


| Basic Information | |
|---|---|
| Family ID | F054391 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 38 residues |
| Representative Sequence | GGSLSDIETTVAMTAKDAHATFESAGKAAKNFRSAGRS |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.14 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.14 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.00 |
| PF03992 | ABM | 3.57 |
| PF00072 | Response_reg | 2.86 |
| PF10262 | Rdx | 2.86 |
| PF03401 | TctC | 2.14 |
| PF00106 | adh_short | 1.43 |
| PF01066 | CDP-OH_P_transf | 1.43 |
| PF07719 | TPR_2 | 1.43 |
| PF14026 | DUF4242 | 1.43 |
| PF13356 | Arm-DNA-bind_3 | 0.71 |
| PF08811 | DUF1800 | 0.71 |
| PF05532 | CsbD | 0.71 |
| PF02582 | DUF155 | 0.71 |
| PF03795 | YCII | 0.71 |
| PF09694 | Gcw_chp | 0.71 |
| PF03703 | bPH_2 | 0.71 |
| PF05305 | DUF732 | 0.71 |
| PF04430 | DUF498 | 0.71 |
| PF05598 | DUF772 | 0.71 |
| PF06147 | DUF968 | 0.71 |
| PF12625 | Arabinose_bd | 0.71 |
| PF13699 | DUF4157 | 0.71 |
| PF01243 | Putative_PNPOx | 0.71 |
| PF00027 | cNMP_binding | 0.71 |
| PF13180 | PDZ_2 | 0.71 |
| PF02566 | OsmC | 0.71 |
| PF14559 | TPR_19 | 0.71 |
| PF01183 | Glyco_hydro_25 | 0.71 |
| PF03951 | Gln-synt_N | 0.71 |
| PF06689 | zf-C4_ClpX | 0.71 |
| PF07769 | PsiF_repeat | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF13417 | GST_N_3 | 0.71 |
| PF00933 | Glyco_hydro_3 | 0.71 |
| PF00590 | TP_methylase | 0.71 |
| PF13505 | OMP_b-brl | 0.71 |
| PF08734 | GYD | 0.71 |
| PF13442 | Cytochrome_CBB3 | 0.71 |
| PF02894 | GFO_IDH_MocA_C | 0.71 |
| PF01527 | HTH_Tnp_1 | 0.71 |
| PF01370 | Epimerase | 0.71 |
| PF00536 | SAM_1 | 0.71 |
| PF02581 | TMP-TENI | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.00 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.14 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 1.43 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 1.43 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 1.43 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.71 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.71 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.71 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.71 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.71 |
| COG1723 | Mitochondrial translation protein, Rmd1/RMND1/DUF155 family | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.71 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.71 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.71 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.71 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.71 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.71 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.71 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.86 % |
| Unclassified | root | N/A | 32.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1051881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300000675|JGI12335J11872_100790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 635 | Open in IMG/M |
| 3300000721|JGI12410J11868_103111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1036615 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300000955|JGI1027J12803_103866733 | Not Available | 561 | Open in IMG/M |
| 3300004633|Ga0066395_10206003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300005332|Ga0066388_106649599 | Not Available | 582 | Open in IMG/M |
| 3300005457|Ga0070662_100010949 | Not Available | 5976 | Open in IMG/M |
| 3300005471|Ga0070698_100141030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2361 | Open in IMG/M |
