


| Basic Information | |
|---|---|
| Family ID | F064744 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.95 % |
| % of genes near scaffold ends (potentially truncated) | 22.66 % |
| % of genes from short scaffolds (< 2000 bps) | 82.03 % |
| Associated GOLD sequencing projects | 53 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.719 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (64.844 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.812 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF02195 | ParBc | 13.28 |
| PF03237 | Terminase_6N | 6.25 |
| PF09682 | Phage_holin_6_1 | 6.25 |
| PF13384 | HTH_23 | 5.47 |
| PF04545 | Sigma70_r4 | 5.47 |
| PF14386 | DUF4417 | 2.34 |
| PF03592 | Terminase_2 | 2.34 |
| PF01555 | N6_N4_Mtase | 1.56 |
| PF13551 | HTH_29 | 0.78 |
| PF00196 | GerE | 0.78 |
| PF15960 | DUF4763 | 0.78 |
| PF02592 | Vut_1 | 0.78 |
| PF04404 | ERF | 0.78 |
| PF04448 | DUF551 | 0.78 |
| PF04466 | Terminase_3 | 0.78 |
| PF03602 | Cons_hypoth95 | 0.78 |
| PF04860 | Phage_portal | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 2.34 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.56 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.56 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.56 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.78 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.78 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.09 % |
| Unclassified | root | N/A | 28.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876020|2244396769 | Not Available | 872 | Open in IMG/M |
| 3300000185|Draft_c109580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 530 | Open in IMG/M |
| 3300000568|Draft_10053079 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300002219|SCADCLC_10063476 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1677 | Open in IMG/M |
| 3300002703|draft_11074907 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 4111 | Open in IMG/M |
| 3300005664|Ga0073685_1179604 | Not Available | 529 | Open in IMG/M |
| 3300006395|Ga0079066_1414553 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006805|Ga0075464_10039063 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 2573 | Open in IMG/M |
| 3300006805|Ga0075464_10241073 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1080 | Open in IMG/M |
| 3300006805|Ga0075464_10342733 | Not Available | 903 | Open in IMG/M |
| 3300006805|Ga0075464_10433147 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006805|Ga0075464_10722144 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 617 | Open in IMG/M |
| 3300006805|Ga0075464_10919924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 547 | Open in IMG/M |
| 3300006805|Ga0075464_10941915 | Not Available | 540 | Open in IMG/M |
| 3300006917|Ga0075472_10170928 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1068 | Open in IMG/M |
| 3300009542|Ga0116234_1180442 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300009588|Ga0116232_1082984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1060 | Open in IMG/M |
| 3300009659|Ga0123328_1104137 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300009669|Ga0116148_1171439 | Not Available | 969 | Open in IMG/M |
| 3300009669|Ga0116148_1220807 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 812 | Open in IMG/M |
| 3300009669|Ga0116148_1231671 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009669|Ga0116148_1244652 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 757 | Open in IMG/M |
| 3300009673|Ga0116185_1131346 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1204 | Open in IMG/M |
| 3300009675|Ga0116149_1079749 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1774 | Open in IMG/M |
| 3300009675|Ga0116149_1114650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1365 | Open in IMG/M |
| 3300009680|Ga0123335_1242685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 900 | Open in IMG/M |
| 3300009688|Ga0116176_10070598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1912 | Open in IMG/M |
| 3300009688|Ga0116176_10271379 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 843 | Open in IMG/M |
| 3300009693|Ga0116141_10237545 | Not Available | 987 | Open in IMG/M |
| 3300009693|Ga0116141_10689614 | Not Available | 504 | Open in IMG/M |
| 3300009696|Ga0116177_10055571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 2417 | Open in IMG/M |
| 3300009696|Ga0116177_10170992 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300009696|Ga0116177_10250199 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 959 | Open in IMG/M |
| 3300009720|Ga0116159_1197336 | Not Available | 825 | Open in IMG/M |
| 3300009771|Ga0116155_10027449 | All Organisms → Viruses → Predicted Viral | 2949 | Open in IMG/M |
