


| Basic Information | |
|---|---|
| Family ID | F031584 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLA |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.12 % |
| % of genes near scaffold ends (potentially truncated) | 96.70 % |
| % of genes from short scaffolds (< 2000 bps) | 83.52 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (20.879 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.066 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.341 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 14.84 |
| PF04392 | ABC_sub_bind | 13.19 |
| PF01451 | LMWPc | 1.10 |
| PF00211 | Guanylate_cyc | 1.10 |
| PF00144 | Beta-lactamase | 1.10 |
| PF13185 | GAF_2 | 1.10 |
| PF13460 | NAD_binding_10 | 1.10 |
| PF03073 | TspO_MBR | 1.10 |
| PF12697 | Abhydrolase_6 | 1.10 |
| PF12847 | Methyltransf_18 | 0.55 |
| PF01925 | TauE | 0.55 |
| PF03976 | PPK2 | 0.55 |
| PF01557 | FAA_hydrolase | 0.55 |
| PF14226 | DIOX_N | 0.55 |
| PF07484 | Collar | 0.55 |
| PF02275 | CBAH | 0.55 |
| PF13561 | adh_short_C2 | 0.55 |
| PF13432 | TPR_16 | 0.55 |
| PF03734 | YkuD | 0.55 |
| PF12680 | SnoaL_2 | 0.55 |
| PF00571 | CBS | 0.55 |
| PF00903 | Glyoxalase | 0.55 |
| PF06100 | MCRA | 0.55 |
| PF07345 | DUF1476 | 0.55 |
| PF03060 | NMO | 0.55 |
| PF00805 | Pentapeptide | 0.55 |
| PF12833 | HTH_18 | 0.55 |
| PF05545 | FixQ | 0.55 |
| PF07647 | SAM_2 | 0.55 |
| PF13545 | HTH_Crp_2 | 0.55 |
| PF04134 | DCC1-like | 0.55 |
| PF07045 | DUF1330 | 0.55 |
| PF13594 | Obsolete Pfam Family | 0.55 |
| PF00230 | MIP | 0.55 |
| PF02566 | OsmC | 0.55 |
| PF01717 | Meth_synt_2 | 0.55 |
| PF13515 | FUSC_2 | 0.55 |
| PF00115 | COX1 | 0.55 |
| PF01565 | FAD_binding_4 | 0.55 |
| PF08031 | BBE | 0.55 |
| PF06762 | LMF1 | 0.55 |
| PF13560 | HTH_31 | 0.55 |
| PF04546 | Sigma70_ner | 0.55 |
| PF13936 | HTH_38 | 0.55 |
| PF00999 | Na_H_Exchanger | 0.55 |
| PF00413 | Peptidase_M10 | 0.55 |
| PF01872 | RibD_C | 0.55 |
| PF09865 | DUF2092 | 0.55 |
| PF09851 | SHOCT | 0.55 |
| PF13505 | OMP_b-brl | 0.55 |
| PF03171 | 2OG-FeII_Oxy | 0.55 |
| PF13676 | TIR_2 | 0.55 |
| PF00884 | Sulfatase | 0.55 |
| PF13924 | Lipocalin_5 | 0.55 |
| PF03466 | LysR_substrate | 0.55 |
| PF00536 | SAM_1 | 0.55 |
| PF13419 | HAD_2 | 0.55 |
| PF03625 | DUF302 | 0.55 |
| PF00924 | MS_channel | 0.55 |
| PF04002 | RadC | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 14.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 13.19 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.10 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.10 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.10 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 1.10 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.55 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.55 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.55 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.55 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.55 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.55 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.55 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.55 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.55 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.55 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.55 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.55 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.55 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.55 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.55 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.55 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG3049 | Penicillin V acylase or related amidase, Ntn superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
| COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.55 |
| COG4736 | Cbb3-type cytochrome oxidase, subunit 3 | Energy production and conversion [C] | 0.55 |
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 0.55 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.55 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.92 % |
| Unclassified | root | N/A | 23.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000670|JGI12454J11922_100101 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300000670|JGI12454J11922_100655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300000678|JGI12377J11919_100102 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300000680|JGI12452J11691_100062 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300000682|JGI12334J11920_100171 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300000695|JGI12539J11930_100397 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300000717|JGI12543J11896_100743 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300000856|JGI12376J12823_100083 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300000898|JGI12368J12877_100237 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300000909|JGI12488J12863_102846 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300000935|JGI12407J12866_102603 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300001867|JGI12627J18819_10061065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1570 | Open in IMG/M |
