTP_transf_2 | 3.23 |
| PF12849 | PBP_like_2 | 3.23 |
| PF13470 | PIN_3 | 1.61 |
| PF02698 | DUF218 | 1.61 |
| PF02661 | Fic | 1.61 |
| PF01381 | HTH_3 | 1.61 |
| PF02452 | PemK_toxin | 1.61 |
| PF13683 | rve_3 | 1.61 |
| PF05973 | Gp49 | 1.61 |
| PF02719 | Polysacc_synt_2 | 1.61 |
| PF07927 | HicA_toxin | 1.61 |
| PF00106 | adh_short | 0.81 |
| PF01555 | N6_N4_Mtase | 0.81 |
| PF00440 | TetR_N | 0.81 |
| PF13310 | Virulence_RhuM | 0.81 |
| PF05015 | HigB-like_toxin | 0.81 |
| PF09346 | SMI1_KNR4 | 0.81 |
| PF00665 | rve | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF13701 | DDE_Tnp_1_4 | 0.81 |
| PF13518 | HTH_28 | 0.81 |
| PF00872 | Transposase_mut | 0.81 |
| PF01527 | HTH_Tnp_1 | 0.81 |
| PF11731 | Cdd1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 4.03 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 3.23 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 3.23 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 3.23 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 3.23 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 3.23 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.61 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.61 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 1.61 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 1.61 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.81 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.81 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.81 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.81 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.81 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.97 % |
| Unclassified | root | N/A | 29.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000506|Soeholt_1017166 | Not Available | 2072 | Open in IMG/M |
| 3300004151|Ga0066602_10200954 | Not Available | 864 | Open in IMG/M |
| 3300006360|Ga0079079_1003966 | Not Available | 617 | Open in IMG/M |
| 3300006360|Ga0079079_1029668 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 521 | Open in IMG/M |
| 3300006386|Ga0079068_1020387 | Not Available | 948 | Open in IMG/M |
| 3300006387|Ga0079069_1066623 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Elizabethkingia → Elizabethkingia meningoseptica | 1384 | Open in IMG/M |
| 3300006387|Ga0079069_1074295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 562 | Open in IMG/M |
| 3300006388|Ga0079062_1046716 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
| 3300006389|Ga0079064_1065950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1065 | Open in IMG/M |
| 3300006395|Ga0079066_1044123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 804 | Open in IMG/M |
| 3300006431|Ga0099701_102844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1266 | Open in IMG/M |
| 3300006583|Ga0079077_1177058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 622 | Open in IMG/M |
| 3300006584|Ga0079086_1020623 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300006584|Ga0079086_1020796 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006584|Ga0079086_1021782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae | 3816 | Open in IMG/M |
| 3300006585|Ga0079082_1007671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 795 | Open in IMG/M |
| 3300006585|Ga0079082_1019194 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300006586|Ga0079087_1010732 | Not Available | 640 | Open in IMG/M |
| 3300006592|Ga0079076_1003884 | Not Available | 1564 | Open in IMG/M |
| 3300006593|Ga0079081_1020739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3993 | Open in IMG/M |
| 3300006593|Ga0079081_1035514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1128 | Open in IMG/M |
| 3300006594|Ga0079073_1017351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 839 | Open in IMG/M |
| 3300006595|Ga0079080_1005994 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006595|Ga0079080_1017433 | Not Available | 1740 | Open in IMG/M |
| 3300006595|Ga0079080_1025661 | Not Available | 500 | Open in IMG/M |
| 3300006596|Ga0079074_1022438 | Not Available | 590 | Open in IMG/M |
| 3300006597|Ga0079070_1029964 | Not Available | 602 | Open in IMG/M |