| 3300009771|Ga0116155_10071307 | Not Available | 1606 | Open in IMG/M |
| 3300009771|Ga0116155_10135832 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300009771|Ga0116155_10169156 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 933 | Open in IMG/M |
| 3300009776|Ga0116154_10056263 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300009776|Ga0116154_10078948 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300009776|Ga0116154_10120287 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300009776|Ga0116154_10232210 | Not Available | 801 | Open in IMG/M |
| 3300009778|Ga0116151_10005564 | All Organisms → cellular organisms → Bacteria | 10856 | Open in IMG/M |
| 3300009780|Ga0116156_10066680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2210 | Open in IMG/M |
| 3300009780|Ga0116156_10363080 | Not Available | 714 | Open in IMG/M |
| 3300009780|Ga0116156_10540130 | Not Available | 548 | Open in IMG/M |
| 3300009781|Ga0116178_10241126 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 909 | Open in IMG/M |
| 3300009781|Ga0116178_10313103 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 777 | Open in IMG/M |
| 3300009781|Ga0116178_10595982 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 535 | Open in IMG/M |
| 3300009782|Ga0116157_10067139 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300009782|Ga0116157_10151107 | Not Available | 1321 | Open in IMG/M |
| 3300009782|Ga0116157_10242519 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300009782|Ga0116157_10452763 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 658 | Open in IMG/M |
| 3300009783|Ga0116158_10293554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 909 | Open in IMG/M |
| 3300009783|Ga0116158_10332580 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300009838|Ga0116153_10208313 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 805 | Open in IMG/M |
| 3300009838|Ga0116153_10236845 | Not Available | 749 | Open in IMG/M |
| 3300009838|Ga0116153_10255255 | Not Available | 718 | Open in IMG/M |
| 3300010346|Ga0116239_10359741 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300010346|Ga0116239_10585818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 727 | Open in IMG/M |
| 3300010346|Ga0116239_10689090 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 654 | Open in IMG/M |
| 3300010346|Ga0116239_10829688 | Not Available | 579 | Open in IMG/M |
| 3300010346|Ga0116239_10948254 | Not Available | 531 | Open in IMG/M |
| 3300010351|Ga0116248_10189122 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1700 | Open in IMG/M |
| 3300010353|Ga0116236_10152743 | All Organisms → Viruses → Predicted Viral | 2150 | Open in IMG/M |
| 3300010353|Ga0116236_10401924 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1166 | Open in IMG/M |
| 3300010353|Ga0116236_10640220 | Not Available | 871 | Open in IMG/M |
| 3300010355|Ga0116242_10279707 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300010355|Ga0116242_11602858 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 528 | Open in IMG/M |
| 3300010357|Ga0116249_10347437 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1369 | Open in IMG/M |
| 3300010365|Ga0116251_10216333 | Not Available | 1140 | Open in IMG/M |
| 3300010429|Ga0116241_10045665 | All Organisms → cellular organisms → Bacteria | 4114 | Open in IMG/M |
| 3300010429|Ga0116241_10106974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2417 | Open in IMG/M |
| 3300014204|Ga0172381_10001238 | All Organisms → cellular organisms → Bacteria | 30491 | Open in IMG/M |
| 3300014204|Ga0172381_10858452 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 677 | Open in IMG/M |
| 3300014204|Ga0172381_10934997 | Not Available | 643 | Open in IMG/M |
| 3300014206|Ga0172377_11037073 | Not Available | 631 | Open in IMG/M |
| 3300019216|Ga0179939_1025348 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300019219|Ga0179942_1096213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 548 | Open in IMG/M |
| 3300019219|Ga0179942_1110557 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300019220|Ga0179936_1074007 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 522 | Open in IMG/M |
| 3300019220|Ga0179936_1144752 | Not Available | 728 | Open in IMG/M |
| 3300019231|Ga0179935_1106217 | Not Available | 515 | Open in IMG/M |
| 3300019231|Ga0179935_1257448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 735 | Open in IMG/M |
| 3300019236|Ga0179944_1293675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 606 | Open in IMG/M |
| 3300019237|Ga0180028_1006269 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300020176|Ga0181556_1180620 | Not Available | 828 | Open in IMG/M |
| 3300020814|Ga0214088_1367255 | Not Available | 553 | Open in IMG/M |
