


| Basic Information | |
|---|---|
| Family ID | F060961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVL |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.424 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.939 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.35% β-sheet: 0.00% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 28.03 |
| PF07238 | PilZ | 11.36 |
| PF01039 | Carboxyl_trans | 4.55 |
| PF02627 | CMD | 3.03 |
| PF00248 | Aldo_ket_red | 1.52 |
| PF06736 | TMEM175 | 1.52 |
| PF01323 | DSBA | 1.52 |
| PF00892 | EamA | 1.52 |
| PF01124 | MAPEG | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF06574 | FAD_syn | 0.76 |
| PF04909 | Amidohydro_2 | 0.76 |
| PF02464 | CinA | 0.76 |
| PF05598 | DUF772 | 0.76 |
| PF01042 | Ribonuc_L-PSP | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 28.03 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 4.55 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 4.55 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 4.55 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.03 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.03 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.52 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 0.76 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.76 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.45 % |
| Unclassified | root | N/A | 4.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401CAFHR | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101738741 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300000732|JGI12023J11887_1012828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300000956|JGI10216J12902_116759568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1717 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100171140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2054 | Open in IMG/M |
| 3300005332|Ga0066388_102054031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300005341|Ga0070691_10076541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1631 | Open in IMG/M |
| 3300005558|Ga0066698_10523605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 805 | Open in IMG/M |
| 3300005713|Ga0066905_100062705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2347 | Open in IMG/M |
| 3300005713|Ga0066905_101080078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300005713|Ga0066905_102255247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300005764|Ga0066903_101643817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300005764|Ga0066903_109026061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300005937|Ga0081455_10269176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300006046|Ga0066652_101125552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300006354|Ga0075021_10532999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300006606|Ga0074062_12848041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1517 | Open in IMG/M |
| 3300006845|Ga0075421_100253996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2154 | Open in IMG/M |
| 3300006846|Ga0075430_100858564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300006846|Ga0075430_100950238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300006872|Ga0101947_1090860 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300007788|Ga0099795_10286065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300009012|Ga0066710_104486458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009100|Ga0075418_10425472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1422 | Open in IMG/M |
| 3300009101|Ga0105247_11677545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 525 | Open in IMG/M |