| 3300003992|Ga0055470_10016347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1311 | Open in IMG/M |
| 3300004006|Ga0055453_10140371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 736 | Open in IMG/M |
| 3300004633|Ga0066395_10024516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2441 | Open in IMG/M |
| 3300005332|Ga0066388_100064369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3921 | Open in IMG/M |
| 3300005332|Ga0066388_101450543 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005332|Ga0066388_102737125 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300005332|Ga0066388_104060041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 746 | Open in IMG/M |
| 3300005332|Ga0066388_104828028 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005332|Ga0066388_107679616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300005334|Ga0068869_101021852 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005439|Ga0070711_100369059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1158 | Open in IMG/M |
| 3300005441|Ga0070700_100311740 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300005526|Ga0073909_10056839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium tibeticum | 1438 | Open in IMG/M |
| 3300005537|Ga0070730_10128546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1733 | Open in IMG/M |
| 3300005543|Ga0070672_101395243 | Not Available | 626 | Open in IMG/M |
| 3300005548|Ga0070665_100234657 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300005556|Ga0066707_10792122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300005591|Ga0070761_10070409 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300005610|Ga0070763_10039926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2190 | Open in IMG/M |
| 3300005610|Ga0070763_10115345 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300005617|Ga0068859_102007821 | Not Available | 639 | Open in IMG/M |
| 3300005713|Ga0066905_101222570 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005713|Ga0066905_102273924 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005713|Ga0066905_102295074 | Not Available | 504 | Open in IMG/M |
| 3300005764|Ga0066903_100474367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2105 | Open in IMG/M |
| 3300005764|Ga0066903_100560365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1963 | Open in IMG/M |
| 3300005764|Ga0066903_100641931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1853 | Open in IMG/M |
| 3300005764|Ga0066903_100733285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1750 | Open in IMG/M |
| 3300005764|Ga0066903_100898428 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300005764|Ga0066903_102529245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. | 994 | Open in IMG/M |
| 3300005764|Ga0066903_102767077 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005764|Ga0066903_103194326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 886 | Open in IMG/M |
| 3300005764|Ga0066903_103763346 | Not Available | 815 | Open in IMG/M |
| 3300005764|Ga0066903_103941041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 796 | Open in IMG/M |
| 3300005764|Ga0066903_104973334 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005764|Ga0066903_105288163 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005764|Ga0066903_105521656 | Not Available | 666 | Open in IMG/M |
| 3300005764|Ga0066903_107849681 | Not Available | 548 | Open in IMG/M |
| 3300005841|Ga0068863_101658585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300005921|Ga0070766_10042450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2526 | Open in IMG/M |
| 3300005921|Ga0070766_10916501 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005937|Ga0081455_10080004 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300005937|Ga0081455_10116997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2107 | Open in IMG/M |
| 3300005937|Ga0081455_10125684 | Not Available | 2013 | Open in IMG/M |
| 3300006028|Ga0070717_11366535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300006046|Ga0066652_101208859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300006046|Ga0066652_101672398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300006057|Ga0075026_100118700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1330 | Open in IMG/M |
| 3300006057|Ga0075026_100997423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300006102|Ga0075015_100495933 | Not Available | 703 | Open in IMG/M |
| 3300006175|Ga0070712_101025986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300006176|Ga0070765_100064623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 3044 | Open in IMG/M |
