


| Basic Information | |
|---|---|
| Family ID | F035649 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDV |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.41 % |
| % of genes near scaffold ends (potentially truncated) | 95.32 % |
| % of genes from short scaffolds (< 2000 bps) | 92.40 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.573 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.860 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00732 | GMC_oxred_N | 24.56 |
| PF00296 | Bac_luciferase | 5.85 |
| PF07690 | MFS_1 | 4.68 |
| PF05199 | GMC_oxred_C | 3.51 |
| PF02308 | MgtC | 3.51 |
| PF08883 | DOPA_dioxygen | 2.34 |
| PF00491 | Arginase | 1.75 |
| PF08240 | ADH_N | 1.75 |
| PF00441 | Acyl-CoA_dh_1 | 1.75 |
| PF00383 | dCMP_cyt_deam_1 | 1.17 |
| PF13417 | GST_N_3 | 1.17 |
| PF00106 | adh_short | 0.58 |
| PF13561 | adh_short_C2 | 0.58 |
| PF14437 | MafB19-deam | 0.58 |
| PF07859 | Abhydrolase_3 | 0.58 |
| PF01430 | HSP33 | 0.58 |
| PF05443 | ROS_MUCR | 0.58 |
| PF13602 | ADH_zinc_N_2 | 0.58 |
| PF04542 | Sigma70_r2 | 0.58 |
| PF00892 | EamA | 0.58 |
| PF15919 | HicB_lk_antitox | 0.58 |
| PF02771 | Acyl-CoA_dh_N | 0.58 |
| PF00043 | GST_C | 0.58 |
| PF01315 | Ald_Xan_dh_C | 0.58 |
| PF01361 | Tautomerase | 0.58 |
| PF02798 | GST_N | 0.58 |
| PF07505 | DUF5131 | 0.58 |
| PF00248 | Aldo_ket_red | 0.58 |
| PF01061 | ABC2_membrane | 0.58 |
| PF13650 | Asp_protease_2 | 0.58 |
| PF01134 | GIDA | 0.58 |
| PF13676 | TIR_2 | 0.58 |
| PF12697 | Abhydrolase_6 | 0.58 |
| PF10142 | PhoPQ_related | 0.58 |
| PF03350 | UPF0114 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 28.07 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.85 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 3.51 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 3.51 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.34 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.34 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.75 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.58 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.58 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.58 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
| COG1281 | Redox-regulated molecular chaperone, HSP33 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 0.58 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.58 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.16 % |
| Unclassified | root | N/A | 36.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001652|JGI20274J16320_102466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300004635|Ga0062388_101790961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300005179|Ga0066684_10804091 | Not Available | 621 | Open in IMG/M |
| 3300005332|Ga0066388_103267232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 828 | Open in IMG/M |
| 3300005340|Ga0070689_102138120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 174MFSha1.1 | 513 | Open in IMG/M |
| 3300005347|Ga0070668_101097041 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005569|Ga0066705_10872170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005602|Ga0070762_10623509 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005764|Ga0066903_105670371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300006032|Ga0066696_11014020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300006871|Ga0075434_100291499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1652 | Open in IMG/M |
| 3300006954|Ga0079219_10251971 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300006954|Ga0079219_12388210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia rosea | 513 | Open in IMG/M |
| 3300009038|Ga0099829_10287599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1346 | Open in IMG/M |
| 3300009038|Ga0099829_11052960 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009137|Ga0066709_102797242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300009143|Ga0099792_11002633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300010043|Ga0126380_10338574 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300010044|Ga0126310_10630215 | Not Available | 803 | Open in IMG/M |