| 3300009162|Ga0075423_11545167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300009792|Ga0126374_10635463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300009836|Ga0105068_1071859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 647 | Open in IMG/M |
| 3300010047|Ga0126382_11735210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300010162|Ga0131853_10818118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 747 | Open in IMG/M |
| 3300010359|Ga0126376_11788299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300010361|Ga0126378_11559298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300010362|Ga0126377_10288298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300010366|Ga0126379_10944028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300010366|Ga0126379_11373287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300010371|Ga0134125_10456781 | Not Available | 1416 | Open in IMG/M |
| 3300010371|Ga0134125_10785259 | Not Available | 1048 | Open in IMG/M |
| 3300010376|Ga0126381_104751414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300011120|Ga0150983_16391375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300012199|Ga0137383_10110080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2004 | Open in IMG/M |
| 3300012204|Ga0137374_10276698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1391 | Open in IMG/M |
| 3300012206|Ga0137380_11130639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300012212|Ga0150985_107094637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300012212|Ga0150985_120645623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300012354|Ga0137366_11255728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012362|Ga0137361_11180966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 687 | Open in IMG/M |
| 3300012363|Ga0137390_10464327 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012685|Ga0137397_10983922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300012909|Ga0157290_10136679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300012929|Ga0137404_11947720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300012944|Ga0137410_11906803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300012957|Ga0164303_10855190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300012958|Ga0164299_10098913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1511 | Open in IMG/M |
| 3300014501|Ga0182024_10231456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2495 | Open in IMG/M |
| 3300014501|Ga0182024_10979294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300014501|Ga0182024_12672874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300014501|Ga0182024_12801935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300014657|Ga0181522_10207533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1154 | Open in IMG/M |
| 3300015242|Ga0137412_11153268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300015371|Ga0132258_10588514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2792 | Open in IMG/M |
| 3300015374|Ga0132255_104765149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300016294|Ga0182041_10387320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1186 | Open in IMG/M |
| 3300016319|Ga0182033_10472525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300016319|Ga0182033_11877260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300017970|Ga0187783_10445392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
| 3300018044|Ga0187890_10002500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12818 | Open in IMG/M |
| 3300018051|Ga0184620_10131367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300018062|Ga0187784_10107807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2269 | Open in IMG/M |
| 3300018468|Ga0066662_11484357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 705 | Open in IMG/M |