| 3300006176|Ga0070765_100455290 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300006176|Ga0070765_101466176 | Not Available | 642 | Open in IMG/M |
| 3300006195|Ga0075366_10653105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis | 653 | Open in IMG/M |
| 3300006354|Ga0075021_10383746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300006354|Ga0075021_10609048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300006893|Ga0073928_10064340 | All Organisms → cellular organisms → Bacteria | 3219 | Open in IMG/M |
| 3300006914|Ga0075436_100966175 | Not Available | 639 | Open in IMG/M |
| 3300009094|Ga0111539_12653738 | Not Available | 581 | Open in IMG/M |
| 3300009147|Ga0114129_10609840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 1413 | Open in IMG/M |
| 3300009521|Ga0116222_1028056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2506 | Open in IMG/M |
| 3300009683|Ga0116224_10162427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1074 | Open in IMG/M |
| 3300009801|Ga0105056_1012920 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300010047|Ga0126382_11903056 | Not Available | 563 | Open in IMG/M |
| 3300010048|Ga0126373_10131980 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300010358|Ga0126370_10113252 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300010359|Ga0126376_10700713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 974 | Open in IMG/M |
| 3300010361|Ga0126378_10482430 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300010366|Ga0126379_10462624 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300010375|Ga0105239_10709508 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300010375|Ga0105239_12479762 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia | 604 | Open in IMG/M |
| 3300010376|Ga0126381_101482915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 980 | Open in IMG/M |
| 3300010379|Ga0136449_100189634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3935 | Open in IMG/M |
| 3300010379|Ga0136449_100663719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1759 | Open in IMG/M |
| 3300010379|Ga0136449_101673912 | Not Available | 961 | Open in IMG/M |
| 3300010379|Ga0136449_103076949 | Not Available | 648 | Open in IMG/M |
| 3300010379|Ga0136449_103775504 | Not Available | 570 | Open in IMG/M |
| 3300010379|Ga0136449_104445653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 516 | Open in IMG/M |
| 3300010397|Ga0134124_12302266 | Not Available | 579 | Open in IMG/M |
| 3300010398|Ga0126383_10178871 | Not Available | 2013 | Open in IMG/M |
| 3300012918|Ga0137396_11266338 | Not Available | 515 | Open in IMG/M |
| 3300012948|Ga0126375_11711623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300012955|Ga0164298_11559895 | Not Available | 518 | Open in IMG/M |
| 3300012957|Ga0164303_10671413 | Not Available | 694 | Open in IMG/M |
| 3300012971|Ga0126369_10013922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6283 | Open in IMG/M |
| 3300012971|Ga0126369_10027541 | All Organisms → cellular organisms → Bacteria | 4638 | Open in IMG/M |
| 3300012988|Ga0164306_11837197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex | 527 | Open in IMG/M |
| 3300013297|Ga0157378_11965769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300013308|Ga0157375_13806278 | Not Available | 501 | Open in IMG/M |
| 3300014495|Ga0182015_10119900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1808 | Open in IMG/M |
| 3300014495|Ga0182015_10219875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1263 | Open in IMG/M |
| 3300015371|Ga0132258_10945887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2176 | Open in IMG/M |
| 3300015372|Ga0132256_102887052 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300015373|Ga0132257_102823906 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300016294|Ga0182041_10229955 | Not Available | 1497 | Open in IMG/M |
| 3300016319|Ga0182033_10388441 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300016319|Ga0182033_12049302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium pseudokansasii | 521 | Open in IMG/M |
| 3300016357|Ga0182032_10156806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1691 | Open in IMG/M |
| 3300016371|Ga0182034_10356762 | Not Available | 1188 | Open in IMG/M |
| 3300016371|Ga0182034_10910948 | Not Available | 756 | Open in IMG/M |
| 3300016404|Ga0182037_11453472 | Not Available | 607 | Open in IMG/M |
| 3300016445|Ga0182038_11182561 | Not Available | 681 | Open in IMG/M |
| 3300017924|Ga0187820_1057765 | Not Available | 1059 | Open in IMG/M |
| 3300017943|Ga0187819_10260130 | Not Available | 1014 | Open in IMG/M |
| 3300017946|Ga0187879_10179809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1189 | Open in IMG/M |
| 3300017959|Ga0187779_10096975 | Not Available | 1773 | Open in IMG/M |
| 3300017959|Ga0187779_10521283 | Not Available | 788 | Open in IMG/M |