| 3300010048|Ga0126373_10115773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2501 | Open in IMG/M |
| 3300010048|Ga0126373_11832535 | Not Available | 670 | Open in IMG/M |
| 3300010048|Ga0126373_13211963 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010343|Ga0074044_10487333 | Not Available | 806 | Open in IMG/M |
| 3300010358|Ga0126370_12121279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300010359|Ga0126376_10797369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300010360|Ga0126372_11601583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300010361|Ga0126378_10343902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1601 | Open in IMG/M |
| 3300010361|Ga0126378_10383906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium esperanzae | 1516 | Open in IMG/M |
| 3300010361|Ga0126378_11881338 | Not Available | 681 | Open in IMG/M |
| 3300010376|Ga0126381_100905775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300010376|Ga0126381_101961436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300010376|Ga0126381_103879822 | Not Available | 583 | Open in IMG/M |
| 3300010376|Ga0126381_104255175 | Not Available | 555 | Open in IMG/M |
| 3300010379|Ga0136449_102750026 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011269|Ga0137392_10751176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L48C026A00 | 806 | Open in IMG/M |
| 3300012189|Ga0137388_11427139 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012198|Ga0137364_10644638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 799 | Open in IMG/M |
| 3300012210|Ga0137378_10496790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1127 | Open in IMG/M |
| 3300012354|Ga0137366_10577688 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012918|Ga0137396_10300310 | Not Available | 1187 | Open in IMG/M |
| 3300012923|Ga0137359_10789411 | Not Available | 823 | Open in IMG/M |
| 3300012925|Ga0137419_10380254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1099 | Open in IMG/M |
| 3300012925|Ga0137419_11857984 | Not Available | 516 | Open in IMG/M |
| 3300012948|Ga0126375_11113585 | Not Available | 651 | Open in IMG/M |
| 3300012984|Ga0164309_10818989 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300014497|Ga0182008_10734945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300014968|Ga0157379_10799645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300015241|Ga0137418_10154182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2022 | Open in IMG/M |
| 3300015372|Ga0132256_102363089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300016270|Ga0182036_10124179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1797 | Open in IMG/M |
| 3300016270|Ga0182036_11183481 | Not Available | 635 | Open in IMG/M |
| 3300016319|Ga0182033_10437510 | Not Available | 1113 | Open in IMG/M |
| 3300016319|Ga0182033_11178996 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300016387|Ga0182040_10112829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 1869 | Open in IMG/M |
| 3300016387|Ga0182040_11768386 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300016404|Ga0182037_11057108 | Not Available | 709 | Open in IMG/M |
| 3300016422|Ga0182039_10795024 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300017822|Ga0187802_10169207 | Not Available | 837 | Open in IMG/M |
| 3300017822|Ga0187802_10323655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300017823|Ga0187818_10285610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300017934|Ga0187803_10327244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300018433|Ga0066667_12343913 | Not Available | 501 | Open in IMG/M |
| 3300020579|Ga0210407_10018706 | All Organisms → cellular organisms → Bacteria | 5141 | Open in IMG/M |
| 3300020581|Ga0210399_10972121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300021086|Ga0179596_10680459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300021168|Ga0210406_11318614 | Not Available | 519 | Open in IMG/M |
| 3300021171|Ga0210405_10822148 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021178|Ga0210408_10176505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1696 | Open in IMG/M |