| 3300018476|Ga0190274_13477449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 531 | Open in IMG/M |
| 3300020016|Ga0193696_1127458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 642 | Open in IMG/M |
| 3300020581|Ga0210399_10899701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300020583|Ga0210401_10933638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300021078|Ga0210381_10037575 | Not Available | 1397 | Open in IMG/M |
| 3300021377|Ga0213874_10140241 | Not Available | 836 | Open in IMG/M |
| 3300021384|Ga0213876_10639223 | Not Available | 566 | Open in IMG/M |
| 3300021402|Ga0210385_11435578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300021474|Ga0210390_10308674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1340 | Open in IMG/M |
| 3300024225|Ga0224572_1057766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300025325|Ga0209341_10404303 | Not Available | 1106 | Open in IMG/M |
| 3300025556|Ga0210120_1105260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 563 | Open in IMG/M |
| 3300025604|Ga0207930_1131943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300025900|Ga0207710_10696415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 533 | Open in IMG/M |
| 3300025929|Ga0207664_11356416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300026089|Ga0207648_11044035 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300026557|Ga0179587_10295012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300027616|Ga0209106_1079958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300027663|Ga0208990_1004567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4511 | Open in IMG/M |
| 3300027703|Ga0207862_1203375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300027961|Ga0209853_1154999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 552 | Open in IMG/M |
| 3300028380|Ga0268265_11987564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 588 | Open in IMG/M |
| 3300028536|Ga0137415_10027893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5566 | Open in IMG/M |
| 3300028709|Ga0307279_10118882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300028768|Ga0307280_10028351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1658 | Open in IMG/M |
| 3300028771|Ga0307320_10055754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300028778|Ga0307288_10058576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
| 3300028811|Ga0307292_10242508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 747 | Open in IMG/M |
| 3300028872|Ga0307314_10021531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1475 | Open in IMG/M |
| 3300028876|Ga0307286_10041928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1536 | Open in IMG/M |
| 3300028906|Ga0308309_10512015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300028906|Ga0308309_11244742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300030058|Ga0302179_10099971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
| 3300031091|Ga0308201_10244195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300031091|Ga0308201_10302896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 570 | Open in IMG/M |
| 3300031170|Ga0307498_10022575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300031564|Ga0318573_10268185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
| 3300031708|Ga0310686_111444506 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300031736|Ga0318501_10843664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300031740|Ga0307468_102350813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300031763|Ga0318537_10363471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300031765|Ga0318554_10319340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300031778|Ga0318498_10073422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