| 3300021603|Ga0226659_10171240 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1040 | Open in IMG/M |
| 3300023207|Ga0255811_11554561 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 951 | Open in IMG/M |
| 3300025708|Ga0209201_1019698 | All Organisms → Viruses → Predicted Viral | 3522 | Open in IMG/M |
| 3300025708|Ga0209201_1028914 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300025708|Ga0209201_1085348 | Not Available | 1181 | Open in IMG/M |
| 3300025713|Ga0208195_1183503 | Not Available | 658 | Open in IMG/M |
| 3300025715|Ga0209310_1019594 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 2760 | Open in IMG/M |
| 3300025715|Ga0209310_1041503 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300025715|Ga0209310_1080508 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 1029 | Open in IMG/M |
| 3300025730|Ga0209606_1031268 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300025737|Ga0208694_1138293 | Not Available | 859 | Open in IMG/M |
| 3300025748|Ga0208459_1138863 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 886 | Open in IMG/M |
| 3300025762|Ga0208040_1249809 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 592 | Open in IMG/M |
| 3300025772|Ga0208939_1128254 | Not Available | 926 | Open in IMG/M |
| 3300025847|Ga0209607_1036819 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 2587 | Open in IMG/M |
| 3300025855|Ga0209717_1082251 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
| 3300025856|Ga0209604_1194784 | Not Available | 811 | Open in IMG/M |
| 3300025866|Ga0208822_1135601 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300025866|Ga0208822_1236211 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 647 | Open in IMG/M |
| 3300025882|Ga0209097_10363202 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300025896|Ga0208916_10416892 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 586 | Open in IMG/M |
| 3300025902|Ga0209202_1048752 | All Organisms → Viruses → Predicted Viral | 1568 | Open in IMG/M |
| 3300026195|Ga0209312_1094797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 774 | Open in IMG/M |
| 3300026311|Ga0209723_1154979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 877 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1037822 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 2741 | Open in IMG/M |
| (restricted) 3300028567|Ga0255342_1191887 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | 830 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1060140 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1155185 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1091929 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1239412 | Not Available | 807 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1301730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 670 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1048950 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1057855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria → Candidatus Shapirobacteria bacterium | 2004 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1070045 | Not Available | 1737 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1149494 | Not Available | 985 | Open in IMG/M |
| 3300029440|Ga0167329_1071959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 582 | Open in IMG/M |
| 3300029446|Ga0167332_1072181 | Not Available | 630 | Open in IMG/M |
| 3300029799|Ga0311022_16307728 | Not Available | 523 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 64.84% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 8.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.03% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 6.25% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 3.91% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 3.12% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 1.56% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 1.56% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 1.56% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876020 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300000185 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002219 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300006395 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009542 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009588 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300019216 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019219 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC052_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019220 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019236 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019237 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025855 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025882 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025902 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300029440 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111 | Engineered | Open in IMG/M |