| 3300021358|Ga0213873_10175447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300021403|Ga0210397_10674811 | Not Available | 793 | Open in IMG/M |
| 3300021403|Ga0210397_11512756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300021404|Ga0210389_11235500 | Not Available | 574 | Open in IMG/M |
| 3300021560|Ga0126371_10630692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300021560|Ga0126371_11320675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
| 3300021560|Ga0126371_11586791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300021560|Ga0126371_11926303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300021560|Ga0126371_13361379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300021560|Ga0126371_13390644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300022708|Ga0242670_1046995 | Not Available | 604 | Open in IMG/M |
| 3300025903|Ga0207680_10718802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium schleiferi | 716 | Open in IMG/M |
| 3300026322|Ga0209687_1128339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300026508|Ga0257161_1028110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300026557|Ga0179587_10332798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium esperanzae | 983 | Open in IMG/M |
| 3300027065|Ga0208489_1000114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2505 | Open in IMG/M |
| 3300027565|Ga0209219_1162440 | Not Available | 533 | Open in IMG/M |
| 3300027603|Ga0209331_1048174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium esperanzae | 1079 | Open in IMG/M |
| 3300027903|Ga0209488_10959765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300027968|Ga0209061_1108150 | Not Available | 963 | Open in IMG/M |
| 3300028047|Ga0209526_10779001 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 594 | Open in IMG/M |
| 3300028906|Ga0308309_10196511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1659 | Open in IMG/M |
| 3300028906|Ga0308309_10358484 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300028906|Ga0308309_11619075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300031543|Ga0318516_10476242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300031543|Ga0318516_10795862 | Not Available | 534 | Open in IMG/M |
| 3300031545|Ga0318541_10083396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1694 | Open in IMG/M |
| 3300031546|Ga0318538_10379190 | Not Available | 764 | Open in IMG/M |
| 3300031549|Ga0318571_10469690 | Not Available | 502 | Open in IMG/M |
| 3300031561|Ga0318528_10288077 | Not Available | 881 | Open in IMG/M |
| 3300031561|Ga0318528_10605800 | Not Available | 587 | Open in IMG/M |
| 3300031563|Ga0307436_1179207 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031564|Ga0318573_10005506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5035 | Open in IMG/M |
| 3300031564|Ga0318573_10279020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300031573|Ga0310915_10169934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1515 | Open in IMG/M |
| 3300031573|Ga0310915_10234437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300031682|Ga0318560_10350603 | Not Available | 797 | Open in IMG/M |
| 3300031708|Ga0310686_100115993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1621 | Open in IMG/M |
| 3300031718|Ga0307474_10510931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Paracoccus → Paracoccus homiensis | 943 | Open in IMG/M |
| 3300031718|Ga0307474_10672105 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031719|Ga0306917_10714596 | Not Available | 787 | Open in IMG/M |
| 3300031720|Ga0307469_11625658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300031724|Ga0318500_10683125 | Not Available | 523 | Open in IMG/M |
| 3300031744|Ga0306918_10429336 | Not Available | 1031 | Open in IMG/M |
| 3300031744|Ga0306918_10945955 | Not Available | 670 | Open in IMG/M |
| 3300031751|Ga0318494_10243503 | Not Available | 1030 | Open in IMG/M |
| 3300031751|Ga0318494_10508225 | Not Available | 702 | Open in IMG/M |
| 3300031751|Ga0318494_10574596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300031751|Ga0318494_10703435 | Not Available | 591 | Open in IMG/M |
| 3300031751|Ga0318494_10719985 | Not Available | 584 | Open in IMG/M |