| 3300017959|Ga0187779_10775753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300017974|Ga0187777_11184043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300018040|Ga0187862_10337966 | Not Available | 939 | Open in IMG/M |
| 3300018044|Ga0187890_10031338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 3230 | Open in IMG/M |
| 3300018057|Ga0187858_10326236 | Not Available | 967 | Open in IMG/M |
| 3300018090|Ga0187770_10691728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 813 | Open in IMG/M |
| 3300021088|Ga0210404_10438947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300021178|Ga0210408_11237800 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300021403|Ga0210397_10402570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
| 3300021403|Ga0210397_10498072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 922 | Open in IMG/M |
| 3300021405|Ga0210387_10028993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4352 | Open in IMG/M |
| 3300021432|Ga0210384_10127171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2286 | Open in IMG/M |
| 3300025915|Ga0207693_10400930 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300025930|Ga0207701_10108118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2489 | Open in IMG/M |
| 3300026552|Ga0209577_10185133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1611 | Open in IMG/M |
| 3300026945|Ga0207743_1001229 | Not Available | 3492 | Open in IMG/M |
| 3300026981|Ga0207822_1018169 | Not Available | 770 | Open in IMG/M |
| 3300027330|Ga0207777_1040061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300027497|Ga0208199_1073505 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027635|Ga0209625_1029917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1213 | Open in IMG/M |
| 3300027783|Ga0209448_10200237 | Not Available | 662 | Open in IMG/M |
| 3300027854|Ga0209517_10366397 | Not Available | 820 | Open in IMG/M |
| 3300027855|Ga0209693_10001943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9072 | Open in IMG/M |
| 3300027894|Ga0209068_10532343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300028047|Ga0209526_10323736 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300030986|Ga0308154_109859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300031368|Ga0307429_1087782 | Not Available | 894 | Open in IMG/M |
| 3300031538|Ga0310888_10108005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1426 | Open in IMG/M |
| 3300031543|Ga0318516_10278380 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031546|Ga0318538_10121817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1362 | Open in IMG/M |
| 3300031562|Ga0310886_10000397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11463 | Open in IMG/M |
| 3300031563|Ga0307436_1065907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300031564|Ga0318573_10167968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1155 | Open in IMG/M |
| 3300031573|Ga0310915_10003797 | All Organisms → cellular organisms → Bacteria | 8212 | Open in IMG/M |
| 3300031640|Ga0318555_10495403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 662 | Open in IMG/M |
| 3300031736|Ga0318501_10323420 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031744|Ga0306918_10665038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 815 | Open in IMG/M |
| 3300031777|Ga0318543_10325888 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031779|Ga0318566_10368711 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031819|Ga0318568_10057784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2254 | Open in IMG/M |
| 3300031833|Ga0310917_10883474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300031846|Ga0318512_10685299 | Not Available | 525 | Open in IMG/M |
| 3300031854|Ga0310904_10132980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300031879|Ga0306919_10226410 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300031897|Ga0318520_10092215 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300031942|Ga0310916_10473103 | Not Available | 1067 | Open in IMG/M |
| 3300031943|Ga0310885_10395939 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia | 735 | Open in IMG/M |
| 3300031945|Ga0310913_10175825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300031947|Ga0310909_10988212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300032003|Ga0310897_10222901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300032009|Ga0318563_10700522 | Not Available | 544 | Open in IMG/M |
| 3300032017|Ga0310899_10514605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 589 | Open in IMG/M |
| 3300032035|Ga0310911_10367451 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300032059|Ga0318533_10279549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1208 | Open in IMG/M |
| 3300032066|Ga0318514_10143836 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300032091|Ga0318577_10166924 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300032160|Ga0311301_10164734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3943 | Open in IMG/M |