| 3300031779|Ga0318566_10459618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300031782|Ga0318552_10729007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031792|Ga0318529_10569208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300031796|Ga0318576_10292977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300031831|Ga0318564_10157025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300031896|Ga0318551_10530243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300031910|Ga0306923_10815365 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031912|Ga0306921_10363115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1692 | Open in IMG/M |
| 3300031942|Ga0310916_10421980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300031945|Ga0310913_10859730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300031954|Ga0306926_10353472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1816 | Open in IMG/M |
| 3300032025|Ga0318507_10112288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300032025|Ga0318507_10268867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300032044|Ga0318558_10579832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300032065|Ga0318513_10476257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300032065|Ga0318513_10565686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300032132|Ga0315336_1084106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1444 | Open in IMG/M |
| 3300032783|Ga0335079_10518636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1269 | Open in IMG/M |
| 3300032783|Ga0335079_11858161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300033289|Ga0310914_10388138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_09993260 | 2124908009 | Soil | MPDAVPAPTRDVVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLTAAR |
| INPhiseqgaiiFebDRAFT_1017387411 | 3300000364 | Soil | MSLAVPPSARDLTIVHSSDLHLDHDYTARLHGGDGTAG |
| JGI12023J11887_10128281 | 3300000732 | Forest Soil | MPDAVPPPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGL |
| JGI10216J12902_1167595681 | 3300000956 | Soil | MKSRDIVIVHSSDLHVDHDYTARMHGGDGTAGLASVLAAA |
| JGIcombinedJ26739_1001711404 | 3300002245 | Forest Soil | MPHAGAPTKDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAAGAA |
| Ga0066388_1020540313 | 3300005332 | Tropical Forest Soil | MPHAGAPTKDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARAAG |
| Ga0070691_100765413 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDAVSPPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLA |
| Ga0066698_105236053 | 3300005558 | Soil | MPFAPSRDIVLVHSSDLHMDHDYTARLHGGDGTAGLS |
| Ga0066905_1000627051 | 3300005713 | Tropical Forest Soil | MPSFRDIVVVHSSDLHMDHDYTARLHGGDGTAGLSSV |
| Ga0066905_1010800781 | 3300005713 | Tropical Forest Soil | MPHAAPSRDIVVVHSSDVHIDHDYTARLHGGDGTAGLSGVLSA |
| Ga0066905_1022552471 | 3300005713 | Tropical Forest Soil | MPHAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLS |
| Ga0066903_1016438173 | 3300005764 | Tropical Forest Soil | MLPAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARAA |
| Ga0066903_1090260612 | 3300005764 | Tropical Forest Soil | MPHAPPPPTRDIVVVHSSDLHLDHDYTARLHGGDGTA |
| Ga0081455_102691764 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPPPTRDLVVVHSSDLHIDHDYTARLHGGDGTAGLAGVLAAARR |
| Ga0066652_1011255521 | 3300006046 | Soil | MGLKWVWSATMSPLARDLTVVHSSDLHLDHDYTARL |
| Ga0075021_105329992 | 3300006354 | Watersheds | VTNNSATRELLLVHSSDLHVDDERIAALHGGDGTAGL |
| Ga0074062_128480411 | 3300006606 | Soil | MPDAVPAPTRDVVVVHSSDLHLDHDYTARLHGGDGTAGLVGVLAAAR |
| Ga0075421_1002539965 | 3300006845 | Populus Rhizosphere | MSSKDVIMVHTSDLHVDHDYTAKLHGGDGTAGLACVLNAASRI* |
| Ga0075430_1008585643 | 3300006846 | Populus Rhizosphere | MLPARDIVVVHSSDLHMDHDYTARLHGGDGTAGLSSVLSA |