| 3300005764|Ga0066903_101022818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1513 | Open in IMG/M |
| 3300005764|Ga0066903_101389165 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005764|Ga0066903_107603670 | Not Available | 558 | Open in IMG/M |
| 3300005764|Ga0066903_107700642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300006028|Ga0070717_10488222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1112 | Open in IMG/M |
| 3300006032|Ga0066696_10418026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 876 | Open in IMG/M |
| 3300006058|Ga0075432_10217918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 762 | Open in IMG/M |
| 3300006163|Ga0070715_10096168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1373 | Open in IMG/M |
| 3300006806|Ga0079220_10109536 | Not Available | 1449 | Open in IMG/M |
| 3300006845|Ga0075421_100168884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2727 | Open in IMG/M |
| 3300006871|Ga0075434_100432322 | Not Available | 1337 | Open in IMG/M |
| 3300009137|Ga0066709_101918612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300009147|Ga0114129_10496076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300009147|Ga0114129_11892319 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009147|Ga0114129_13482442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 504 | Open in IMG/M |
| 3300009521|Ga0116222_1329359 | Not Available | 661 | Open in IMG/M |
| 3300009545|Ga0105237_10646341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1064 | Open in IMG/M |
| 3300010047|Ga0126382_10901839 | Not Available | 765 | Open in IMG/M |
| 3300010048|Ga0126373_11786130 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010301|Ga0134070_10196108 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010358|Ga0126370_10292933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1286 | Open in IMG/M |
| 3300010359|Ga0126376_10110172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2121 | Open in IMG/M |
| 3300010361|Ga0126378_11040215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300010361|Ga0126378_11858222 | Not Available | 685 | Open in IMG/M |
| 3300010362|Ga0126377_10250056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1725 | Open in IMG/M |
| 3300010362|Ga0126377_12614932 | Not Available | 580 | Open in IMG/M |
| 3300010366|Ga0126379_11681595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 739 | Open in IMG/M |
| 3300010366|Ga0126379_13115502 | Not Available | 555 | Open in IMG/M |
| 3300010366|Ga0126379_13694634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 513 | Open in IMG/M |
| 3300010376|Ga0126381_104627704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 530 | Open in IMG/M |
| 3300010398|Ga0126383_10953244 | Not Available | 945 | Open in IMG/M |
| 3300010398|Ga0126383_12732410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300011119|Ga0105246_11787101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 587 | Open in IMG/M |
| 3300012198|Ga0137364_10449863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 966 | Open in IMG/M |
| 3300012200|Ga0137382_10223720 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300012960|Ga0164301_11685905 | Not Available | 529 | Open in IMG/M |
| 3300012971|Ga0126369_10553621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300012971|Ga0126369_13230401 | Not Available | 534 | Open in IMG/M |
| 3300012984|Ga0164309_11006862 | Not Available | 687 | Open in IMG/M |
| 3300013297|Ga0157378_10665915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