| 3300032160|Ga0311301_10213056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 3278 | Open in IMG/M |
| 3300032892|Ga0335081_10114069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3973 | Open in IMG/M |
| 3300033289|Ga0310914_10409732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1227 | Open in IMG/M |
| 3300033289|Ga0310914_11366359 | Not Available | 611 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.20% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.10% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.10% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000670 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 | Environmental | Open in IMG/M |
| 3300000678 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 | Environmental | Open in IMG/M |
| 3300000680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 | Environmental | Open in IMG/M |
| 3300000682 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 | Environmental | Open in IMG/M |
| 3300000695 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 | Environmental | Open in IMG/M |
| 3300000717 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 | Environmental | Open in IMG/M |
| 3300000856 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 | Environmental | Open in IMG/M |
| 3300000898 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 58 | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300000935 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12454J11922_1001011 | 3300000670 | Tropical Forest Soil | QRDCNSSTALEFGPLMSALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12454J11922_1006552 | 3300000670 | Tropical Forest Soil | MSALGHVWTAPWQELSDVAAALVGCGHVSGLLMRRMCRWP* |
| JGI12377J11919_1001021 | 3300000678 | Tropical Forest Soil | ALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12452J11691_1000623 | 3300000680 | Tropical Forest Soil | HPTGGMSTKGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12334J11920_1001712 | 3300000682 | Tropical Forest Soil | LMSALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12539J11930_1003972 | 3300000695 | Tropical Forest Soil | ALEFGPLMSALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12543J11896_1007432 | 3300000717 | Tropical Forest Soil | MEIAMSALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12376J12823_1000831 | 3300000856 | Tropical Forest Soil | KTSSRNVALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12368J12877_1002372 | 3300000898 | Tropical Forest Soil | SALGHVWTAPWQELSDASAALVGCGHVSGLLMRPM* |
| JGI12488J12863_1028461 | 3300000909 | Tropical Forest Soil | YALGHVWTAPWQELSDVAAALVGCGHVSGLLMRRMCRWP* |
| JGI12407J12866_1026032 | 3300000935 | Tropical Forest Soil | GHVWTAPWQELSDASAALVGCGHVSGLFVRHNGRWP* |
| JGI12627J18819_100610653 | 3300001867 | Forest Soil | LGHVWTAPWQELSDVLQQVGCGHVSGLLMRQVGRWP* |
| JGIcombinedJ51221_100293803 | 3300003505 | Forest Soil | EVIAWPMPALGHVWTAPDWQELLDVDAALVGCGHVSGLT* |
| Ga0055470_100163472 | 3300003992 | Natural And Restored Wetlands | MSALGHVWTAPWQELSDMSAALVGCGHVSGLLMRRCGRWP* |
| Ga0055453_101403711 | 3300004006 | Natural And Restored Wetlands | LGHVWTAPFWQGVFWVQLVECCHVSGLLMRRVVPLALMRSAWA |
| Ga0066395_100245161 | 3300004633 | Tropical Forest Soil | MGNATVHRQMSAKGHVWTAPWQEPSDVIAALVGCGHVSGLLMRQERPLALML |
| Ga0066388_10006436910 | 3300005332 | Tropical Forest Soil | MSPLGHVWTAPWQEPSDVVAALVGCGHVSGLLMRQERPLALM |
| Ga0066388_1014505433 | 3300005332 | Tropical Forest Soil | MRSRSSTKGAALGHVWTAPWQEPSDVVAALVGCGHVSGLLMRQERPLALM |
| Ga0066388_1027371251 | 3300005332 | Tropical Forest Soil | MGLAKSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLA |
| Ga0066388_1040600413 | 3300005332 | Tropical Forest Soil | MSPLGHVWTAPWQVLSDASAALVGCGHVSGLFVRPMWPLAIML |
| Ga0066388_1048280281 | 3300005332 | Tropical Forest Soil | MLTASLPMSAPGHVWTAPWQELSDVAAALVGCGHVSGLLMRRGWPLALMLCAD |
| Ga0066388_1076796162 | 3300005332 | Tropical Forest Soil | MPDLGHVWTAPWQEPSDVIAALVGCGHVSGLLMRQERPLALM |
| Ga0068869_1010218521 | 3300005334 | Miscanthus Rhizosphere | ALGHVWTAPWQELSDASAALVGCGHVSGLLMRRGYGRWP* |
| Ga0070711_1003690592 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHVWTAPWQELSDVSAALVECGHVSGLLMRQVWPLALMLCAD |
| Ga0070700_1003117401 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVWTAPWQELSDGLQQVGCGHVSGLLMRQVWPLALALRGSGPNR* |
| Ga0073909_100568391 | 3300005526 | Surface Soil | MSALGHVWTAPWQVLSDGSAALVGCGHVSGLLMRRCGRWP* |
| Ga0070730_101285462 | 3300005537 | Surface Soil | MSASGHVWTAPWQELSDVSAALVGCGHVSGLLVRHL* |
| Ga0070672_1013952432 | 3300005543 | Miscanthus Rhizosphere | MSAMGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVWPLALMLCAD |
| Ga0070665_1002346572 | 3300005548 | Switchgrass Rhizosphere | MPALGHVWTAPWQELCDVDAGLGGCGHVSGLLVRR* |
| Ga0066707_107921222 | 3300005556 | Soil | MGHVWTAPWQELSDVAAALVGCGHVSGLLMRQVWPLALMLCAD |
| Ga0070761_100704092 | 3300005591 | Soil | MGHVWTAPWQELSDVSAALVGCGHVSGLLMRQCGRWP* |