| Ga0075430_1009502383 | 3300006846 | Populus Rhizosphere | MPQALPLATRDVVVVHSSDLHVDHDYTARLHGGDGTAGLKGVLRAAVQAGAD |
| Ga0101947_10908601 | 3300006872 | Drinking Water Pipes | MRSSRDVVVAHSSDVHVDHEYTARLFEGDGAGGLRAVLTAARKASADLVLLA |
| Ga0099795_102860651 | 3300007788 | Vadose Zone Soil | MPDAVPAPTRDIVVVHSSDLQLDHDYTARLHGGDGTAGLAGVLAAARH |
| Ga0066710_1044864581 | 3300009012 | Grasslands Soil | MPFAPPRDIVLVHSSDLHMDHDYTARLHGGDGTAGLSSVLAAARAA |
| Ga0075418_104254723 | 3300009100 | Populus Rhizosphere | MPHAVPPPARDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAA |
| Ga0105247_116775451 | 3300009101 | Switchgrass Rhizosphere | MPDAVSPPTRDVVVIHSSDLHLDHDYTARLHGGDGTAGLVA |
| Ga0075423_115451673 | 3300009162 | Populus Rhizosphere | MPPSRDIVVVHSSDLHMDHDYTARLHGGDGTAGLSSVLSAARGAGA |
| Ga0126374_106354631 | 3300009792 | Tropical Forest Soil | MPHAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARAA |
| Ga0105068_10718593 | 3300009836 | Groundwater Sand | MDRDIVITHSSDLHVDHDYTARIHGGDGTAGLACVLAA |
| Ga0126382_117352102 | 3300010047 | Tropical Forest Soil | MPPAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSG |
| Ga0131853_108181181 | 3300010162 | Termite Gut | VNDDIVLVHSSDLHVDHDHTEPIYEGDGTAGLRWVLDTARGLDAHAVL |
| Ga0126376_117882991 | 3300010359 | Tropical Forest Soil | MPLAMPSARDIVVVHSSDVHVDHEYTARLHGGDGTAGRAGVLSAARGAGADA |
| Ga0126378_115592982 | 3300010361 | Tropical Forest Soil | MTLNNLPSGRDVVVAHSSDLHMDDDHTARLHGGDGAAGLACVLRAASGAG |
| Ga0126377_102882981 | 3300010362 | Tropical Forest Soil | MSAAMPPPTRDLVVVHSSDLHIDHDYTARLHGGDG |
| Ga0126379_109440283 | 3300010366 | Tropical Forest Soil | MPPAAPFRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVL |
| Ga0126379_113732871 | 3300010366 | Tropical Forest Soil | MPHAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSVVLS |
| Ga0134125_104567811 | 3300010371 | Terrestrial Soil | VTRPARDILLAHSSDLHVDEGLTARQYDGDGTAGLGRVL |
| Ga0134125_107852591 | 3300010371 | Terrestrial Soil | VNDRDTDDIVLVHSSDLHVDHDHTEPVYDGDGTAG |
| Ga0126381_1047514142 | 3300010376 | Tropical Forest Soil | MPPAAPSRDIVVVHSSDLHIDHDYTASLHGGDGTAGLSGVL |
| Ga0150983_163913751 | 3300011120 | Forest Soil | MPLPPSRDIVVVHSSDLHVDHDYTARLHGGDGTAG |
| Ga0137383_101100804 | 3300012199 | Vadose Zone Soil | MPHAAPSWDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARA |
| Ga0137374_102766981 | 3300012204 | Vadose Zone Soil | MLQARDIVVVHSSDLHMDHYYTARLHGGDGAAGLVSVLTAAR |
| Ga0137380_111306391 | 3300012206 | Vadose Zone Soil | MRPGEHLPTPDIVVVHSSDLHMDDDYTARLYGGDGTAGLAGVL |
| Ga0150985_1070946372 | 3300012212 | Avena Fatua Rhizosphere | MVHSSDLHVDHDYTARLHGGDGTAGLACVLTKARAVG |
| Ga0150985_1206456231 | 3300012212 | Avena Fatua Rhizosphere | MAFPTPSKDVVVVHSSDVHVDTDYNARLHGGDGTTGLACVLAAARDASADV |
| Ga0137366_112557281 | 3300012354 | Vadose Zone Soil | MRPGEHLPTPDIVVVHSSDLHMDDDYTARLHGGDGTA |
| Ga0137361_111809662 | 3300012362 | Vadose Zone Soil | MTSKDVIVVHSSDLHVDHDYTARLHGGDGTAGLACVLH |
| Ga0137390_104643271 | 3300012363 | Vadose Zone Soil | MTLNNLPSIRDPVVVHSSDLHVDDDHTARLHGGDGTAGLACVLRAAC |
| Ga0137397_109839222 | 3300012685 | Vadose Zone Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAAR |
| Ga0157290_101366791 | 3300012909 | Soil | MPHAVPPPARDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVL |
| Ga0137404_119477202 | 3300012929 | Vadose Zone Soil | MTPNNLPPARDLIVAHSSDLHVDHDHTARLHGGDGTAGLACVLRAA |
| Ga0137410_119068031 | 3300012944 | Vadose Zone Soil | MDMFGAMPQGTHPPTRDIVVVHSSDVHVDHEYTARLHGGDGTAG |
| Ga0164303_108551902 | 3300012957 | Soil | MPYAVPPPARDIVVVHSSDLHLDHDYTARLHGGDGTAGL |
| Ga0164299_100989131 | 3300012958 | Soil | MPDAVPTPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAARHAGAD |
| Ga0182024_102314566 | 3300014501 | Permafrost | MSNPPSRDIIVVHSSDLHVDHDYTARLHGGDGTAGLACVLGAARDNA |