| 3300015371|Ga0132258_13618930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1056 | Open in IMG/M |
| 3300016270|Ga0182036_10341961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
| 3300016270|Ga0182036_11767910 | Not Available | 523 | Open in IMG/M |
| 3300016294|Ga0182041_10144350 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300016294|Ga0182041_11635840 | Not Available | 595 | Open in IMG/M |
| 3300016341|Ga0182035_10966842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 753 | Open in IMG/M |
| 3300016341|Ga0182035_11526889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300016371|Ga0182034_10569692 | Not Available | 952 | Open in IMG/M |
| 3300016371|Ga0182034_10579143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 945 | Open in IMG/M |
| 3300016404|Ga0182037_10343176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300016422|Ga0182039_11038795 | Not Available | 736 | Open in IMG/M |
| 3300016445|Ga0182038_10150219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1777 | Open in IMG/M |
| 3300016445|Ga0182038_11169266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300018007|Ga0187805_10635385 | Not Available | 506 | Open in IMG/M |
| 3300018060|Ga0187765_10365161 | Not Available | 883 | Open in IMG/M |
| 3300018072|Ga0184635_10066691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1403 | Open in IMG/M |
| 3300018072|Ga0184635_10228828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300018476|Ga0190274_12866082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. LC85 | 578 | Open in IMG/M |
| 3300021078|Ga0210381_10017412 | Not Available | 1858 | Open in IMG/M |
| 3300021405|Ga0210387_10814820 | Not Available | 824 | Open in IMG/M |
| 3300022534|Ga0224452_1225808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300022756|Ga0222622_10461090 | Not Available | 903 | Open in IMG/M |
| 3300023072|Ga0247799_1096356 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025915|Ga0207693_10297874 | Not Available | 1263 | Open in IMG/M |
| 3300025949|Ga0207667_10381925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300026121|Ga0207683_11047856 | Not Available | 757 | Open in IMG/M |
| 3300026824|Ga0207723_102099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1742 | Open in IMG/M |
| 3300026859|Ga0207859_1002786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 1679 | Open in IMG/M |
| 3300027049|Ga0207806_1026103 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027654|Ga0209799_1001146 | All Organisms → cellular organisms → Bacteria | 5126 | Open in IMG/M |
| 3300027703|Ga0207862_1159963 | Not Available | 673 | Open in IMG/M |
| 3300027725|Ga0209178_1150277 | Not Available | 804 | Open in IMG/M |
| 3300027915|Ga0209069_10436681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300028380|Ga0268265_10679546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300028715|Ga0307313_10177458 | Not Available | 660 | Open in IMG/M |
| 3300028828|Ga0307312_10872633 | Not Available | 596 | Open in IMG/M |
| 3300028878|Ga0307278_10251036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300031226|Ga0307497_10028325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1803 | Open in IMG/M |
| 3300031474|Ga0170818_108949055 | Not Available | 503 | Open in IMG/M |
| 3300031543|Ga0318516_10087623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1744 | Open in IMG/M |
| 3300031564|Ga0318573_10669532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300031572|Ga0318515_10291637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300031573|Ga0310915_11270606 | Not Available | 508 | Open in IMG/M |