| 3300006598|Ga0079098_1003382 | Not Available | 587 | Open in IMG/M |
| 3300006601|Ga0079100_1013578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 752 | Open in IMG/M |
| 3300006601|Ga0079100_1017859 | Not Available | 596 | Open in IMG/M |
| 3300006640|Ga0075527_10189911 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 589 | Open in IMG/M |
| 3300006940|Ga0079099_1040364 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 804 | Open in IMG/M |
| 3300009009|Ga0105105_10117488 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp. | 1304 | Open in IMG/M |
| 3300009648|Ga0116175_1013662 | All Organisms → cellular organisms → Bacteria | 3569 | Open in IMG/M |
| 3300009652|Ga0123330_1112500 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 1036 | Open in IMG/M |
| 3300009652|Ga0123330_1127405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 951 | Open in IMG/M |
| 3300009670|Ga0116183_1073317 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1915 | Open in IMG/M |
| 3300009670|Ga0116183_1163481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1077 | Open in IMG/M |
| 3300009680|Ga0123335_1146899 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1286 | Open in IMG/M |
| 3300009681|Ga0116174_10401388 | Not Available | 638 | Open in IMG/M |
| 3300009682|Ga0116172_10233613 | Not Available | 929 | Open in IMG/M |
| 3300009685|Ga0116142_10032276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 3252 | Open in IMG/M |
| 3300009685|Ga0116142_10347912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 723 | Open in IMG/M |
| 3300009689|Ga0116186_1154743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1064 | Open in IMG/M |
| 3300009715|Ga0116160_1111416 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1161 | Open in IMG/M |
| 3300009715|Ga0116160_1116218 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1129 | Open in IMG/M |
| 3300009715|Ga0116160_1151509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis | 945 | Open in IMG/M |
| 3300009767|Ga0116161_1119878 | Not Available | 1222 | Open in IMG/M |
| 3300009767|Ga0116161_1389095 | Not Available | 543 | Open in IMG/M |
| 3300009769|Ga0116184_10154047 | Not Available | 1096 | Open in IMG/M |
| 3300009773|Ga0123333_10314060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 650 | Open in IMG/M |
| 3300009778|Ga0116151_10237098 | Not Available | 892 | Open in IMG/M |
| 3300009779|Ga0116152_10238360 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 914 | Open in IMG/M |
| 3300009782|Ga0116157_10352002 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 770 | Open in IMG/M |
| 3300010342|Ga0116252_10149801 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1519 | Open in IMG/M |
| 3300010342|Ga0116252_10239667 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300010346|Ga0116239_10049454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae | 3998 | Open in IMG/M |
| 3300010357|Ga0116249_10106363 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2651 | Open in IMG/M |
| 3300010365|Ga0116251_10041205 | Not Available | 3703 | Open in IMG/M |
| 3300012881|Ga0079063_1007801 | Not Available | 763 | Open in IMG/M |
| 3300019202|Ga0179947_1024594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinifilaceae → Marinifilum → unclassified Marinifilum → Marinifilum sp. N1E240 | 1566 | Open in IMG/M |
| 3300019202|Ga0179947_1095776 | Not Available | 1071 | Open in IMG/M |
| 3300019202|Ga0179947_1116201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin016 | 567 | Open in IMG/M |
| 3300019202|Ga0179947_1138944 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300019217|Ga0179946_1188644 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 1042 | Open in IMG/M |
| 3300019219|Ga0179942_1239993 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Pricia → Pricia antarctica | 615 | Open in IMG/M |
| 3300019223|Ga0179948_1026531 | Not Available | 1356 | Open in IMG/M |
| 3300019223|Ga0179948_1247162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin016 | 994 | Open in IMG/M |
| 3300019223|Ga0179948_1247931 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii | 967 | Open in IMG/M |