| Ga0182024_109792943 | 3300014501 | Permafrost | MPSPTPALSPPADIIVVHSSDLHVDHDYTARLHGGDGT |
| Ga0182024_126728741 | 3300014501 | Permafrost | MQHPPARDIVVVHSSDLHVDHDYTARLHGGDGTAGLGCVLDAARDLSA |
| Ga0182024_128019351 | 3300014501 | Permafrost | MHPPARDIVVVHSSDLHVDHDYTARLHGGDGTAGLGCVL |
| Ga0181522_102075333 | 3300014657 | Bog | MSPALLPVRDIVVIHSSDLHVDHDYTARLHGGDGAAGLACVLGAARGTDAD |
| Ga0137412_111532681 | 3300015242 | Vadose Zone Soil | MDMFGAMPQGTHPPTRDIVVVHSSDVHVDHEYTARLHGGDGRGDPKP |
| Ga0132258_105885141 | 3300015371 | Arabidopsis Rhizosphere | MPNAVPAPTREVVVVHSSDLPRDHDCTARLHGGDGTAGLVG |
| Ga0132255_1047651491 | 3300015374 | Arabidopsis Rhizosphere | MPPPTRDLVVVHSSDLHIDHDYTARLHGGDGTAGLAGV |
| Ga0182041_103873201 | 3300016294 | Soil | MPSLIAARREIVVVHSSDLHMDDDYTARLHGGDGTAGLAGVL |
| Ga0182033_104725253 | 3300016319 | Soil | MPPAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGV |
| Ga0182033_118772602 | 3300016319 | Soil | MSQAPIPPARDIVVVHSSDLHLDHDYTARLHGGDGTAGL |
| Ga0187783_104453921 | 3300017970 | Tropical Peatland | MSSFPPPDRDIVVVHSSDLHVDDDYTARLHGGDGVA |
| Ga0187890_1000250016 | 3300018044 | Peatland | MPQPPSRDVVVVHSSDLHVDHDYTARLHGGDGTAGLGCVLEAARDLAA |
| Ga0184620_101313671 | 3300018051 | Groundwater Sediment | MPDAVPAPTRDVVVVHSSDLHLDHDYTARLHGGDGAAGLVGVLA |
| Ga0187784_101078071 | 3300018062 | Tropical Peatland | MPNLPRRDIIVVHSSDLHVDHDYTARLHGGDGTTGLACVLAAAQKL |
| Ga0066662_114843571 | 3300018468 | Grasslands Soil | MPLQVCSPIDRDIVVVHSSDLHVDHDYTARIHGGDGTAG |
| Ga0190274_134774491 | 3300018476 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLVGVLAAA |
| Ga0193696_11274582 | 3300020016 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAG |
| Ga0210399_108997011 | 3300020581 | Soil | MPLPPARDVVVVHSSDLHVDHDYTARLHGGDGTAGLG |
| Ga0210401_109336382 | 3300020583 | Soil | MPHPHPPSRDIVVVHSSDLHVDHDYTARLHGGDGTAGLNCVLEAARGLAAD |
| Ga0210381_100375751 | 3300021078 | Groundwater Sediment | MNTKDVIMVHSSDLHVDHDYTARLHGGDGTAGLACVLHAARAIS |
| Ga0213874_101402411 | 3300021377 | Plant Roots | MIVNPLPSGPDVVVAHSSDLHIDDDHTARLHGGDGA |
| Ga0213876_106392232 | 3300021384 | Plant Roots | MPFDAQSPTRDIVIVHASDLHVDDDRIAAKHDGDGTAGLHA |
| Ga0210385_114355782 | 3300021402 | Soil | MTLKNLPPTRDLIVAHSSDLHVDHDHTARLHGGDGTAGLACVLRAAR |
| Ga0210390_103086741 | 3300021474 | Soil | MPHPPTRDIVVVHSSDLHVDHDYTARLHGGDGTLGLGCVL |
| Ga0224572_10577662 | 3300024225 | Rhizosphere | MPHPHPPSRDIVVVHSSDLHVDHDYTARLHGGDGTAGLNCVLEAARDLAAD |
| Ga0209341_104043031 | 3300025325 | Soil | MTAPRDLVLVHSSDLHVDDGFTARTHGGDGTRGLRAVLATA |
| Ga0210120_11052601 | 3300025556 | Natural And Restored Wetlands | MSAKDIVIVHSSDLHVDHDYTARMHGGDGTAGLASILTLARSA |
| Ga0207930_11319432 | 3300025604 | Arctic Peat Soil | MPLPPPRDIVVVHSSDLHVDHDYTARLHGGDGTAGLGCVLAAARD |
| Ga0207710_106964151 | 3300025900 | Switchgrass Rhizosphere | MPDAVSPPTRDVVVIHSSDLHLDHDYTARLHGGDGTAGLVAVLAAAR |
| Ga0207664_113564161 | 3300025929 | Agricultural Soil | MPASVSPPRRDLTIVHSSDLHLDHDYTARLHGGDGTAGLAGVLK |
| Ga0207648_110440353 | 3300026089 | Miscanthus Rhizosphere | MSSKDVIMVHTSDLHVDHDYTAKLHGGDGTAGLACVLNAAR |
| Ga0179587_102950123 | 3300026557 | Vadose Zone Soil | MPHAPPPPTRDIVVVHSSDLHLDHDYTARLHGGDGTAG |
| Ga0209106_10799581 | 3300027616 | Forest Soil | MTPNNLPPARDLIVAHSSDLHVDHDHTARLHGGDGTAG |
| Ga0208990_10045671 | 3300027663 | Forest Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVL |
| Ga0207862_12033751 | 3300027703 | Tropical Forest Soil | MSRDKDVVLIHSSDLHLEHDYAARLHGGDGTAVLSAVLGAAR |
| Ga0209853_11549992 | 3300027961 | Groundwater Sand | MSRDVVIVHSSDLHVDHDYTARIHGGDGTAGLACVLAAAKSVGA |
| Ga0268265_119875641 | 3300028380 | Switchgrass Rhizosphere | MPDAVSPPTRDVVVVHSSDLHLDHDYTARLHGGDGT |
| Ga0137415_100278931 | 3300028536 | Vadose Zone Soil | MPHALPPPTRDIVVVHSSDLHLDHDYAARLHGGDGTAGLAG |