| 3300031719|Ga0306917_10061139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2574 | Open in IMG/M |
| 3300031719|Ga0306917_11313346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300031720|Ga0307469_10371519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 1209 | Open in IMG/M |
| 3300031736|Ga0318501_10331638 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300031744|Ga0306918_10286608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300031744|Ga0306918_10303165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1231 | Open in IMG/M |
| 3300031751|Ga0318494_10939310 | Not Available | 508 | Open in IMG/M |
| 3300031753|Ga0307477_10403097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 937 | Open in IMG/M |
| 3300031763|Ga0318537_10198480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300031771|Ga0318546_10337916 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300031771|Ga0318546_10477088 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300031771|Ga0318546_10837141 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031771|Ga0318546_10854384 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031792|Ga0318529_10017993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2773 | Open in IMG/M |
| 3300031833|Ga0310917_10905042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300031835|Ga0318517_10120586 | Not Available | 1160 | Open in IMG/M |
| 3300031890|Ga0306925_10088476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3285 | Open in IMG/M |
| 3300031890|Ga0306925_10357662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1568 | Open in IMG/M |
| 3300031912|Ga0306921_10531306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1365 | Open in IMG/M |
| 3300031912|Ga0306921_10626821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300031941|Ga0310912_10135246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1848 | Open in IMG/M |
| 3300031944|Ga0310884_10158983 | Not Available | 1173 | Open in IMG/M |
| 3300031945|Ga0310913_10263192 | Not Available | 1213 | Open in IMG/M |
| 3300031945|Ga0310913_10825429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300031946|Ga0310910_10409538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
| 3300031946|Ga0310910_10830102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300031946|Ga0310910_10916587 | Not Available | 687 | Open in IMG/M |
| 3300031946|Ga0310910_11165985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
| 3300031947|Ga0310909_11611393 | Not Available | 514 | Open in IMG/M |
| 3300031954|Ga0306926_10445492 | Not Available | 1595 | Open in IMG/M |
| 3300031954|Ga0306926_12752990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300031981|Ga0318531_10008404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3769 | Open in IMG/M |
| 3300032001|Ga0306922_11751115 | Not Available | 613 | Open in IMG/M |
| 3300032013|Ga0310906_11209345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300032052|Ga0318506_10267469 | Not Available | 758 | Open in IMG/M |
| 3300032059|Ga0318533_10507364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300032063|Ga0318504_10651657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300032076|Ga0306924_10607788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300032076|Ga0306924_10822842 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300032076|Ga0306924_11102082 | Not Available | 865 | Open in IMG/M |