| 3300019231|Ga0179935_1177595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1059 | Open in IMG/M |
| 3300019236|Ga0179944_1150318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 775 | Open in IMG/M |
| 3300019236|Ga0179944_1200343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1160 | Open in IMG/M |
| 3300019236|Ga0179944_1203213 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis | 1009 | Open in IMG/M |
| 3300022556|Ga0212121_10325472 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 1030 | Open in IMG/M |
| 3300025677|Ga0209719_1101011 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 871 | Open in IMG/M |
| 3300025682|Ga0209718_1086019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1055 | Open in IMG/M |
| 3300025708|Ga0209201_1004800 | All Organisms → cellular organisms → Bacteria | 10624 | Open in IMG/M |
| 3300025713|Ga0208195_1021949 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3252 | Open in IMG/M |
| 3300025713|Ga0208195_1100938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1038 | Open in IMG/M |
| 3300025724|Ga0208196_1063023 | Not Available | 1418 | Open in IMG/M |
| 3300025724|Ga0208196_1088765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → unclassified Bacilli → Bacilli bacterium | 1111 | Open in IMG/M |
| 3300025737|Ga0208694_1049007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1920 | Open in IMG/M |
| 3300025748|Ga0208459_1084053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1274 | Open in IMG/M |
| 3300025856|Ga0209604_1300753 | Not Available | 593 | Open in IMG/M |
| 3300025859|Ga0209096_1183783 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300025866|Ga0208822_1018670 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3280 | Open in IMG/M |
| 3300025866|Ga0208822_1148288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum | 872 | Open in IMG/M |
| 3300025882|Ga0209097_10070534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1783 | Open in IMG/M |
| 3300028626|Ga0302244_1027744 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300028626|Ga0302244_1037114 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1112 | Open in IMG/M |
| 3300028626|Ga0302244_1041044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1023 | Open in IMG/M |
| 3300028629|Ga0302248_1021120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2001 | Open in IMG/M |
| 3300028629|Ga0302248_1095202 | Not Available | 602 | Open in IMG/M |
| 3300028638|Ga0302240_1018451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2442 | Open in IMG/M |
| 3300028640|Ga0302237_1023985 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1966 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1051866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Flexilinea → Flexilinea flocculi | 2174 | Open in IMG/M |
| 3300028724|Ga0307338_107205 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1097 | Open in IMG/M |
| 3300028729|Ga0307334_105927 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1543 | Open in IMG/M |
| 3300028729|Ga0307334_140288 | Not Available | 518 | Open in IMG/M |
| 3300028749|Ga0307349_116477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 530 | Open in IMG/M |
| 3300028750|Ga0307329_109973 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 848 | Open in IMG/M |
| 3300028752|Ga0307346_106680 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300028753|Ga0307336_107322 | Not Available | 1175 | Open in IMG/M |
| 3300028753|Ga0307336_109972 | Not Available | 991 | Open in IMG/M |
| 3300028847|Ga0307327_106029 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1134 | Open in IMG/M |
| 3300028847|Ga0307327_110938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 810 | Open in IMG/M |
| 3300028848|Ga0307339_118851 | Not Available | 637 | Open in IMG/M |
| 3300028850|Ga0307358_104494 | Not Available | 1588 | Open in IMG/M |
| 3300028850|Ga0307358_111697 | Not Available | 952 | Open in IMG/M |
| 3300029440|Ga0167329_1014388 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 2096 | Open in IMG/M |
| 3300029596|Ga0307345_100199 | Not Available | 4354 | Open in IMG/M |