| 3300031751|Ga0318494_10879310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031763|Ga0318537_10227982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300031768|Ga0318509_10536379 | Not Available | 653 | Open in IMG/M |
| 3300031768|Ga0318509_10853039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031770|Ga0318521_11050011 | Not Available | 500 | Open in IMG/M |
| 3300031771|Ga0318546_10190614 | Not Available | 1397 | Open in IMG/M |
| 3300031771|Ga0318546_11015801 | Not Available | 583 | Open in IMG/M |
| 3300031779|Ga0318566_10662680 | Not Available | 506 | Open in IMG/M |
| 3300031782|Ga0318552_10538209 | Not Available | 596 | Open in IMG/M |
| 3300031798|Ga0318523_10617436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031819|Ga0318568_10089150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1835 | Open in IMG/M |
| 3300031821|Ga0318567_10466859 | Not Available | 716 | Open in IMG/M |
| 3300031821|Ga0318567_10813824 | Not Available | 529 | Open in IMG/M |
| 3300031832|Ga0318499_10351710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031833|Ga0310917_11106477 | Not Available | 529 | Open in IMG/M |
| 3300031835|Ga0318517_10045178 | Not Available | 1828 | Open in IMG/M |
| 3300031845|Ga0318511_10517481 | Not Available | 553 | Open in IMG/M |
| 3300031845|Ga0318511_10592946 | Not Available | 516 | Open in IMG/M |
| 3300031846|Ga0318512_10444179 | Not Available | 654 | Open in IMG/M |
| 3300031859|Ga0318527_10277590 | Not Available | 713 | Open in IMG/M |
| 3300031890|Ga0306925_10012357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8265 | Open in IMG/M |
| 3300031890|Ga0306925_10685977 | Not Available | 1073 | Open in IMG/M |
| 3300031893|Ga0318536_10663235 | Not Available | 520 | Open in IMG/M |
| 3300031896|Ga0318551_10648545 | Not Available | 610 | Open in IMG/M |
| 3300031945|Ga0310913_11163768 | Not Available | 537 | Open in IMG/M |
| 3300031946|Ga0310910_11032022 | Not Available | 642 | Open in IMG/M |
| 3300031947|Ga0310909_10473613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 1051 | Open in IMG/M |
| 3300031947|Ga0310909_10594710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300031954|Ga0306926_10191606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2537 | Open in IMG/M |
| 3300031962|Ga0307479_12142273 | Not Available | 506 | Open in IMG/M |
| 3300032001|Ga0306922_11988705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300032008|Ga0318562_10059274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2116 | Open in IMG/M |
| 3300032010|Ga0318569_10492532 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300032010|Ga0318569_10583123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300032035|Ga0310911_10264537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300032035|Ga0310911_10484855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300032039|Ga0318559_10057671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1643 | Open in IMG/M |
| 3300032039|Ga0318559_10520483 | Not Available | 555 | Open in IMG/M |
| 3300032039|Ga0318559_10624892 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032041|Ga0318549_10246665 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300032051|Ga0318532_10021095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium esperanzae | 2104 | Open in IMG/M |
| 3300032051|Ga0318532_10079821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 1144 | Open in IMG/M |
| 3300032052|Ga0318506_10331496 | Not Available | 675 | Open in IMG/M |
| 3300032060|Ga0318505_10227175 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300032067|Ga0318524_10609522 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032089|Ga0318525_10141600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300032094|Ga0318540_10519629 | Not Available | 574 | Open in IMG/M |
| 3300032515|Ga0348332_10861472 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300033158|Ga0335077_10951864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium trifolii | 861 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.58% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001652 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20274J16320_1024661 | 3300001652 | Forest Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLEYGVASDVTVEPVT |
| Ga0062388_1017909611 | 3300004635 | Bog Forest Soil | MSDAEIGTLRAKLASRPRSDDYRQRRKDIDARGLAYGLAADVGVEPVT |
| Ga0066672_104390601 | 3300005167 | Soil | MSDPEIVALRAKLASRPRSDDYHQRRRDIDARGLAYGLAGDVVVEPVT |
| Ga0066684_108040912 | 3300005179 | Soil | MSDAEIGALRAKLAARPRSDDYRQRRNDIDARGLAYGLAADIE |
| Ga0066388_1032672322 | 3300005332 | Tropical Forest Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTVEPVTANG |
| Ga0070689_1021381201 | 3300005340 | Switchgrass Rhizosphere | MADTEIVALRAKLATRPRSPDYRQRRLDIDARGREYGIPADVSLEPVTAN |
| Ga0070668_1010970411 | 3300005347 | Switchgrass Rhizosphere | MADTEIVALRAKLATRPRSPDYRQRRLDIDARGREYGIPADVSLEPVNAN |
| Ga0066705_108721701 | 3300005569 | Soil | MSDPEIVALRAKLTSRPRSDDYRQRRRDIDERGLAYGLRPDVKVEPVTA |
| Ga0070762_106235093 | 3300005602 | Soil | MSDPQIGALRAKLTGRPRSTDYRQRRRDLDALGQSYELASDVKIEK |
| Ga0066903_1056703712 | 3300005764 | Tropical Forest Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDFDTGFSQYGIARDVTVEPVTANGVRAEW |
| Ga0066696_110140201 | 3300006032 | Soil | MSHPEIVALRAKLGSQPRSPDYRQRRKDIDARGLEYG |
| Ga0075434_1002914991 | 3300006871 | Populus Rhizosphere | MADAEIVALREKLTNRPRSDDYRQRRRDIDERGLAYGLQPDVKVE |
| Ga0079219_102519712 | 3300006954 | Agricultural Soil | MADTEIMALRAKLASRPRSPDYRQRRLDFDALGRAFPVPSDVSLE |
| Ga0079219_123882101 | 3300006954 | Agricultural Soil | MTDPEIVALRQKLASRPRSPDYRQRRRDFDARSLEYR |
| Ga0099829_102875991 | 3300009038 | Vadose Zone Soil | MADPEIIALRAKLASLPRSEDYRQRRRDFDARSLEYGVAADVTVE |
| Ga0099829_110529602 | 3300009038 | Vadose Zone Soil | MADREIVALRAKLASLPRSEDYRQRRRDFDARSLEYGVAADVTVE |
| Ga0066709_1027972422 | 3300009137 | Grasslands Soil | MSDAEIRALRTKLAGRPRSPDYRQRRRDIDARGLEYGVPADVVVEPVS |
| Ga0099792_110026332 | 3300009143 | Vadose Zone Soil | MADPEITALRAKLASRPRSDDYRQRRRDFDARSLEY |
| Ga0126380_103385741 | 3300010043 | Tropical Forest Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVT |
| Ga0126310_106302152 | 3300010044 | Serpentine Soil | MADPEIVALRAKLASRPRSTDYRQRRLDLDARGREYGI |
| Ga0126373_101157731 | 3300010048 | Tropical Forest Soil | MNDTEIGALRQKLASRVRSDDFRQRRKDMDARALEYKISPD |
| Ga0126373_118325351 | 3300010048 | Tropical Forest Soil | MTDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTVEPVT |
| Ga0126373_132119631 | 3300010048 | Tropical Forest Soil | MSDPEIGALRAKLAARPRSDDYRQRRKDIDARGLAYGLAADV |
| Ga0074044_104873332 | 3300010343 | Bog Forest Soil | MAREKDMSDSEIGALRQKLASRVRSDDYRQRRKDMDAGFL |
| Ga0126370_121212791 | 3300010358 | Tropical Forest Soil | MNDSEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAP |
| Ga0126376_107973691 | 3300010359 | Tropical Forest Soil | MADLEIIALREKLTSRPRSDDYRQRRRDIDERGIAYGL |
| Ga0126372_116015832 | 3300010360 | Tropical Forest Soil | MTDPEIVALRQKLASRPRSDDYRQRRRDFDARSLE |
| Ga0126378_103439021 | 3300010361 | Tropical Forest Soil | MQMGGTEIVALRAKLASRPRSDDYRQRRKDIDARGLQYDLAPDIAV |
| Ga0126378_103839061 | 3300010361 | Tropical Forest Soil | MSDIVIGALRAKLASRVRSEDYRQRRKDMDARALEYKIASDVTVEPVTA |
| Ga0126378_118813382 | 3300010361 | Tropical Forest Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAP |
| Ga0126381_1009057753 | 3300010376 | Tropical Forest Soil | MSGQEIGALRAKLASRVRSDDYRQRRKDFDTGFSQYGIARDVTVEPVTA |
| Ga0126381_1019614361 | 3300010376 | Tropical Forest Soil | MTDTEIGVLRQKLASRVRSDDFRQRRKDMDARALEYKIAPDVTVEPVTANGV |
| Ga0126381_1027234751 | 3300010376 | Tropical Forest Soil | MSDPEIGALRAKILARPVTTDIGERRKNMDTRGLAYTLASD |
| Ga0126381_1038798222 | 3300010376 | Tropical Forest Soil | MSDTEISALRAKLVSRVRSDDYRQRRKDMDAGFLQ |
| Ga0126381_1042551751 | 3300010376 | Tropical Forest Soil | MNDTEIGAPRQKLASRVRSDDFRQRRKDMDARALEYKIAPDVTVEPV |
| Ga0136449_1027500262 | 3300010379 | Peatlands Soil | MSDAEIGALRAKLAARPRSDDYRQRRKDIDARGLAYGLAADVGVEPATANGV |
| Ga0134126_111218773 | 3300010396 | Terrestrial Soil | MSDPEIGALRAKLLSRPRTTDYVQRRKDLDALGQAYGLASDV |
| Ga0137392_107511762 | 3300011269 | Vadose Zone Soil | MSDTEIGALRQKLASRQRSDDYRQRRKEMDAAFSQYGTARDVTVEPVTANGVRA |
| Ga0137388_114271391 | 3300012189 | Vadose Zone Soil | MADPEIVALRAKLASMPRSTDYRQRRRDFDARSLEYGVAADV |
| Ga0137364_106446382 | 3300012198 | Vadose Zone Soil | MSDPEIVALRAKLTSRPRSDDYRQRRRDIDERGLAYGLRPDVKVEPVTAN |
| Ga0137378_104967901 | 3300012210 | Vadose Zone Soil | MADPEITALRAKLASRPRSDDYRQRRRDFDARSLEYGVAADVTV |