| 3300029446 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114 | Engineered | Open in IMG/M |
| 3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2244023179 | 2236876020 | Hydrocarbon Resource Environments | MAMEVIDGAYQLLLARLLAIEADMAVLRERVEELEDELHETWMGGTD |
| Draft_1095802 | 3300000185 | Hydrocarbon Resource Environments | LLLARLLAIEADMAVLRERVEELEDELHETWMGGTD* |
| Draft_100530792 | 3300000568 | Hydrocarbon Resource Environments | MAMEVIDGAYQLLLARLLAIEADMAVLRERVEELEDELHETWMGGTD* |
| SCADCLC_100634764 | 3300002219 | Hydrocarbon Resource Environments | YTLLLAELMAIKAEIAALRERVDEIDGELHETWMGGTD* |
| draft_1107490711 | 3300002703 | Hydrocarbon Resource Environments | MPTIDGAYQLLLARLMAIEADMADLRERVQELEGDLHEAQF* |
| Ga0073685_11796041 | 3300005664 | Aquatic | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF* |
| Ga0079066_14145532 | 3300006395 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETWMGGTD* |
| Ga0075464_100390634 | 3300006805 | Aqueous | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0075464_102410733 | 3300006805 | Aqueous | MEVIDGAYQLLLARLMAIEADMADLRERVSELEADVHEAQF* |
| Ga0075464_103427332 | 3300006805 | Aqueous | MDGAYQLLLARLLAIEADMADLRERVDELEAALHETWMGGNE* |
| Ga0075464_104331472 | 3300006805 | Aqueous | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF* |
| Ga0075464_107221441 | 3300006805 | Aqueous | MPVIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAQF* |
| Ga0075464_109199242 | 3300006805 | Aqueous | MEVIDGAYQLLLARLMAIEADMADLRERVAELEAELHETWMGGNE* |
| Ga0075464_109419151 | 3300006805 | Aqueous | MEVIDGAYQLLLARLMAVEADMEALRERVAELEAELHEAWMGGTD* |
| Ga0075472_101709283 | 3300006917 | Aqueous | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116234_11804424 | 3300009542 | Anaerobic Biogas Reactor | MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE* |
| Ga0116232_10829842 | 3300009588 | Anaerobic Biogas Reactor | MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD* |
| Ga0123326_10404205 | 3300009647 | Anaerobic Biogas Reactor | MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD* |
| Ga0123328_11041373 | 3300009659 | Anaerobic Biogas Reactor | MPVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE* |
| Ga0116148_11714392 | 3300009669 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHEAWMGGTD* |
| Ga0116148_12208073 | 3300009669 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAALHEAQF* |
| Ga0116148_12316713 | 3300009669 | Anaerobic Digestor Sludge | AYQLLLARLMALESDLAGLRERVAELEAELHETWMGGND* |
| Ga0116148_12446522 | 3300009669 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVSELEADVHEAQF* |
| Ga0116185_11313461 | 3300009673 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVVELESDLHEAWLGGTD* |
| Ga0116149_10797496 | 3300009675 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHE |
| Ga0116149_11146503 | 3300009675 | Anaerobic Digestor Sludge | MPTIDGAYALLLARLMALESDLAALRERVAELEAELHEAWLGGTD* |
| Ga0123335_12426852 | 3300009680 | Anaerobic Biogas Reactor | MPTIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD* |
| Ga0116176_100705982 | 3300009688 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE* |
| Ga0116176_102713793 | 3300009688 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLALESDLADLRERVQELEAALHEAQF* |
| Ga0116141_102375451 | 3300009693 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETW |
| Ga0116141_106896141 | 3300009693 | Anaerobic Digestor Sludge | AYQLLLARLLAIEADMADLRERVQELEEALHETWMGGTD* |
| Ga0116177_100555713 | 3300009696 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLMALESDLADLRERVDEIDGELHEAGMK* |
| Ga0116177_101709922 | 3300009696 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEANMADLRERVQELEAALHEAQF* |
| Ga0116177_102501991 | 3300009696 | Anaerobic Digestor Sludge | RSRSMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116159_11973361 | 3300009720 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAE |
| Ga0116155_100274491 | 3300009771 | Anaerobic Digestor Sludge | IDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF* |
| Ga0116155_100713072 | 3300009771 | Anaerobic Digestor Sludge | MPTIDGAYALLLARLMAVEADKEALRERVAELEAELHEAWMGGTD* |
| Ga0116155_101358321 | 3300009771 | Anaerobic Digestor Sludge | MDIPMAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND* |
| Ga0116155_101691562 | 3300009771 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHEAGMK* |
| Ga0116154_100562631 | 3300009776 | Anaerobic Digestor Sludge | EVIDGAYQLLLARLMAIEADMADLRERVAELEAALHEAQF* |