| 3300029596|Ga0307345_112757 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300029599|Ga0307337_121569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 625 | Open in IMG/M |
| 3300029654|Ga0307328_112779 | Not Available | 703 | Open in IMG/M |
| 3300029654|Ga0307328_120317 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 530 | Open in IMG/M |
| 3300029663|Ga0307335_107244 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 1198 | Open in IMG/M |
| 3300029667|Ga0307354_122935 | Not Available | 669 | Open in IMG/M |
| 3300029673|Ga0307355_134422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 526 | Open in IMG/M |
| 3300029677|Ga0307359_1035077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 597 | Open in IMG/M |
| 3300029834|Ga0307324_106920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Leadbetterella → Leadbetterella byssophila | 994 | Open in IMG/M |
| 3300029836|Ga0307325_100286 | All Organisms → cellular organisms → Bacteria | 3624 | Open in IMG/M |
| 3300029837|Ga0307332_111361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 972 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 83.06% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 5.65% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 3.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.81% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.81% |
| Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.81% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300006360 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006386 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006387 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006388 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006389 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006395 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006431 | T18 (1) (BES), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006583 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006584 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Met_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006585 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006586 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Met_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006592 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006593 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006594 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006595 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006596 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006597 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006598 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006601 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006940 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009769 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG | Engineered | Open in IMG/M |
| 3300009773 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300012881 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019202 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA5_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019217 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019219 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC052_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019223 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA6_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019236 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025882 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300028626 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Phe | Engineered | Open in IMG/M |
| 3300028629 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Leu | Engineered | Open in IMG/M |
| 3300028638 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His | Engineered | Open in IMG/M |