| Ga0137366_105776882 | 3300012354 | Vadose Zone Soil | MADPEIVALRAKLASRPRSDDYRQRRRDFDARSLEYGVDRDVTIEP |
| Ga0137396_103003101 | 3300012918 | Vadose Zone Soil | MSDTEIDALRAKLASRERSDDYRQRRKDFDVGFSQYGIA |
| Ga0137359_107894112 | 3300012923 | Vadose Zone Soil | MADAEIVALRAKLASRPRSDDYRHRRRDIDARGLAYGLAAGRKI* |
| Ga0137419_103802541 | 3300012925 | Vadose Zone Soil | MEAGKMSDPEIVALRAKLASRPRPDDYHQRRKDIDARGLA |
| Ga0137419_118579842 | 3300012925 | Vadose Zone Soil | MNESEIGALRQKLASRVRSDDYRQRRKDMDARALEYKI |
| Ga0126375_111135852 | 3300012948 | Tropical Forest Soil | MNDTEIGALRQKLTSRVRSDDYRQRHKDMDARALEYKIAPDVT |
| Ga0164309_108189891 | 3300012984 | Soil | MADAEIVALRAKLASRPRSDDYQQRRRDMDARGLQYGV |
| Ga0182008_107349451 | 3300014497 | Rhizosphere | MADAEIAALRAKLAAPPRSADYRQRRLDIDARGREY |
| Ga0157379_107996451 | 3300014968 | Switchgrass Rhizosphere | MADAEIVPLRAKLASRPRSDDYRQRRRDIDARGLQNK |
| Ga0137418_101541825 | 3300015241 | Vadose Zone Soil | MEAGKMSDPEIVALRAKLASRPRPDDYHQRRKDIDARGLAYG |
| Ga0132256_1023630893 | 3300015372 | Arabidopsis Rhizosphere | MADPEIVALRAKLASRPRAADYRQRRLDLDARGREYGVAADVTVE |
| Ga0182036_101241794 | 3300016270 | Soil | MSDTEIDALREKLASRVRSDDYRQRRRDMDAGFLQ |
| Ga0182036_111834811 | 3300016270 | Soil | TEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAETQM |
| Ga0182033_104375101 | 3300016319 | Soil | MNDTEIGALRQKLASRGRSDDYRQRRKDMDARALEYKIAPDVTVEPVPRVASL |
| Ga0182033_111789962 | 3300016319 | Soil | MSDPEIGALRQKLASRVRSEDYRQRRKDMDARALEYKIAPDVTVEPVT |
| Ga0182040_101128292 | 3300016387 | Soil | VSDVEIGALRAKLASRPRSDDYRQRRNDIDTRGLHYGV |
| Ga0182040_117683861 | 3300016387 | Soil | MSDTEIGALREKLVSRVRSDDYRQRRRDMDAGFLQYGI |
| Ga0182037_110571081 | 3300016404 | Soil | MSDQAIGALRAKLASRVRSDDYRQRRRDMDAGFLQYGIARDVTVEPVSAN |
| Ga0182039_107950242 | 3300016422 | Soil | MSDAEIGALRAKLASRPRSDDYRQRRKDIDARGLQYALAPDVGVEP |
| Ga0187802_101692071 | 3300017822 | Freshwater Sediment | MSDSEIGALRQKLASRVRSDDYRQRRKDMDANFLQYGIGRDVSVEPVTAN |
| Ga0187802_103236552 | 3300017822 | Freshwater Sediment | MGDSEIVALRAKLAARPRSDDYRQRRNDIDARGLAYRLAGDVGVEPVTASGVRA |
| Ga0187818_102856101 | 3300017823 | Freshwater Sediment | MADAEITALRAKLASRPRSNDYRQRRRDFDARSREYGLAADVTV |
| Ga0187803_103272441 | 3300017934 | Freshwater Sediment | MADAEITALREKLASRTRSDDYRQRRRDFDARSLEYRLASDVTVEP |
| Ga0066667_123439131 | 3300018433 | Grasslands Soil | MSDTEIGALRAKLASRVRSEDYRQRRRDMDAAFSQYPLARDV |
| Ga0210407_100187061 | 3300020579 | Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLEYGVASDVTVE |
| Ga0210399_109721212 | 3300020581 | Soil | MSDTEIGALRQKLASRERSDDYRQRRKEMDAAFSHYGIARDVAVEP |
| Ga0179596_106804591 | 3300021086 | Vadose Zone Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLEYG |
| Ga0210406_113186141 | 3300021168 | Soil | MSDTEIGTLRAKLASRERSDDYRQRRKDFDVGFSQYGI |
| Ga0210405_108221483 | 3300021171 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARSLEYKIA |
| Ga0210408_101765051 | 3300021178 | Soil | MNDTEIGTLRQKLASRVRSDDYRQRRKDMDARALEYKLAP |
| Ga0213873_101754471 | 3300021358 | Rhizosphere | MSDTEIGALRQKLASRARSDDYRQRRKDMDARALEYKIAPDVTVEPVTANGVRA |
| Ga0210397_106748111 | 3300021403 | Soil | MNDTEIGTLRQKLASRVRSDDYRQRRKDMDARALEYKLAPDVTVEPVTANG |
| Ga0210397_115127561 | 3300021403 | Soil | METAMSDTEITALRAKLAARPRSDDYRQRRRDIDARG |
| Ga0210389_112355001 | 3300021404 | Soil | MPDAEIVALRAKLASRPRSDDYRQLRREIDARGLQYGLAACRTGV |
| Ga0126371_106306922 | 3300021560 | Tropical Forest Soil | MTDTEIGALRQKLASRVRSDDFRQRRKDMDARALEYKIAPDVTVEPVTAN |
| Ga0126371_113206752 | 3300021560 | Tropical Forest Soil | MNDSEIGALRQKLASRVRSDDFRQRRKDMDARALEYKIAPDVTVEPVTAN |
| Ga0126371_115867911 | 3300021560 | Tropical Forest Soil | MLEWRDYTREESMNDREIDTLRQKLASRVRSDDYRQRRKDMDARALEYKIALDITVEPVT |
| Ga0126371_119263031 | 3300021560 | Tropical Forest Soil | MSDPEIFALRAKLASRPRSDDFRQRRKDIDARGLQYGLA |
| Ga0126371_133613791 | 3300021560 | Tropical Forest Soil | MGGTEIAALRAKLASRLRSDDYRQRRKDIDARSLQYDLAPDIA |
| Ga0126371_133906441 | 3300021560 | Tropical Forest Soil | MNDAEIAALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTV |
| Ga0242670_10469951 | 3300022708 | Soil | MPDAEIVALRAKLASRPRSDDYRQLRREIDARGLQYGLAACRT |
| Ga0207680_107188023 | 3300025903 | Switchgrass Rhizosphere | MADAEIVALRANLASRPRSDDYRQRRRDIDARGRQ |