| 3300032076|Ga0306924_11276450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300032160|Ga0311301_10057740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8596 | Open in IMG/M |
| 3300032261|Ga0306920_100368512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2136 | Open in IMG/M |
| 3300032261|Ga0306920_101276742 | Not Available | 1057 | Open in IMG/M |
| 3300032261|Ga0306920_101409205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 998 | Open in IMG/M |
| 3300032261|Ga0306920_104226179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300033289|Ga0310914_11785130 | Not Available | 519 | Open in IMG/M |
| 3300033433|Ga0326726_11745437 | Not Available | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000675 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 | Environmental | Open in IMG/M |
| 3300000721 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10518812 | 3300000580 | Forest Soil | TDIETTVAMSAREATETFAAAGKAARSLRSAGHA* |
| JGI12335J11872_1007902 | 3300000675 | Tropical Forest Soil | AGGSLSDIETTIAMTAKDAAATFESAGKAAKAFRSAGHP* |
| JGI12410J11868_1031112 | 3300000721 | Tropical Forest Soil | GSLSDIETTIAMTAKDAAATFESAGKAAKAFRSAGHP* |
| AP72_2010_repI_A001DRAFT_10366152 | 3300000893 | Forest Soil | GSLAEVETTVAMTAKDAHATFVSAGKAAKAFRSAGRS* |
| JGI1027J12803_1038667331 | 3300000955 | Soil | GGSFSDIETTVAMTAEDARRTFEAAGAAARDFRSAGRS* |
| Ga0066395_102060031 | 3300004633 | Tropical Forest Soil | AAGGSLSNIETTVAMTAKEATATFKSAGKAAKGFRSMAHAA* |
| Ga0066388_1066495991 | 3300005332 | Tropical Forest Soil | GGGSLSEVETTVAMTAKDAHATFVSAAKAAKAFRSAGRS* |
| Ga0070662_1000109491 | 3300005457 | Corn Rhizosphere | AGGSLSEIETTVAMTADDAKATFGAAGKAATAFRKKGACS* |
| Ga0070698_1001410304 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGSLSDIETTVAMTAKDAHATFVSAGKAAKSFRSAGRS* |
| Ga0066903_1010228183 | 3300005764 | Tropical Forest Soil | GSLSDIETTVAMSAQDAHATFQAASKAAKDFRSAGRS* |
| Ga0066903_1013891651 | 3300005764 | Tropical Forest Soil | GGSLSDVETTVAMTAKDAFTTFESAGKAAKAFRSAGRR* |
| Ga0066903_1076036703 | 3300005764 | Tropical Forest Soil | GSLSDIETTVAMTAKEAHATFEAASKAAKDFRSAGRS* |
| Ga0066903_1077006422 | 3300005764 | Tropical Forest Soil | LSDIETTVAMTAKDAVATFKSAGKAAKTFRSAGRS* |
| Ga0070717_104882221 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SLSDIETTVAMTAKDAHATFVSAGKAAKSFRSAGRS* |
| Ga0066696_104180261 | 3300006032 | Soil | GGSLSEVETTVAMTAKDAAATFKSAGKVAKDFRSAGRS* |
| Ga0075432_102179182 | 3300006058 | Populus Rhizosphere | GGSLSDVETTVAMTAKDAAATFEAAGKAAQGFRSAGHA* |
| Ga0070715_100961683 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EIETTVAMTADDAKATFGAAGKAATAFRKKGARS* |
| Ga0079220_101095363 | 3300006806 | Agricultural Soil | GGGSLSDVETTIAMTANEAFATFESAAKAAKAFRSAGRS* |
| Ga0075421_1001688848 | 3300006845 | Populus Rhizosphere | AAAGGSLSEIETTVAMTAKDAHATFVSAGKAAKSFRSAGR* |
| Ga0075434_1004323224 | 3300006871 | Populus Rhizosphere | SDIETTVAMSAKDAVATFEAAGKAAKGFRSAGRP* |
| Ga0066709_1019186121 | 3300009137 | Grasslands Soil | GGSLSEIETTVAMTAKDAHATFESAGKAAKGFRSAGRS* |
| Ga0114129_104960761 | 3300009147 | Populus Rhizosphere | SLSDVETTVAMTAAEAKATFEAAGKVAEDFRSAGRS* |
| Ga0114129_118923192 | 3300009147 | Populus Rhizosphere | AAGGSLSDIETTPAMTAKDAHATFVSAGKVAKGFRSAGRA* |
| Ga0114129_134824422 | 3300009147 | Populus Rhizosphere | AGGSLTDIETTPAMTAKDAHATFVSAGKAAKTFRSAGRA* |
| Ga0116222_13293591 | 3300009521 | Peatlands Soil | VLTVDSSLSEIETTVAMAAKDARATFESAGKAAKSFRSAGRS* |
| Ga0105237_106463411 | 3300009545 | Corn Rhizosphere | AGGSLTDIETTVAMTARDAAATFESAGKAARNFRSAGHS* |