| 3300028640 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300028724 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gln1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028729 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Asp1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028749 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Met2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028750 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Cys2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028752 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Lys1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028753 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Glu1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028847 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Ala2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028848 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gln2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028850 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Leu1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029440 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111 | Engineered | Open in IMG/M |
| 3300029596 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Arg2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029599 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Glu2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029654 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Cys1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029663 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Asp2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029667 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029673 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029677 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Leu2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029834 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gly1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029836 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gly2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029837 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Asn1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Soeholt_10171666 | 3300000506 | Anaerobic Digester | MCGNRSVYVIGAPWRDNRVTKEAVPWLAPRSAPAPRRGLPHGVTVFANARIN* |
| Ga0066602_102009541 | 3300004151 | Freshwater | GHCLPRRDNNVTKEERFVAGSTARPSSRRGLPPGVTVFANTGTNY* |
| Ga0066602_105081572 | 3300004151 | Freshwater | GGIGHCLLYRDNLLTKEDRSVAGGTGCPGCSRGLPLGVTVFANAINK* |
| Ga0079079_10039661 | 3300006360 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLTPGVTV |
| Ga0079079_10296681 | 3300006360 | Anaerobic Digestor Sludge | PVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPSGVTVFANARINKTTS* |
| Ga0079068_10203871 | 3300006386 | Anaerobic Digestor Sludge | TIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0079069_10666233 | 3300006387 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNRVTKEEGFVAGATARPGCRRGSPSGVTVFANARINY* |
| Ga0079069_10742952 | 3300006387 | Anaerobic Digestor Sludge | PWRDNWVTKEEGFMAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0079062_10467162 | 3300006388 | Anaerobic Digestor Sludge | IGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN* |
| Ga0079064_10659502 | 3300006389 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINKTTS* |
| Ga0079066_10441231 | 3300006395 | Anaerobic Digestor Sludge | NWVTKEEGFMAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0099701_1028441 | 3300006431 | Sediment | APASNRSVYAIAFPWRDYFVTEEERFVAGATAWPRSRGALPHGVTVFANARIN* |
| Ga0079077_11770581 | 3300006583 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNWVTKEEGFVADATACPGCRRGLPPGVTVFANARIN* |
| Ga0079086_10206231 | 3300006584 | Anaerobic Digestor Sludge | ATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINKTTS* |
| Ga0079086_10207961 | 3300006584 | Anaerobic Digestor Sludge | NKNKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0079086_10217821 | 3300006584 | Anaerobic Digestor Sludge | KKPKNTQPNRSVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPPGVTVFANARINF* |
| Ga0079082_10076711 | 3300006585 | Anaerobic Digestor Sludge | TKEEGFMAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0079082_10191941 | 3300006585 | Anaerobic Digestor Sludge | IGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN* |