| Ga0307279_101188822 | 3300028709 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGV |
| Ga0307280_100283514 | 3300028768 | Soil | MPDAVPTPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAARHA |
| Ga0307320_100557541 | 3300028771 | Soil | MPDAVPTPTRDIVVVHSSDLHLDHDYTARLHGGDGTAG |
| Ga0307288_100585764 | 3300028778 | Soil | MPDAVPTPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAARHAGA |
| Ga0307292_102425082 | 3300028811 | Soil | MSDAVPTPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLAAAR |
| Ga0307314_100215313 | 3300028872 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAG |
| Ga0307286_100419283 | 3300028876 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLVGVL |
| Ga0308309_105120151 | 3300028906 | Soil | MPHPPARDIVVVHSSDLHVDHDYTARLHGGDGTAGLHC |
| Ga0308309_112447422 | 3300028906 | Soil | MLHPPARDIVVVHSSDLHVDHDYTARLHGGDGTAGLG |
| Ga0302179_100999711 | 3300030058 | Palsa | MPNLPARDIIVVHSSDLHVDHDYTARLHGGDGTTG |
| Ga0308201_102441952 | 3300031091 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLTAARH |
| Ga0308201_103028961 | 3300031091 | Soil | MPDAVPAPTRDIVVVHSSDLHLDHDYTARLHGGDGTAGLVGVLAAAR |
| Ga0307498_100225751 | 3300031170 | Soil | MSQASPPPARDIVVVHSSDLHLDHDYTARLHGGDGTAGLAGVLRAAR |
| Ga0318573_102681851 | 3300031564 | Soil | MQAAGAPTKDIVVVHSSDLHMDDDYTARLHGGDGTAGLSGVLS |
| Ga0310686_1114445065 | 3300031708 | Soil | MPHPPSRDIVVVHSSDLHVDHDYTARLHGGDGTAGLNCVLEAAR |
| Ga0318501_108436642 | 3300031736 | Soil | MQAAGAPTKDIVVVHSSDLHMDDDYTARLHGGDGTAGLSGVLSAARA |
| Ga0307468_1023508132 | 3300031740 | Hardwood Forest Soil | MTAGRDIVVVHSSDLHVDHDYTARMHGGDGTAGLAAVLDAARD |
| Ga0318537_103634711 | 3300031763 | Soil | MPSLIAARREIVVVHSSDLHMDDDYTARLHGGDGTAGLAGVLSVASS |
| Ga0318554_103193401 | 3300031765 | Soil | MQAAGAPTKDIVVVHSSDLHMDDDYTARLHGGDGTAGLSGVLSAAAEMTAAARSSRSI |
| Ga0318498_100734221 | 3300031778 | Soil | MPHAAPARDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAAR |
| Ga0318566_104596181 | 3300031779 | Soil | MPQASARDIVVVHSSDLHVDHDYTARLHGGDGAAGLGC |
| Ga0318552_107290072 | 3300031782 | Soil | MTLNELPPGRDVVVAHSSDLHMDDDHTARLHGGDGTAGLACVLRAASGAGADVVI |
| Ga0318529_105692081 | 3300031792 | Soil | MTLNELPPGRDVVVAHSSDLHMDDDHTARLHGGDGTAGLACVLRAASGAGADVV |
| Ga0318576_102929771 | 3300031796 | Soil | MQAAGAPTKDIVVVHSSDLHMDDDYTARLHGGDGTAGLSGVLSAARAG |
| Ga0318564_101570251 | 3300031831 | Soil | MPHAGAATKDIVVVHSSDLHIDDDYTARLHGGDGTPE |
| Ga0318551_105302431 | 3300031896 | Soil | MQAAGAPTKDIVVVHSSDLHMDDDYTARLHGGDGTAGEPGG |
| Ga0306923_108153651 | 3300031910 | Soil | MTLNELPPGRDVVVAHSSDLHMDDDHTARLHGGDGTAGLACVLGAASGA |
| Ga0306921_103631151 | 3300031912 | Soil | MPHAAPSRDIVIVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARAAR |
| Ga0310916_104219801 | 3300031942 | Soil | MPHAGAPTKDIVVVHSSDLHIDDDYTARLHGGDGTAGLSGVLSA |
| Ga0310913_108597301 | 3300031945 | Soil | MPHAGAPTKDIVVVHSSDLHIDDDYTARLHGGDGTAGLSGV |
| Ga0306926_103534721 | 3300031954 | Soil | MTLNDLPAGRDVVVAHSSDLHMDDDHTARLHGGDGTAG |
| Ga0318507_101122881 | 3300032025 | Soil | MPHAGAATKDIVVVHSSDLHIDDDYTARLHGGDGTAGLSGVLSA |
| Ga0318507_102688671 | 3300032025 | Soil | MPHAGAPTKDIVVVHSSDLHIDDDYTARLHGGDGTAG |
| Ga0318558_105798321 | 3300032044 | Soil | MPHAAPSRDIVIVHSSDLHIDHDYTARLHGGDGTAGLCGVLS |
| Ga0318513_104762571 | 3300032065 | Soil | MPNAGAATKDIVVVHSSDLHIDDDYTARLHGGDGTAGLS |
| Ga0318513_105656862 | 3300032065 | Soil | MPHAGAPTKDIVVVHSSDLHIDDDYTARLHGGDGTAGLSGVLSAAAEMTA |
| Ga0315336_10841063 | 3300032132 | Seawater | VSSETSDRDAIEIVHSSDLHVDDGYTARAFGGDGTRGLGIVLEA |
| Ga0335079_105186361 | 3300032783 | Soil | MLQAPARDVIVVHSSDLHVDHDYTARLHGGDGAAGLACVLEAARA |
| Ga0335079_118581612 | 3300032783 | Soil | MLHPPARDIVVVHSSDLHVDHDYTARLHGGDGAAGLACVL |
| Ga0310914_103881383 | 3300033289 | Soil | MPHAAPSRDIVVVHSSDLHIDHDYTARLHGGDGTAGLSGVLSAARAAG |
| ⦗Top⦘ |