| Ga0070763_100399264 | 3300005610 | Soil | MGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPL |
| Ga0070763_101153452 | 3300005610 | Soil | FLHSQGHVWTAPWQELSDGLQQVGCGHVSGLLVRQGGRWP* |
| Ga0068859_1020078212 | 3300005617 | Switchgrass Rhizosphere | MSALGHVWTAPWQGLSDVSAALVGCGHVSGLLMRQVWPLAL |
| Ga0066905_1012225701 | 3300005713 | Tropical Forest Soil | MSALGHVWTAPWQELSDAAAALVGCGHVSGLFVRRSSR |
| Ga0066905_1022739242 | 3300005713 | Tropical Forest Soil | MSVSGHVWTALDWQELSYVGAALVGCGHVSGLLMRHGWPLALM |
| Ga0066905_1022950741 | 3300005713 | Tropical Forest Soil | VWTALDWQELSYVGAALVGCGHVSGLLMRHGWPLALM |
| Ga0066903_1004743673 | 3300005764 | Tropical Forest Soil | MSALGHVWTAPPWQELSDVGAALVGCGHVSGLFVRRLKP |
| Ga0066903_1005603651 | 3300005764 | Tropical Forest Soil | MSAMGHVWTAPWQEDFDVVQQVGCGHVSGLLVRQVWPLALML |
| Ga0066903_1006419311 | 3300005764 | Tropical Forest Soil | MTRTSRMSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLA |
| Ga0066903_1007332851 | 3300005764 | Tropical Forest Soil | MSALGHVWTAPWQEDFDVVQQVGCGHVSGLLVRQVWPLALML |
| Ga0066903_1008984283 | 3300005764 | Tropical Forest Soil | ALGHVWTAPWQELSDVAAALVGCGHVSGLLMRRMCRWP* |
| Ga0066903_1025292452 | 3300005764 | Tropical Forest Soil | MTSALGHVWTAPWQEPSDVIATLVGCGHVSGLLMRQERPLALM |
| Ga0066903_1027670771 | 3300005764 | Tropical Forest Soil | MSGLGHVWTAPWQEHSEGSAGLVGCGHVSGLLMRHHGPLALMLCA |
| Ga0066903_1031943261 | 3300005764 | Tropical Forest Soil | MASLMSALGHVWTAPWQELSDVAAALVGCGHVSGLLMRRMCRW |
| Ga0066903_1037633461 | 3300005764 | Tropical Forest Soil | MSALGHVWTAPPWQELSDAAAALVGCGHVCGLFVRPVWPL |
| Ga0066903_1039410412 | 3300005764 | Tropical Forest Soil | MGHVWTAPWQEPSDVIATLVGCGHVSGLLMRQERPLALM |
| Ga0066903_1049733341 | 3300005764 | Tropical Forest Soil | MSALGHVWTAPWQGHCEIGAGLVGCGHVSGLLMRHDGPLAL |
| Ga0066903_1052881632 | 3300005764 | Tropical Forest Soil | MGHVWTAPWQEPSDVIATLVGCGHVSGLLMRQERPLAL |
| Ga0066903_1055216561 | 3300005764 | Tropical Forest Soil | MSELGHVWTAPWQEPSDVIAALVGCGHVSGLLMRQERPLA |
| Ga0066903_1078496811 | 3300005764 | Tropical Forest Soil | MRSAVAMSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPL |
| Ga0068863_1016585852 | 3300005841 | Switchgrass Rhizosphere | MGHVWTAPWQGLSDVSAALVGCGHVSGLLMRQVWP |
| Ga0070766_100424501 | 3300005921 | Soil | MSGSAMSAMGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPLALML |
| Ga0070766_109165012 | 3300005921 | Soil | MTALGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQV |
| Ga0081455_100800041 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSNCPMSALGHVWTAPWQELSDAAAALVGCGHVSGLLMRRIRPLALMLC |
| Ga0081455_101169971 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSALGHVWTAPWQELSDAAALVGCGHVSGLLMRRICR |
| Ga0081455_101256841 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSALGHVWTAPWHVWTAPWQELSDAAAALFGCGHVSGLF |
| Ga0070717_113665353 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLGHVWTAPWQELSDVFAVLVGCGHVSGLLMRQVWPLALM |
| Ga0066652_1012088591 | 3300006046 | Soil | MPVMSLLGHVWTAPWQELSDGLQQVGCGHVSGLLMRQVWPLALML |
| Ga0066652_1016723982 | 3300006046 | Soil | MTGLGHVWTAPWQELSDGLQQVGCGHVSGLLMRQVWPLALML |
| Ga0075026_1001187001 | 3300006057 | Watersheds | MSVVGHVWTAPWQELSDVSAALVGCGHVSGLLMRQV |
| Ga0075026_1009974231 | 3300006057 | Watersheds | MSHLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQV |
| Ga0075015_1004959331 | 3300006102 | Watersheds | VQRTVNKASMSEVGHVWTAPWQELFDVSAALVGCGHVSGLLMRRGWPLALMLC |
| Ga0070712_1010259862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALGHVWTAPWQELSDVFAVLVGCGHVSGLLMRQVWPL |
| Ga0070765_1000646234 | 3300006176 | Soil | MSASGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPL |
| Ga0070765_1004552901 | 3300006176 | Soil | SALGHVWTAPWQELSDVSAALVGCGHVSGLLMRQCGRWP* |
| Ga0070765_1014661761 | 3300006176 | Soil | MSALGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPLA |
| Ga0075366_106531052 | 3300006195 | Populus Endosphere | VQANAKGHVWTAPWQEPSDVIAALVGCGHVSGLLMRQ |
| Ga0075021_103837462 | 3300006354 | Watersheds | MTGLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVWPLA |
| Ga0075021_106090481 | 3300006354 | Watersheds | MGHVWTAPWQELSNVSAALVGCGHVSGLLMRQVWPLALML |
| Ga0073928_100643404 | 3300006893 | Iron-Sulfur Acid Spring | MSQLGHVWTAPWQELSDVCAALVGCGHVSGLLMRRGWPLALMLC |
| Ga0075436_1009661751 | 3300006914 | Populus Rhizosphere | MFKASSAMSAPGHVWTAPPWQELSDVCAALVGCGHVSGL |
| Ga0111539_126537382 | 3300009094 | Populus Rhizosphere | VWTAPWQELSDVAAALVGCGHVSGLLMRQVWPLALMLC |
| Ga0114129_106098401 | 3300009147 | Populus Rhizosphere | ENVGMQPCISALGHVWTAPWQELSDVAAALVGCGHVSGLLMRQV* |
| Ga0116222_10280561 | 3300009521 | Peatlands Soil | MSAPGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLAIMLC |
| Ga0116224_101624272 | 3300009683 | Peatlands Soil | MLSLMMSAVGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVW |
| Ga0105056_10129202 | 3300009801 | Groundwater Sand | HVWTALNWQEFFLTLVQLVGCGHVSGLFMRHGWPLALMLSAN* |