| Ga0079087_10107321 | 3300006586 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLTPGVTVFA |
| Ga0079076_10038841 | 3300006592 | Anaerobic Digestor Sludge | VTKEEGFVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0079081_10207392 | 3300006593 | Anaerobic Digestor Sludge | MCGNRSVYVIGAPWRDNRVTKEAVPWLAPRPAPAPRRGLPHGVTVFANARIN* |
| Ga0079081_10355142 | 3300006593 | Anaerobic Digestor Sludge | GNRSVYVIGAPWRDNRVTKEKGSVAGATACPGSRRGLPPGVTVFANARMN* |
| Ga0079073_10173511 | 3300006594 | Anaerobic Digestor Sludge | VTKEEGFMAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0079080_10059942 | 3300006595 | Anaerobic Digestor Sludge | MLGNPKKRTTTNRSVYVIGAPLRDNRVTKEEGFVAGATARPGCRRGSPSGVTVFAN |
| Ga0079080_10174331 | 3300006595 | Anaerobic Digestor Sludge | VYVIGAPWRDNRVTKEEGLVAGATACPGYRRGLPPGVTVFANARINK* |
| Ga0079080_10256612 | 3300006595 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVT |
| Ga0079074_10224382 | 3300006596 | Anaerobic Digestor Sludge | ATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0079070_10299641 | 3300006597 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0079098_10033821 | 3300006598 | Anaerobic Digestor Sludge | NRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINF* |
| Ga0079100_10135782 | 3300006601 | Anaerobic Digestor Sludge | KNKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINKTTS* |
| Ga0079100_10178591 | 3300006601 | Anaerobic Digestor Sludge | VTKEEGFVAGATACPGYRRGLPPGVTAFANARINK* |
| Ga0075527_101899111 | 3300006640 | Arctic Peat Soil | VYAIAFPWRDNFVAQEERFVAGATAWPRSCGALPPGVTVFANARTK* |
| Ga0079099_10403643 | 3300006940 | Anaerobic Digestor Sludge | NRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINK* |
| Ga0105105_101174881 | 3300009009 | Freshwater Sediment | NWVTKEECFVVGATIRPGFRRGLPPGVTVFANARLK* |
| Ga0116175_10136626 | 3300009648 | Anaerobic Digestor Sludge | GTGYNRPVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPPGVTAFANARINK* |
| Ga0123330_11125001 | 3300009652 | Anaerobic Biogas Reactor | NRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLTPGVTVFANARIN* |
| Ga0123330_11274051 | 3300009652 | Anaerobic Biogas Reactor | NKNKTATIPNRPVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPPGVTVFANARINK* |
| Ga0116183_10733171 | 3300009670 | Anaerobic Digestor Sludge | WRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN* |
| Ga0116183_11634813 | 3300009670 | Anaerobic Digestor Sludge | APWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINK* |
| Ga0123335_11468992 | 3300009680 | Anaerobic Biogas Reactor | KTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATARPGCRRGLPPGVTVFANARINY* |
| Ga0116174_104013881 | 3300009681 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANA |
| Ga0116172_102336132 | 3300009682 | Anaerobic Digestor Sludge | APWRDNWVTKEEGFVADATACPGSRRGLPPGVTVFANARIK* |
| Ga0116142_100322761 | 3300009685 | Anaerobic Digestor Sludge | DNRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN* |
| Ga0116142_103479121 | 3300009685 | Anaerobic Digestor Sludge | RENLLAKEERKVPGGAACPGCRRGLPPGVTVFANARIK* |
| Ga0116186_11547431 | 3300009689 | Anaerobic Digestor Sludge | LTHGNRSVYVIGAPWRDNRVTKEKGSVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0116160_11114162 | 3300009715 | Anaerobic Digestor Sludge | IPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIK* |
| Ga0116160_11162181 | 3300009715 | Anaerobic Digestor Sludge | ATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINK* |
| Ga0116160_11515093 | 3300009715 | Anaerobic Digestor Sludge | VYVIGAPCRDNWVTKEESFVAGVTARPGYRRGLPPGVTVFANARIN* |
| Ga0116161_11198783 | 3300009767 | Anaerobic Digestor Sludge | SVYVISAPWRDNWVTKEEGFVAGATACPGCRRGLTPGVTVFANARIN* |
| Ga0116161_13890951 | 3300009767 | Anaerobic Digestor Sludge | WRDNWVTKEESFVAGVTACPGSRRGLPPGVTVFANARINK* |
| Ga0116184_101540472 | 3300009769 | Anaerobic Digestor Sludge | WRDNRVTKEKGSVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0123333_103140601 | 3300009773 | Anaerobic Biogas Reactor | VYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINK* |
| Ga0116151_102370981 | 3300009778 | Anaerobic Digestor Sludge | APWRDNWVTKEGFMAGATACPGSRRGLPPGVTVFANARIKK* |