| Ga0126382_109018391 | 3300010047 | Tropical Forest Soil | LSDIETTPAMTAKDAHAAFESATKAAKAFRSAGRA* |
| Ga0126373_117861301 | 3300010048 | Tropical Forest Soil | SLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS* |
| Ga0134070_101961082 | 3300010301 | Grasslands Soil | LVAAGGGSLSEVETTVAMTAKDAHATFVSAGKAAKAFRSAGRS* |
| Ga0126370_102929332 | 3300010358 | Tropical Forest Soil | GSLTDIETIPAMTAKDAHATFVSAGKAAKTFRSAGRAEVSGGGFS* |
| Ga0126376_101101721 | 3300010359 | Tropical Forest Soil | GGSLSEIETTVAMTAKDAHATFESAAKAAKAFRSAGRS* |
| Ga0126378_110402152 | 3300010361 | Tropical Forest Soil | LSDIETTVAMSAQDAHATFQAAAKAAKDFRSAGRA* |
| Ga0126378_118582222 | 3300010361 | Tropical Forest Soil | SLSEVETTVAMTAKDAHATFVSAAKAAKAFRRAGRS* |
| Ga0126377_102500563 | 3300010362 | Tropical Forest Soil | GGSLSDIETTVAMTAKDAAATFEIAGKAAKSFRSAGRH* |
| Ga0126377_126149321 | 3300010362 | Tropical Forest Soil | AAAGGSLTEVETTVAMTAKEAQATFESAGKAAKNFRSA* |
| Ga0126379_116815953 | 3300010366 | Tropical Forest Soil | LSDVETTVAMTAKDAFTTFESAGKAAKAFRSAGRR* |
| Ga0126379_131155022 | 3300010366 | Tropical Forest Soil | SEIETTVAMTAKDAHATFESAAKAAKAFRSAGRSQVRARLSG* |
| Ga0126379_136946341 | 3300010366 | Tropical Forest Soil | SDVETTVAMTAKDAVATFESAGKAAREFRSAGRS* |
| Ga0126381_1046277041 | 3300010376 | Tropical Forest Soil | GSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS* |
| Ga0126383_109532441 | 3300010398 | Tropical Forest Soil | GGSLSDIETTVAMTAKDAHATFEAASKAAKDFRSAGRS* |
| Ga0126383_127324101 | 3300010398 | Tropical Forest Soil | GRSLSDVETTAAMTTKDAHATFVSAGKAAKDFRSAGRS* |
| Ga0105246_117871011 | 3300011119 | Miscanthus Rhizosphere | AGGGSLSDVETNVAMTAADAKATFEAAGKAAREFRSAGRS* |
| Ga0137364_104498633 | 3300012198 | Vadose Zone Soil | LSEIETTVAMTAKDAHATFESAGKAAKGFRSAGRS* |
| Ga0137382_102237201 | 3300012200 | Vadose Zone Soil | SLSEIETTVAMTAKDAHATFESAGKAAKGFRSAGRS* |
| Ga0164301_116859051 | 3300012960 | Soil | SLCDVETTLAMTAKDAAATFEAAGKAARGFRSAGHS* |
| Ga0126369_105536211 | 3300012971 | Tropical Forest Soil | SLSDVETTVAMTAKDATATFESAGKAAREFRSAGRS* |
| Ga0126369_132304011 | 3300012971 | Tropical Forest Soil | GGSLSDVETTVAMTAKDAFTTFESASKAAKAFRSAGRR* |
| Ga0164309_110068623 | 3300012984 | Soil | GGSLTDIETTVAMTARDAAATFESAGKVARNFRSAGHS* |
| Ga0157378_106659151 | 3300013297 | Miscanthus Rhizosphere | GVALSLIKTTVAMTADDAKATFGAAGKAATAFRKKGECS* |
| Ga0132258_136189302 | 3300015371 | Arabidopsis Rhizosphere | LSDIETTVAMTAEDAKATFGAAGKAATAFRKAGHS* |
| Ga0182036_103419611 | 3300016270 | Soil | AAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0182036_117679102 | 3300016270 | Soil | GGGSLSDVETTIAMTAKEAFATFESAAKAARAFRSAGR |
| Ga0182041_101443501 | 3300016294 | Soil | LSDIETTVAMSAQDAHATFQAAAKAAKDFRSAGRS |
| Ga0182041_116358402 | 3300016294 | Soil | LSDVETTVAMTAKDAFSTFESAGKAAKAFRSAGLK |
| Ga0182035_109668422 | 3300016341 | Soil | GGGSLSDVETTVAMTAKDAFTTFESASKAAKAFRSAGRR |
| Ga0182035_115268893 | 3300016341 | Soil | AAAAGGSLTDIETVPAMTAKDAHATFMSAAKAAKTFRSAGRA |
| Ga0182034_105696923 | 3300016371 | Soil | GGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0182034_105791433 | 3300016371 | Soil | AAAGGSLTDIETVPAMTAKDAHATFVSAQKAAKTFRSAGRA |
| Ga0182037_103431761 | 3300016404 | Soil | AASGGGSLSDVETTIAMTAKEAFATFESAAKAARAFRSAGR |
| Ga0182039_110387951 | 3300016422 | Soil | AAGGSLSDVETTIAMTAKDAFTTFESAAKAAKAFRSAGRQ |
| Ga0182038_101502193 | 3300016445 | Soil | LTDIETVPAMTAKDAHATFVSAQKAAKAFRSAGRT |
| Ga0182038_111692661 | 3300016445 | Soil | GGSLSDIETTVAMTAKEAASTFESAGKAAKAFRSAGR |
| Ga0187805_106353851 | 3300018007 | Freshwater Sediment | LCDVETTVAMTAKDAATTFEAAGKAAKDFRSAGRS |