| Ga0116154_100789481 | 3300009776 | Anaerobic Digestor Sludge | QLLLARLLAIEADMADLRERVQELEEALHEAGMRG* |
| Ga0116154_101202873 | 3300009776 | Anaerobic Digestor Sludge | MLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF* |
| Ga0116154_102322103 | 3300009776 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116151_100055646 | 3300009778 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLLAIEADMADLRERVDELDDELHEAWLGGTD* |
| Ga0116156_100666803 | 3300009780 | Anaerobic Digestor Sludge | MEVIDGVYQLLLARLMAIEADMADLCERVQELEAELHEAQF* |
| Ga0116156_103630803 | 3300009780 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLCEWVKDLVDELHEVE |
| Ga0116156_105401302 | 3300009780 | Anaerobic Digestor Sludge | METNLPDAYALLLARLIALETELSALRERVAELEAELHETWMGGNE* |
| Ga0116178_102411262 | 3300009781 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVAELEAELHEAQF* |
| Ga0116178_103131032 | 3300009781 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116178_105959821 | 3300009781 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQ |
| Ga0116157_100671393 | 3300009782 | Anaerobic Digestor Sludge | LAKLHAIESELAALEERVQELEAELHETWMGGNE* |
| Ga0116157_101511072 | 3300009782 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELSEAQF* |
| Ga0116157_102425192 | 3300009782 | Anaerobic Digestor Sludge | MPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND* |
| Ga0116157_104527631 | 3300009782 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGNE* |
| Ga0116158_102935542 | 3300009783 | Anaerobic Digestor Sludge | MPTIDGAYALLLARLMVIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116158_103325802 | 3300009783 | Anaerobic Digestor Sludge | METNLPDAYALLLARLIALETELSALRERVAELEGELHEAWVGGTD* |
| Ga0116153_102083133 | 3300009838 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF* |
| Ga0116153_102368451 | 3300009838 | Anaerobic Digestor Sludge | SMEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF* |
| Ga0116153_102552552 | 3300009838 | Anaerobic Digestor Sludge | MPEDWYGLLLAKLHAIESELAALEERVQELEEALHEAQF* |
| Ga0116239_103597412 | 3300010346 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVDEIDGELHETWMGGTD* |
| Ga0116239_105858182 | 3300010346 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLMAIEADMEELRERVQELEDELHETWMGGNE* |
| Ga0116239_106890901 | 3300010346 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELSEAQF* |
| Ga0116239_108296882 | 3300010346 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLMAIEADMADLCERVQELEAELHEAQF* |
| Ga0116239_109482542 | 3300010346 | Anaerobic Digestor Sludge | MDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE* |
| Ga0116248_101891222 | 3300010351 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVAELEDELREAGMK* |
| Ga0116236_101527432 | 3300010353 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEEALHEVGMK* |
| Ga0116236_104019243 | 3300010353 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEDELHETWMGGTD* |
| Ga0116236_106402201 | 3300010353 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVSELEAD |
| Ga0116242_102797073 | 3300010355 | Anaerobic Digestor Sludge | MAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND* |
| Ga0116242_116028582 | 3300010355 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF* |
| Ga0116249_103474371 | 3300010357 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETW |
| Ga0116251_102163332 | 3300010365 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE* |
| Ga0116241_100456655 | 3300010429 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAGMRG* |
| Ga0116241_101069742 | 3300010429 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMAALRERVDELEAELHEAQF* |
| Ga0172381_1000123861 | 3300014204 | Landfill Leachate | MAMPEDWYGLLLARLMAIEADMADLRERVSELEADVHEAQF* |
| Ga0172381_108584522 | 3300014204 | Landfill Leachate | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF* |
| Ga0172381_109349971 | 3300014204 | Landfill Leachate | METNLPDSSAFLLVRLIALETELSAVRERVKELEADVHEAQ |
| Ga0172377_110370731 | 3300014206 | Landfill Leachate | MPTIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF* |
| Ga0179939_10253484 | 3300019216 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHE |
| Ga0179942_10962132 | 3300019219 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEGELHEAWVGGTD |
| Ga0179942_11105573 | 3300019219 | Anaerobic Digestor Sludge | MAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND |
| Ga0179936_10740071 | 3300019220 | Anaerobic Digestor Sludge | MPTIDGAYALLLARLMALESDLAALRERVAELEAELHEA |
| Ga0179936_11447521 | 3300019220 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGTD |
| Ga0179935_11062172 | 3300019231 | Anaerobic Digestor Sludge | METNLPDAYALLLARLIALETELSALRERVAELEAELHETWMGGND |
| Ga0179935_12574482 | 3300019231 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHEAWLGGTD |
| Ga0179944_12936752 | 3300019236 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALEIDLADLRERVQELEAELHETWMGGNE |
| Ga0180028_10062692 | 3300019237 | Anaerobic Biogas Reactor | MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE |
| Ga0181556_11806201 | 3300020176 | Salt Marsh | METTLPDAYALLLARLMAVEADMEALRERVAELEAELHEAWMGGTD |
| Ga0214088_13672552 | 3300020814 | Granular Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE |
| Ga0226659_101712402 | 3300021603 | Granular Sludge | MPVIDGAYQLLLARLMAIEADMADLRERVQELEEALHETWMGGNE |
| Ga0255811_115545611 | 3300023207 | Anaerobic Digester Digestate | MPTIDGAYQLLLARLMAIEADMADLRERVQELEEALHEAQF |
| Ga0209507_10450561 | 3300025706 | Anaerobic Digestor Sludge | SPRRSRERRSRLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF |
| Ga0209201_10196984 | 3300025708 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETWMGGTD |
| Ga0209201_10289141 | 3300025708 | Anaerobic Digestor Sludge | YALLLARLMALESDLAALRERVAELEAELHEAWLGGTD |
| Ga0209201_10853482 | 3300025708 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHEAWMGGTD |
| Ga0208195_11835032 | 3300025713 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETW |
| Ga0209310_10195947 | 3300025715 | Anaerobic Digestor Sludge | MRWAMLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF |
| Ga0209310_10415034 | 3300025715 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAGMRG |
| Ga0209310_10805083 | 3300025715 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF |
| Ga0209606_10312684 | 3300025730 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE |
| Ga0208694_11382932 | 3300025737 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE |
| Ga0208459_11388632 | 3300025748 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVAELEDELREAGMK |
| Ga0208040_12498092 | 3300025762 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVDEIDGELHETWMGGNE |
| Ga0208939_11282541 | 3300025772 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE |
| Ga0209607_103681910 | 3300025847 | Anaerobic Digestor Sludge | MPTIDGAYQLLLARLLAIEADMADLRERVDELDDELHEAWLGGTD |
| Ga0209717_10822511 | 3300025855 | Anaerobic Digestor Sludge | MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGNE |
| Ga0209604_11947841 | 3300025856 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAE |
| Ga0208822_11356013 | 3300025866 | Anaerobic Digestor Sludge | AYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE |
| Ga0208822_12362113 | 3300025866 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLIALETELSALRERVAELEAALHETWMGGNE |
| Ga0209097_103632022 | 3300025882 | Anaerobic Digestor Sludge | METNLPDAYALLLARLIALETELSALRERVAELEGELHEAWVGGTD |
| Ga0208916_104168921 | 3300025896 | Aqueous | MEVIDGAYQLLLARLMAIEADMADLCERVQELEDELHEAQF |
| Ga0209202_10487523 | 3300025902 | Anaerobic Digestor Sludge | MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF |
| Ga0209312_10947972 | 3300026195 | Anaerobic Biogas Reactor | MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD |
| Ga0209723_11549792 | 3300026311 | Anaerobic Biogas Reactor | MPTIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD |
| (restricted) Ga0255344_10378229 | 3300028564 | Wastewater | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAWLGGNE |
| (restricted) Ga0255342_11918873 | 3300028567 | Wastewater | MEVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD |
| (restricted) Ga0255345_10601402 | 3300028568 | Wastewater | MPVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD |
| (restricted) Ga0255345_11551853 | 3300028568 | Wastewater | MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD |
| (restricted) Ga0255341_10919292 | 3300028570 | Wastewater | MEVIDGAYQLLLARLMAIEADMADLRERMDELDDELHEAWLGGTD |
| (restricted) Ga0255347_12394121 | 3300028593 | Wastewater | VIDGAYQLLLARLLAIEADMAALRERMDELDDELHEAWLGGMD |
| (restricted) Ga0255347_13017302 | 3300028593 | Wastewater | MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD |
| (restricted) Ga0255346_10489504 | 3300028677 | Wastewater | EVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD |
| (restricted) Ga0255346_10578551 | 3300028677 | Wastewater | METNLPDAYALLLARLLAIEADMADLRERMDELDDELHEAWLGGTD |
| (restricted) Ga0255346_10700455 | 3300028677 | Wastewater | MPVIDGAYQLLLARLLAIEADMADLRERVSETWLGGTE |
| (restricted) Ga0255346_11494942 | 3300028677 | Wastewater | MEVIDGAYQLLLARLLAIEADMADLRERVAELEGELHETWMGGNE |
| Ga0167329_10719591 | 3300029440 | Biosolids | MPVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF |
| Ga0167332_10721811 | 3300029446 | Biosolids | MDGAYQLLLARLMALESDLADLRERVDEIDGELHETWMGGNE |
| Ga0311022_163077282 | 3300029799 | Anaerobic Digester Digestate | MEVIDGAYQLLLARLMAIEADMADLRERVQELEEALHETWMGGNE |
| ⦗Top⦘ |