| Ga0116152_102383601 | 3300009779 | Anaerobic Digestor Sludge | VTKEEGFVAGATACPGSRRGPPPGVTVFANARIK* |
| Ga0116157_103520023 | 3300009782 | Anaerobic Digestor Sludge | APWRDNWVTKEEGFVAGATACPGCRRGLTPGVTVFANARIN* |
| Ga0116252_101498011 | 3300010342 | Anaerobic Digestor Sludge | TATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPHGVTVFANARIN* |
| Ga0116252_102396671 | 3300010342 | Anaerobic Digestor Sludge | VLNKKNKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0116239_100494541 | 3300010346 | Anaerobic Digestor Sludge | YVIGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN* |
| Ga0116249_101063631 | 3300010357 | Anaerobic Digestor Sludge | ATIPNRPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINKTTS* |
| Ga0116251_100412051 | 3300010365 | Anaerobic Digestor Sludge | NRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN* |
| Ga0079063_10078012 | 3300012881 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN* |
| Ga0179947_10245944 | 3300019202 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNRVTKEEGFVAGATACSGYRRGLPPGVTVFANARIN |
| Ga0179947_10957761 | 3300019202 | Anaerobic Digestor Sludge | RPVYVIGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0179947_11162011 | 3300019202 | Anaerobic Digestor Sludge | NRPVYVIGAPWRDNWVTKEESFVAGVTACPGSRRGLPPGVTVFANARIN |
| Ga0179947_11389443 | 3300019202 | Anaerobic Digestor Sludge | NRPVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPPGVTAFANARINK |
| Ga0179946_11886441 | 3300019217 | Anaerobic Digestor Sludge | DNWVTKEESFVAGVTACPGSRRGLPPGVTVFANARINY |
| Ga0179942_12399932 | 3300019219 | Anaerobic Digestor Sludge | DNRVTKEEGFVAGATACPGYRRGLPPGVTVFANARINF |
| Ga0179948_10265311 | 3300019223 | Anaerobic Digestor Sludge | KKPMHNRSVYVIGAPWRDNRVTKEEGFVAGATACSGYRRGLPPGVTVFANARIN |
| Ga0179948_12471621 | 3300019223 | Anaerobic Digestor Sludge | VYVIGAPWRDNWVTKEESFVAGVTACPGSRRGLPPGVTVFANARIN |
| Ga0179948_12479311 | 3300019223 | Anaerobic Digestor Sludge | VYVIGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0179935_11775954 | 3300019231 | Anaerobic Digestor Sludge | DNRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN |
| Ga0179944_11503181 | 3300019236 | Anaerobic Digestor Sludge | IGAPWRDNRVTKEEGFVAGATACPGCRRGLPHGVTVFANARIN |
| Ga0179944_12003431 | 3300019236 | Anaerobic Digestor Sludge | ENFLTKEDSLVVGGAACPGCRRGLPHGVTVFANARIN |
| Ga0179944_12032131 | 3300019236 | Anaerobic Digestor Sludge | TIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0212121_103254721 | 3300022556 | Anoxic Lake Water | IWVTKEESFVVGATARHGSRRGLPHGVTVFANAKINKSTS |
| Ga0209719_11010111 | 3300025677 | Anaerobic Digestor Sludge | WVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN |
| Ga0209718_10860191 | 3300025682 | Anaerobic Digestor Sludge | PWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0209201_10048008 | 3300025708 | Anaerobic Digestor Sludge | MCGNRSVYVIGAPWRDNRVTKEAVPWLAPRPAPAPRRGLPHGVTVFANARIN |
| Ga0208195_10219491 | 3300025713 | Anaerobic Digestor Sludge | KITHANRSVYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPPGVTVFANARIN |
| Ga0208195_11009382 | 3300025713 | Anaerobic Digestor Sludge | IPNRPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINK |
| Ga0208196_10630232 | 3300025724 | Anaerobic Digestor Sludge | IGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARID |
| Ga0208196_10887651 | 3300025724 | Anaerobic Digestor Sludge | VIGAPCRDNWVTKEESFVAGVTARPGYRRGLPPGVTVFANARIN |
| Ga0208694_10490072 | 3300025737 | Anaerobic Digestor Sludge | APWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0208459_10840532 | 3300025748 | Anaerobic Digestor Sludge | WRDNWVTKEEGFVAGATACPGYRRGLPPGVTVFANARIK |
| Ga0209604_13007531 | 3300025856 | Anaerobic Digestor Sludge | GAPWRDNRVTKEEGLVAGATACPGYRRGLPPGVTVFANARIN |
| Ga0209096_11837831 | 3300025859 | Anaerobic Digestor Sludge | MKKRRTVHNRSVYVIGAPWRDNWVTKEEGFVAGATARPGSRRGLPPGVTV |
| Ga0208822_10186707 | 3300025866 | Anaerobic Digestor Sludge | YVIGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN |
| Ga0208822_11482881 | 3300025866 | Anaerobic Digestor Sludge | DNWVTKEEGFVAGATARTGYRRGLPHGVTVFANARIN |