| Ga0209687_11283392 | 3300026322 | Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLE |
| Ga0257161_10281102 | 3300026508 | Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLEYGVA |
| Ga0179587_103327981 | 3300026557 | Vadose Zone Soil | MSDTEIGALRAKLLSRERSDDYRQRRKDFDVGFSQYGIARDVTVEPVNANGVRA |
| Ga0208489_10001141 | 3300027065 | Forest Soil | MADAEIVSLRAKLASRPRSDDYRQRRRDFDARSLEYGVAS |
| Ga0209219_11624403 | 3300027565 | Forest Soil | MSDPEIGALRAKLASRPRSDDYHQRRKDIDARGLAYGLAGDV |
| Ga0209331_10481742 | 3300027603 | Forest Soil | MARERDMSDTEIGALRQKLASRPRSDDYRQRRKDMDAG |
| Ga0209488_109597651 | 3300027903 | Vadose Zone Soil | MSDAEIQVLRAKLAARPRSPDYRQRRKDIDARGLE |
| Ga0209061_11081502 | 3300027968 | Surface Soil | MSDPQLVALRAKLAARPRSDDYRQRRRDIDARGREY |
| Ga0209526_107790011 | 3300028047 | Forest Soil | MSDPEIGALRAKLASRPRSDDYHQRRKDIDARGLAYGLAGDVVVE |
| Ga0308309_101965114 | 3300028906 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARSLEYKIASDVTVEPATANGVRAESTL |
| Ga0308309_103584844 | 3300028906 | Soil | MNDMEIGALRQKLASRVRSDDYRQRRKDMDARSLEY |
| Ga0308309_116190752 | 3300028906 | Soil | MSDPEIIALREKLLSRPRADDYRQRRKDIDARGLAYGLAPDIVVEKVS |
| Ga0302326_130696663 | 3300031525 | Palsa | MSDPEIGALRAKLLSRPVTTDIRERRKNMDARGLAYGLA |
| Ga0318516_104762421 | 3300031543 | Soil | MGGTEIAALRAKLASRPHSDDYRQRRKDIDARGLQYDLAPDIGVEPVS |
| Ga0318516_107958621 | 3300031543 | Soil | MNDTEIGALRAKLASRVRSDDYRQRRRDMDAGFLQYGM |
| Ga0318541_100833962 | 3300031545 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAETQM |
| Ga0318538_103791902 | 3300031546 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKI |
| Ga0318571_104696902 | 3300031549 | Soil | MSDTEIGALRAKLASRVRSDDYRQRRRDMDAGFLQYGIARDVTVEVH |
| Ga0318528_102880771 | 3300031561 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYK |
| Ga0318528_106058001 | 3300031561 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTVEPVTAN |
| Ga0307436_11792072 | 3300031563 | Salt Marsh | MSDREIVALREKLASRPRSDDYRQRRRDIDARGLEY |
| Ga0318573_100055066 | 3300031564 | Soil | MSDSEIGALRAKLASRVRSDDYRQHRRDMDAGFLQYGIAR |
| Ga0318573_102790201 | 3300031564 | Soil | MSDTEIGALRAKLMSRPRSDDYRQRRRDIDARGLQYGLASDVSVDVH |
| Ga0310915_101699341 | 3300031573 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARARVQDCAG |
| Ga0310915_102344371 | 3300031573 | Soil | MTDTEIGALRAKLAARPRSDDYRQRRKDIDSRGLE |
| Ga0318560_103506032 | 3300031682 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRRDMDARALE |
| Ga0310686_1001159931 | 3300031708 | Soil | MSDAEMGALRAKLASRPRSDDYRQRRKDIDTRGLQYGLAADVGVE |
| Ga0307474_105109312 | 3300031718 | Hardwood Forest Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDAGFLQYG |
| Ga0307474_106721052 | 3300031718 | Hardwood Forest Soil | MNDMEIGALRQKLASRVRSDDYRQRRKDMDSRSLEYKIAPDV |
| Ga0306917_107145961 | 3300031719 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDV |
| Ga0307469_116256581 | 3300031720 | Hardwood Forest Soil | MTRESGMSDTEIGALRAKLASRERSDDYRQRRKDFDVG |
| Ga0318500_106831252 | 3300031724 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPD |
| Ga0306918_104293361 | 3300031744 | Soil | MNDTEIGALRQKLASRGRSDDYRQRRKDMDARALEYKIAPDVTVEPVT |
| Ga0306918_109459552 | 3300031744 | Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIARD |
| Ga0318494_102435031 | 3300031751 | Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDMDAAFSQYRVAPEVTVE |
| Ga0318494_105082252 | 3300031751 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVT |
| Ga0318494_105745962 | 3300031751 | Soil | MGDPEIAALRAKLASRPRSDDYRQRRKDIDARGLQY |
| Ga0318494_107034351 | 3300031751 | Soil | SDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAETQM |
| Ga0318494_107199852 | 3300031751 | Soil | MIDTEIGALRAKLASRVRSDDYWQRRKDMDTGFSHYGIARDVTVEPVTAN |
| Ga0318494_108793101 | 3300031751 | Soil | MSDTEIGALRVKLMSRPRSDDYRQRRRDIDARGLQYG |
| Ga0318537_102279822 | 3300031763 | Soil | MGGTEIAALRAKLASRPHSDDYRQRRKDIDARGLQYD |
| Ga0318509_105363791 | 3300031768 | Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIARDVAVEP |
| Ga0318509_108530392 | 3300031768 | Soil | MGGTEIAALRAKLASRPHSDDYRQRRKDIDARGLQYDLAPDIGV |
| Ga0318521_110500112 | 3300031770 | Soil | MGGTEIAALRAKLASRPHSDDYRQRRKDIDARGLQYDLAPDIGVEPVSTNGV |