| Ga0187765_103651611 | 3300018060 | Tropical Peatland | SLSDIETTVAMTARDAAATFEAAGKAARSFRSAGRS |
| Ga0184635_100666914 | 3300018072 | Groundwater Sediment | AAAAGGSLSDVETTPAMTAEDAHTTFVSAGKAAKAFRSAGRV |
| Ga0184635_102288281 | 3300018072 | Groundwater Sediment | AGGSLSDIETTPAMTAKDAHATFVSAGKAAKTFRSAGRA |
| Ga0190274_128660822 | 3300018476 | Soil | LSEIETTVAMTAKDAHATFESAGKAAKSFRSAGRS |
| Ga0210381_100174123 | 3300021078 | Groundwater Sediment | AAGGSLTDIETTPAMTAKDAHATFVSAGKAAKTFRSAGRA |
| Ga0210387_108148201 | 3300021405 | Soil | GGSLSDIETTVAMTAKDAHATFESAGKAAKNFRSAGRS |
| Ga0224452_12258081 | 3300022534 | Groundwater Sediment | AAAGGSLTDIETTPAMTAKDAHATFVSAGKAAKTFRSAGRA |
| Ga0222622_104610903 | 3300022756 | Groundwater Sediment | LSEIETTVAMTAKDAHATFESAGKAAKGFRSAGRS |
| Ga0247799_10963561 | 3300023072 | Soil | LSDVETTLAMTAEDARATFEAAGKVAKQFRSAGRS |
| Ga0207693_102978744 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDVETTLAMTAKEAFATFESAAKAAKAFRSAGRS |
| Ga0207667_103819253 | 3300025949 | Corn Rhizosphere | GSLSEIETTVAMTADDAKATFGAAGKAATAFRKKGARS |
| Ga0207683_110478562 | 3300026121 | Miscanthus Rhizosphere | FEIETTVAMTAEDAKATFRAAGKAATAFRKKGARS |
| Ga0207723_1020991 | 3300026824 | Tropical Forest Soil | GGSLTDIETVPAMTAKDAHATFMSAAKAAKTFRSAGRT |
| Ga0207859_10027861 | 3300026859 | Tropical Forest Soil | LAAAAGGSLTDIETVPAMTAKDAHATFMSAAKAAKTFRSAGRT |
| Ga0207806_10261032 | 3300027049 | Tropical Forest Soil | AAAGGSLTDIETVPAMTAKDAHATFMSAAKAAKTFRSAGRA |
| Ga0209799_10011461 | 3300027654 | Tropical Forest Soil | VAAAGGGSLAEIETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0207862_11599631 | 3300027703 | Tropical Forest Soil | LSDIETTIAMTAKDAHATFESAGKAAKEFRSAGRS |
| Ga0209178_11502772 | 3300027725 | Agricultural Soil | LSDIETTVAMTAQQAAETFRAAGTAAKDFRSAGRHAA |
| Ga0209069_104366811 | 3300027915 | Watersheds | LAAAGGGSLSDVETTIAMTAKEAFATFESASKAAKTFRSAGRS |
| Ga0268265_106795461 | 3300028380 | Switchgrass Rhizosphere | SLSESETTVAMTADDAKATFGAAGKAATAFRKKGACS |
| Ga0307313_101774582 | 3300028715 | Soil | AGGSLSEIETTVAMTAKDAHATFESAGKAAKGFRSAGRS |
| Ga0307312_108726331 | 3300028828 | Soil | AAAGGSLTDIETTPAMTAKDAHATFVSAAKAAKSFRSAGRA |
| Ga0307278_102510361 | 3300028878 | Soil | AGGSLSEIETTVAMTAKDAHATFQSAGKAAKGFRSAGRS |
| Ga0307497_100283252 | 3300031226 | Soil | AGGSLTDIETTPAMTAKDAHATFVSAAKAAKSFRSAGRA |
| Ga0170818_1089490551 | 3300031474 | Forest Soil | GSLSDVETTVAMTAKDAATTFESAGKAARAFRSAGRA |
| Ga0318516_100876232 | 3300031543 | Soil | MQSARASDVETTVAMTAKDAHATFVSAGKAAKAFRSAGRS |
| Ga0318573_106695321 | 3300031564 | Soil | SLSDIETTVAMSAQDAHATFQAAAKAAKDFRSAGRS |
| Ga0318515_102916371 | 3300031572 | Soil | SLSDIETTIAMSAQDAHATFQAAAKAAKEFRSAGRA |
| Ga0310915_112706061 | 3300031573 | Soil | LRADIETTIAMTSKDALATFKSAGKTAKEFRSAGRS |
| Ga0306917_100611394 | 3300031719 | Soil | LSDIETTVAMTARDAAATFEAAGKAARNFRSAGRS |
| Ga0306917_113133461 | 3300031719 | Soil | AAGGGSLSDVETTVAMTAKDAFTTFESASKAAKAFRSAGRR |
| Ga0307469_103715192 | 3300031720 | Hardwood Forest Soil | GSLSDIETTVAMTAKEAAATFEAAGKAAKGFRSAGRA |
| Ga0318501_103316382 | 3300031736 | Soil | LAAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRP |
| Ga0306918_102866081 | 3300031744 | Soil | GGGSLSEIETTVAMNAKDAHATFESAAKAAKAFRSAGRS |
| Ga0306918_103031651 | 3300031744 | Soil | SLSDVETTVAMTAKDAHATFVSAGKAAKDFRSAGRS |
| Ga0318494_109393101 | 3300031751 | Soil | SLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0307477_104030971 | 3300031753 | Hardwood Forest Soil | LSDVETTIAITAKDAATTFETAGKAAKAFRSAARSEVNGRL |