| Ga0209097_100705341 | 3300025882 | Anaerobic Digestor Sludge | VYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIN |
| Ga0302244_10277443 | 3300028626 | Activated Sludge | TATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN |
| Ga0302244_10371141 | 3300028626 | Activated Sludge | STQHNRSVYVIGAPWRDNRVTKEEGFVAGATACPGYRRGLPPGVTVFANARINK |
| Ga0302244_10410441 | 3300028626 | Activated Sludge | APWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIN |
| Ga0302248_10211201 | 3300028629 | Activated Sludge | ITHANRSVYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIN |
| Ga0302248_10952021 | 3300028629 | Activated Sludge | VYVIGAPWRDNWVTKEEGFVAGATARTGYRRGLPHGVTVFANARIN |
| Ga0302240_10184511 | 3300028638 | Activated Sludge | PWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIN |
| Ga0302237_10239852 | 3300028640 | Activated Sludge | ANRSVYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPLGVTVFANARIN |
| (restricted) Ga0255346_10518664 | 3300028677 | Wastewater | APWRDNWVTKEEGFMAGATACPGSRRGLPPGVTVFANARINK |
| Ga0307338_1072053 | 3300028724 | Anaerobic Digestor Sludge | PVYVIGAPWRDNWVTKEEGFMAGATACPGSRRGLPPGVTVFANARINK |
| Ga0307334_1059273 | 3300028729 | Anaerobic Digestor Sludge | KEEGFVAGATACPGSRRGLPPGVTVFANARINKTTS |
| Ga0307334_1402882 | 3300028729 | Anaerobic Digestor Sludge | NWVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0307349_1164771 | 3300028749 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPHGVTVFANARINKTTS |
| Ga0307329_1099733 | 3300028750 | Anaerobic Digestor Sludge | RPVYVIGAPHFANFMAKEDGQVSSGAACPGYRRKLPHGVTVFANARINQ |
| Ga0307346_1066801 | 3300028752 | Anaerobic Digestor Sludge | DNWVTKEEGFMAGATACPGSRRGLPPGVTVFANARINK |
| Ga0307336_1073221 | 3300028753 | Anaerobic Digestor Sludge | ISAPWRDNWVTKEEGFVAGATACPGCRRGLTPGVTVFANARIN |
| Ga0307336_1099722 | 3300028753 | Anaerobic Digestor Sludge | ATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINK |
| Ga0307327_1060292 | 3300028847 | Anaerobic Digestor Sludge | FLTKEDSLVVGGAACPGSRRGLPPGVTVFANARIN |
| Ga0307327_1109381 | 3300028847 | Anaerobic Digestor Sludge | NRVTKEEGFVAGATACPGCRRGLPPGVTVFANAKIN |
| Ga0307339_1188511 | 3300028848 | Anaerobic Digestor Sludge | MHNRSVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARI |
| Ga0307358_1044942 | 3300028850 | Anaerobic Digestor Sludge | NKNKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGSRRGLPPGVTVFANARINK |
| Ga0307358_1116973 | 3300028850 | Anaerobic Digestor Sludge | KNKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINKTT |
| Ga0167329_10143882 | 3300029440 | Biosolids | SVYVIGAPWRDNWVTKEEGFVAGATARTGYRRGLPHGVTVFANARIN |
| Ga0307345_1001991 | 3300029596 | Anaerobic Digestor Sludge | VIGAPWRDNRVTKEEGFVAGATACPGSRRGLPPGVTVFANARIN |
| Ga0307345_1127571 | 3300029596 | Anaerobic Digestor Sludge | MLGNPKKRTTTNRSVYVIGASWRDNWVTKEEGFVAGATACPGCRRGLPPGVT |
| Ga0307337_1215691 | 3300029599 | Anaerobic Digestor Sludge | KNKTATIPNRPVYVIGAPWRDNRVTKEEGFVAGATACPGSRRGLPHGVTVFANARINK |
| Ga0307328_1127791 | 3300029654 | Anaerobic Digestor Sludge | NRSVYVIGAPWRDNWVTKEEGFVAGATACPGYRRGLPPGVTVFANARIN |
| Ga0307328_1203171 | 3300029654 | Anaerobic Digestor Sludge | PNRPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINKTTS |
| Ga0307335_1072442 | 3300029663 | Anaerobic Digestor Sludge | RDNRVTKEEGLVAGATACPGYRRGLPPGVTVFANARINK |
| Ga0307354_1229351 | 3300029667 | Anaerobic Digestor Sludge | SVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINF |
| Ga0307355_1344221 | 3300029673 | Anaerobic Digestor Sludge | NRSVYVIGAPWRDNRVTKEEGFVAGATACPGCRRGLPPGVTVFANARIN |
| Ga0307359_10350771 | 3300029677 | Anaerobic Digestor Sludge | RPVYVIGAPWRDNWVTKEEGFVAGATARPGYRRGFPPGVTVFANARINKTTS |
| Ga0307324_1069201 | 3300029834 | Anaerobic Digestor Sludge | MKKRRTVHNRSVYVIGAPWRDNWVTKEEGFVAGATARPGSRRGLPPGVTVFANARINKST |
| Ga0307325_1002861 | 3300029836 | Anaerobic Digestor Sludge | NRPVYVIGAPWRDNRVTKEEGFVAGATDCPGYRRGLPPGVTAFANARINK |
| Ga0307332_1113611 | 3300029837 | Anaerobic Digestor Sludge | NKTATIPNRPVYVIGAPWRDNWVTKEEGFVAGATACPGCRRGLPPGVTVFANARINK |
| Ga0316621_103211842 | 3300033488 | Soil | PYRENLLTEEDRLVVGGTACPRSRRGLPLGVTVFANARIK |
| ⦗Top⦘ |