| Ga0318546_101906142 | 3300031771 | Soil | DTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAETQM |
| Ga0318546_110158011 | 3300031771 | Soil | MSDTEIGALRAKLASRVRSEDYRQRRRDMDAGFLQYGIARDVTVEPASANGVRAE |
| Ga0318566_106626802 | 3300031779 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTV |
| Ga0318552_105382091 | 3300031782 | Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTV |
| Ga0318523_106174361 | 3300031798 | Soil | MGDPEIAALRAKLASRPRSDDYRQRRKDIDARGLQYD |
| Ga0318568_100891501 | 3300031819 | Soil | MGDPEIAALRAKLASRPRSDDYRQRRKDIDARGLQYDLAPDVAV |
| Ga0318567_104668591 | 3300031821 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRRDMDAGFRQYAIARDVTIEPVTGNGVRAE |
| Ga0318567_108138241 | 3300031821 | Soil | MSDTEIGALRQKLASRVRSDDYRQRCRDMDAAFSQYR |
| Ga0318499_103517102 | 3300031832 | Soil | MSDTEIGALRAKLMSRPRSDDYRQRRRDIDARGLQYGLASDVSVEVTS |
| Ga0310917_111064772 | 3300031833 | Soil | MSDTEIGALRAKLACRVRSDDYRQRRKDFDARASEYKIA |
| Ga0318517_100451781 | 3300031835 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQ |
| Ga0318511_105174811 | 3300031845 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRRDMDAAFSQY |
| Ga0318511_105929462 | 3300031845 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAET |
| Ga0318512_104441792 | 3300031846 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTVEPVTANGV |
| Ga0318527_102775901 | 3300031859 | Soil | MSDTEIGALRAKLASRVRSEDYRQRRRDMDAGFLQYGIARDVTVEPAS |
| Ga0306925_100123571 | 3300031890 | Soil | EIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTGQPAETQM |
| Ga0306925_106859771 | 3300031890 | Soil | MNDTEIGALRQKLASRGRSDDYRQRRKDMDARALEYKIAP |
| Ga0318536_106632351 | 3300031893 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDV |
| Ga0318551_106485451 | 3300031896 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIAPDVTVEPVTLPKH |
| Ga0310913_111637681 | 3300031945 | Soil | MSDIEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIARDVA |
| Ga0310910_110320221 | 3300031946 | Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTVEPVTANGVRA |
| Ga0310909_104736132 | 3300031947 | Soil | VSDVEIGALRAKLASRPWSDDYRQRRNDIDTRGLQYGVKPEVTVEPVNTN |
| Ga0310909_105947102 | 3300031947 | Soil | MSDSEIGALRAKLASRVRSDDYRQHRRDMDAGFLQYGIARDVTVEPVAA |
| Ga0306926_101916064 | 3300031954 | Soil | MGDTEIGALRAKLASRVRSDDYRQRRKDMDAAFSQYR |
| Ga0307479_121422731 | 3300031962 | Hardwood Forest Soil | MNDTEIGALRQKLASRVRSDDYRQRRKDMDARSLEYKIASDVTVEPATANGVRAEW |
| Ga0306922_119887052 | 3300032001 | Soil | MSDPEITALRAQLASRPRSDDYRQMRKDLDALRLAFG |
| Ga0318562_100592743 | 3300032008 | Soil | MSDIEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIARDVAVEP |
| Ga0318569_104925321 | 3300032010 | Soil | MSDTEISALRQKLASRQRSDDYRQRRKDMDALFSQYGIARDVTV |
| Ga0318569_105831232 | 3300032010 | Soil | MSDTEIGALRAKLMSRPRSDDYRQRRRDIDARGLQY |
| Ga0310911_102645371 | 3300032035 | Soil | MNDTEIGALRQKLASRGRSDDYRQRRKDMDARALEYKI |
| Ga0310911_104848552 | 3300032035 | Soil | MTDTEIGALRAKLAARPRSDDYRQRRKDIDSRGLEY |
| Ga0318559_100576714 | 3300032039 | Soil | MSDTEIGALREKLASRVRADDYRQRRKDMDAGFLQYG |
| Ga0318559_105204832 | 3300032039 | Soil | MNDTEIGALRQKLASRGRSDDYRQRRKDMDARALEYKIAPDVTVEPV |
| Ga0318559_106248922 | 3300032039 | Soil | MSDPEIGALRQKLASRVRSEDYRQRRKDMDARALEYKIAPDV |
| Ga0318549_102466651 | 3300032041 | Soil | MSDTEIGALRQKLASRVRSDDYRQRRKDMDARALEYKIASDVTVEPV |
| Ga0318532_100210952 | 3300032051 | Soil | MSDIEIGALRAKLASRVRSDDYRQRRKDMDAGFLQYGIAR |
| Ga0318532_100798212 | 3300032051 | Soil | MSDTEIGALRAKLASRVRSDDYRQRRRDMDAGFLQYGIARDVTVEPVSSNG |
| Ga0318506_103314962 | 3300032052 | Soil | VSDVEIGALRAKLASRPRSDDYRQRRNDIDTRGLQYGVKPDVT |
| Ga0318505_102271751 | 3300032060 | Soil | MSDAEIGALRAKLASRPRSDDYRQRRKDIDARGLQYAL |
| Ga0318524_106095221 | 3300032067 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARD |
| Ga0318525_101416001 | 3300032089 | Soil | MSDTEIGALREKLVSRVRSDDYRQRRRDMDAGFLQYGIARDVTVEPVSANGV |
| Ga0318540_105196292 | 3300032094 | Soil | MSDTEIGALREKLASRVRSDDYRQRRKDMDAGFLQYGIARDVTVEPLTANGVRAE |
| Ga0348332_108614721 | 3300032515 | Plant Litter | MRDAEIGALRAKLASRPRSDDYRQRRKDIDARGRQYGL |
| Ga0335077_109518641 | 3300033158 | Soil | MSDPEISALREKLLSRPRTTDYVQRRKDIDARGLAYG |
| ⦗Top⦘ |