| Ga0318537_101984802 | 3300031763 | Soil | LSDIETTVAMTAKDAHATFESAGKAAKSFRSAGRS |
| Ga0318546_103379161 | 3300031771 | Soil | MQSARASDVETTVAMTAKDAHATFVSAGKAAKAFR |
| Ga0318546_104770881 | 3300031771 | Soil | AAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRP |
| Ga0318546_108371413 | 3300031771 | Soil | PALLATAGGGSLAEVETTVAMTAKDAHATFVSVGKAAKAFRSAGRS |
| Ga0318546_108543842 | 3300031771 | Soil | EECTACGMQSARASDVETTVAMTAKDAHATFVSAGKAAKAFRCAGRS |
| Ga0318529_100179931 | 3300031792 | Soil | AGGSLSDIETTPAMTAKEAHATFESAAKAAKAFRSAGRS |
| Ga0310917_109050421 | 3300031833 | Soil | LSDIETTIAMSAQDAHATFQAAAKAAKDFRSAGRS |
| Ga0318517_101205861 | 3300031835 | Soil | AAAGGGSLSEIETTVAMNAKDAHATFESAAKAAKAFRSAGRS |
| Ga0306925_100884765 | 3300031890 | Soil | LSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0306925_103576625 | 3300031890 | Soil | SLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRT |
| Ga0306921_105313063 | 3300031912 | Soil | AAAGGSLTDIETVPAMTAKDAHATFVSAQKAAKAFRSAGRT |
| Ga0306921_106268211 | 3300031912 | Soil | GSLSDIETTIAMTAKDAHATFESAGKAAKEFRSAGRS |
| Ga0310912_101352464 | 3300031941 | Soil | AGGGSLSDIETTIAMSAQDAHATFQAAAKAAKDFRSAGRS |
| Ga0310884_101589831 | 3300031944 | Soil | AAAGGSLSDVETTPAMTSEDAHATFVSAGKAAKAFRSAGRT |
| Ga0310913_102631921 | 3300031945 | Soil | AGGSLSDIETTIAMIAKEATATFESSGKAAKEFRSAGRS |
| Ga0310913_108254291 | 3300031945 | Soil | LAAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRS |
| Ga0310910_104095381 | 3300031946 | Soil | AGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRT |
| Ga0310910_108301021 | 3300031946 | Soil | LSDIETTVAMTAKDAAATFESAGRAAKAFRSAGRS |
| Ga0310910_109165871 | 3300031946 | Soil | LSDIETTVAMTAKEAHATFEAASKAAKDFRSAGRS |
| Ga0310910_111659852 | 3300031946 | Soil | GGSLSDVETTVAMTAKDAFTTFESASKAAKAFRSAGRR |
| Ga0310909_116113932 | 3300031947 | Soil | LSDVETTVAMTAKDAHATFVSAGKAAKDFRSAGRS |
| Ga0306926_104454921 | 3300031954 | Soil | GGGSLSDIETTIAMSAQDAHATFQAAAKAAKDFRSAGRS |
| Ga0306926_127529901 | 3300031954 | Soil | AAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRT |
| Ga0318531_100084046 | 3300031981 | Soil | AAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRT |
| Ga0306922_117511151 | 3300032001 | Soil | GGGSLSDIETTIAMSAQDAHATFQAAAKAAKEFRSAGRS |
| Ga0310906_112093451 | 3300032013 | Soil | AGGSLSNVETTVAMTAKDAAATFEAAGKAAQGFRSAGHA |
| Ga0318506_102674691 | 3300032052 | Soil | GSLSDIETTVAMTARDAAATFEAAGKAARNFRSAGRS |
| Ga0318533_105073642 | 3300032059 | Soil | LSDIETTVAMSAKEAHATFESATKAAKNFRSAGAR |
| Ga0318504_106516571 | 3300032063 | Soil | LAAAGGGSLSEVETTVAMTAKDAHATFVSASKAAKAFRSAGRT |
| Ga0306924_106077881 | 3300032076 | Soil | GGSLSDIETTVAMSAPDAHATFQAAAKAAKDFRSAGRS |
| Ga0306924_108228421 | 3300032076 | Soil | GGSLTDIETTPAMTAKDAHATFVSAAKAAKSFRSAGRA |
| Ga0306924_111020822 | 3300032076 | Soil | GSLSDIETTVAMSAQDAHATFQAASKAAKDFRSAGRS |
| Ga0306924_112764501 | 3300032076 | Soil | GGSLSEIETTVAMTAKDAATTFESAGKAAKAFRSAGRP |
| Ga0311301_100577401 | 3300032160 | Peatlands Soil | VLTVDSSLSEIETTVAMAAKDARATFESAGKAAKSFRSAGRS |
| Ga0306920_1003685121 | 3300032261 | Soil | AGGGSLSDVETTVAMTAQDAHAMFKTAAKAAKDFRSAGRS |
| Ga0306920_1012767421 | 3300032261 | Soil | GSLSDVETTVAMTAKDAFTTFESAGKAAREFRSAGRS |
| Ga0306920_1014092053 | 3300032261 | Soil | LSEIETTVAMNAKDAHATFESAAKAAKAFRSAGRS |
| Ga0306920_1042261791 | 3300032261 | Soil | AGGGSLSDIETTVAMSAQDAHATFQAASKAAKDFRSAGRS |
| Ga0310914_117851301 | 3300033289 | Soil | GGSLSDVETTVAMTAKDAVTTFESAGKAAREFRSAGRP |
| Ga0326726_117454371 | 3300033433 | Peat Soil | AAGGSLTDIETTPAMTAKDAHATFVSAGKAAKAFRSAGRA |
| ⦗Top⦘ |