| Ga0126382_119030561 | 3300010047 | Tropical Forest Soil | MSALGHVWTAPWQELSNVAAALVGCGHVSDLFVRRLSR |
| Ga0126373_101319801 | 3300010048 | Tropical Forest Soil | MSALGHVWTAPPWQELSELLAALVGCGHVSGLLMRPDVPL |
| Ga0126370_101132523 | 3300010358 | Tropical Forest Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKP |
| Ga0126376_107007131 | 3300010359 | Tropical Forest Soil | MSALGHVWTAPWQELSDVAAALVGCGHVSGLFVRR |
| Ga0126378_104824304 | 3300010361 | Tropical Forest Soil | VHHSTSWSLMSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLAI |
| Ga0126379_104626244 | 3300010366 | Tropical Forest Soil | MRSRSSTKGAALGHVWTAPWQEPSDVIAALVGCGHVSGLLMRLERPLALMLC |
| Ga0105239_107095081 | 3300010375 | Corn Rhizosphere | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLALMLC |
| Ga0105239_124797621 | 3300010375 | Corn Rhizosphere | MKSCMSGMGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLALMLC |
| Ga0126381_1014829152 | 3300010376 | Tropical Forest Soil | MRHSKNGGRMSATGHVWTAPWQEASDVIAALVGCGHVSGLLMRLERPLALML |
| Ga0136449_1001896341 | 3300010379 | Peatlands Soil | MMSAVGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLAIML |
| Ga0136449_1006637191 | 3300010379 | Peatlands Soil | MPALGHVWTAPWQELSDVSAALVGCGHVSGLLMRRVWPLALM |
| Ga0136449_1016739121 | 3300010379 | Peatlands Soil | MGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLALML |
| Ga0136449_1030769491 | 3300010379 | Peatlands Soil | MGHVWTAPWQELSDVGAALVGCGHVYGLFVRLGWPLA |
| Ga0136449_1037755041 | 3300010379 | Peatlands Soil | VWTAPWQELFDVSAALVGCGHVSGLLMRRGWPLALMLC |
| Ga0136449_1044456532 | 3300010379 | Peatlands Soil | MSGWPMSVLGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLA |
| Ga0134124_123022661 | 3300010397 | Terrestrial Soil | VWTAPWQELSDVAAALVGCGHVSGLLMRQVWPLALMLCAD |
| Ga0126383_101788712 | 3300010398 | Tropical Forest Soil | MPDLGHVWTAPWQEPSDVIAALVGCGHVSGLLMRQERPLALMLC |
| Ga0137396_112663381 | 3300012918 | Vadose Zone Soil | MDGANGWLMSELGHVWTAPWQELSDISAALVGCGHVSGLLMRQVWPLAL |
| Ga0126375_117116231 | 3300012948 | Tropical Forest Soil | MSALGHVWTAPWQELSDVAAALVGRGHVSGLFVRRIWPLALMLCADRV |
| Ga0164298_115598952 | 3300012955 | Soil | MGHVWTAPDWQELLDVDAALVGCGHVSVLFVRHGWPLA |
| Ga0164303_106714131 | 3300012957 | Soil | VAAGCPFCPHVWTAPWQELSDVFAALVGCGHVSGLLVRQVWPLAL |
| Ga0126369_100139221 | 3300012971 | Tropical Forest Soil | MRHSKNGGRMSAKGHVWTAPWQEPSDVIAALVGCGHVSGLLMRLERPLA |
| Ga0126369_100275416 | 3300012971 | Tropical Forest Soil | MPALGHVWTAPWQEPSDVIAALVGCGHVSGLLMRLERPLALMLC |
| Ga0164306_118371971 | 3300012988 | Soil | MAALGHVWTAPWQELSDVFAGLVGCGHVSGLLVRQVWPLALMLCA |
| Ga0157378_119657691 | 3300013297 | Miscanthus Rhizosphere | MGHVWTAPWQGLSDVSAALVGCGHVSGLLMRQVWPL |
| Ga0157375_138062781 | 3300013308 | Miscanthus Rhizosphere | RAKSALGHVGTAPWQGFLDVSAALVGCGHVSGLLIRQVWPLALVRNSAPS* |
| Ga0182015_101199001 | 3300014495 | Palsa | MSELGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLAIMLC |
| Ga0182015_102198751 | 3300014495 | Palsa | MFASGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLAIML |
| Ga0132258_109458871 | 3300015371 | Arabidopsis Rhizosphere | MSASGHVWTAPWQELSDVAAALVGCGHVSGLLMRQVWPL |
| Ga0132256_1028870521 | 3300015372 | Arabidopsis Rhizosphere | MSAQGHVWTAPWQELSDVAAALVGCSHVSGLLMRRGWP |
| Ga0132257_1028239061 | 3300015373 | Arabidopsis Rhizosphere | MGHVWTAPWQEPSDVAATLVGCGHVSGLLMRQVWPLAL |
| Ga0182041_102299551 | 3300016294 | Soil | MLRLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVWLLALM |
| Ga0182033_103884411 | 3300016319 | Soil | VTSALGHVWTAPWQELSDGSAALVGGGHVSGMFLRPLWQLAITVCA |
| Ga0182033_120493022 | 3300016319 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLAI |
| Ga0182032_101568061 | 3300016357 | Soil | YVAKAAMSALGHVWTAPWQELSDVSAALVGCGHVSGLLVRRMCRWP |
| Ga0182034_103567621 | 3300016371 | Soil | MLRLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVRPL |
| Ga0182034_109109482 | 3300016371 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLLMRHGWPL |
| Ga0182037_114534721 | 3300016404 | Soil | MSALGHVWTAPWQELSDVAAALVGCGHVSGLLMRRM |
| Ga0182038_111825612 | 3300016445 | Soil | MLRLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVW |
| Ga0187820_10577651 | 3300017924 | Freshwater Sediment | MQRLRTALGHVWTAPWQELSDVAAALVGCGHVSGLF |
| Ga0187819_102601301 | 3300017943 | Freshwater Sediment | MQRLRTALGHVWTAPWQELSDVAAALVGCGHVSGLFVRR |
| Ga0187879_101798091 | 3300017946 | Peatland | MSALGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLALMLF |
| Ga0187779_100969752 | 3300017959 | Tropical Peatland | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLVRQVWPLALMLC |
| Ga0187779_105212831 | 3300017959 | Tropical Peatland | MSALGHVWTAPWQELSDVSAALVGCGHVSGLLMRPVRPLALMLC |
| Ga0187779_107757531 | 3300017959 | Tropical Peatland | MTALGHVWTALWQELSDVSAALVGCGHVSGLFVRPMWPLALMLCAD |
| Ga0187777_111840432 | 3300017974 | Tropical Peatland | MYPSTSALGHVWTAPWQELSDVFAALVGCGHVSGLLVRQVWPLALMLC |
| Ga0187862_103379661 | 3300018040 | Peatland | MGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLA |
| Ga0187890_100313384 | 3300018044 | Peatland | VRYGKFGGLMSALGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLALMLF |
| Ga0187858_103262362 | 3300018057 | Peatland | MGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLALMLF |
| Ga0187770_106917281 | 3300018090 | Tropical Peatland | MTALGHVWTAPWQGLFDAAAALVGCGHVSGLLMRRGW |
| Ga0210404_104389472 | 3300021088 | Soil | MSASGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPLALML |
| Ga0210408_112378001 | 3300021178 | Soil | MSELGHVWTAPWQELSDASAALVGCGHVSGLLRRRVWPLALMLC |
| Ga0210397_104025701 | 3300021403 | Soil | MTASGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQVWPLALMLCAD |
| Ga0210397_104980721 | 3300021403 | Soil | MSALGHVWTAPWQGLSDVAAALVGCGHVSGLLMRRG |
| Ga0210387_100289936 | 3300021405 | Soil | MGHVWTAPWQELSDVFAALVGCGHVSGLLVRQVWPLALMLCA |
| Ga0210384_101271711 | 3300021432 | Soil | MGHVWTAPWQELSDVFAALVGCGHVSGLLVRQVWPLALMLCAD |
| Ga0207693_104009301 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAATGHVWTAPWEELSDVLQQLVGCGHVSGLLMRQVWP |
| Ga0207701_101081181 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSCMSGMGHVWTAPWQELSDVFAALVGCGHVSGLLMRL |
| Ga0209577_101851331 | 3300026552 | Soil | MSALGLLRTAPWQELSVVSAALVGCGHVSGLFVRPMWPLAL |
| Ga0207743_10012291 | 3300026945 | Tropical Forest Soil | FSAIALGHVWTAPWQELFDVAAALVGCGHVSGLFVRHNGRWP |
| Ga0207822_10181692 | 3300026981 | Tropical Forest Soil | VVSSAMGHVWTAPWQELSDVAAALVGCGHVSGLLM |
| Ga0207777_10400612 | 3300027330 | Tropical Forest Soil | MSALGHVWTAPWQELSDVVAALVGCGHVSGLLMRRMWPLA |
| Ga0208199_10735052 | 3300027497 | Peatlands Soil | MSAVGHVWTAPWQELSDVDAALVGCGHVSGLLMRRGWPLALMLCA |
| Ga0209625_10299172 | 3300027635 | Forest Soil | MSEMGHVWTAPWQELSDVAAALVGCGHVSGLLMRRGWPLALMLC |
| Ga0209448_102002371 | 3300027783 | Bog Forest Soil | MSGLGHVWTAPWQELSDVAAALVGCGHVSGLFVRP |
| Ga0209517_103663971 | 3300027854 | Peatlands Soil | MGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLAL |
| Ga0209693_100019431 | 3300027855 | Soil | MSASGHVWTAPWQGHSDVRAALVGCGHVSGLLMRQV |
| Ga0209068_105323431 | 3300027894 | Watersheds | MGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVWP |
| Ga0209526_103237361 | 3300028047 | Forest Soil | NPAVAMTAMGHVWTAPWQELSDVSAALVGCGHVSGLLMRRG |
| Ga0308154_1098591 | 3300030986 | Soil | MLLMGHVWTAPDWQELFDVDAALVGCRHVCGLFVRRAWPLALMLCADQ |
| Ga0307429_10877821 | 3300031368 | Salt Marsh | MSALGHVWTAPWQELSDVAAALVGCGHVSGLFVRLVWPLA |
| Ga0310888_101080053 | 3300031538 | Soil | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLAL |
| Ga0318516_102783801 | 3300031543 | Soil | MSQLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVRPLAL |
| Ga0318538_101218173 | 3300031546 | Soil | LLMGHVWTAPPWQELSDLAAALVGCGHVSGLFVRP |
| Ga0310886_100003971 | 3300031562 | Soil | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLA |
| Ga0307436_10659071 | 3300031563 | Salt Marsh | MGHVWTAPWQELSDVAAALVGCGHVSGLFVRLVWPLALMLCA |
| Ga0318573_101679682 | 3300031564 | Soil | AYPVSALGHVWTAPPWQELSDLAAALVGCGHVSGLFVRP |
| Ga0310915_1000379713 | 3300031573 | Soil | MSALGHVWTAPWQELSDAAAALVGCGHVSGLFVRRLS |
| Ga0318555_104954031 | 3300031640 | Soil | MGHVWTAPWQEHCEVDAGLVGCGHVSGLLLRYDGPLALML |
| Ga0318501_103234202 | 3300031736 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLAIM |
| Ga0306918_106650381 | 3300031744 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLA |
| Ga0318543_103258881 | 3300031777 | Soil | VLMSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRRMCRWP |
| Ga0318566_103687112 | 3300031779 | Soil | VHELSILSWGGGGARTASGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVWPLALM |
| Ga0318568_100577845 | 3300031819 | Soil | SALGHVWTAPPWQELSDLAAALVGCGHVSGLFVRP |
| Ga0310917_108834742 | 3300031833 | Soil | MFALGRVWTAPWQELPDAAAALVGCGHVSGLFVLPMW |
| Ga0318512_106852991 | 3300031846 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQLKPLAIMHC |
| Ga0310904_101329802 | 3300031854 | Soil | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLALMLCA |
| Ga0306919_102264101 | 3300031879 | Soil | EQLGAMSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRRMCRWP |
| Ga0318520_100922154 | 3300031897 | Soil | PYHSARAVVHHSKFKWLMSALGHVWTAPWQELSDVSAALVGCGHVSGLFMRPM |
| Ga0310916_104731031 | 3300031942 | Soil | MLRLGHVWTAPWQELSDVSAALVGCGHVSGLLMRQV |
| Ga0310885_103959391 | 3300031943 | Soil | MKSCMSGMGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLAL |
| Ga0310913_101758252 | 3300031945 | Soil | MSALGHVWTAPWQELSDASAALVGCGHVSGLFVRPMWPLAI |
| Ga0310909_109882121 | 3300031947 | Soil | MSASGHVWTAPWQELSDVSAALVGCGHVSGLLMRQVRPLALM |
| Ga0310897_102229012 | 3300032003 | Soil | MSALGHVWTAPWQELSDVFAALVGCGHVSGLLMRLVWPLALM |
| Ga0318563_107005221 | 3300032009 | Soil | DDAMGHVWTAPWQELSDIAAALVGCGHVSGLFVRR |
| Ga0310899_105146051 | 3300032017 | Soil | RLESGLGHVWTAPWQELSDVSAALVECGHVSGLLMRQVWPPALMPHRPG |
| Ga0310911_103674511 | 3300032035 | Soil | MSALGHVWTAPWQELSDIPAALVGCGHVSGLFVRQ |
| Ga0318533_102795491 | 3300032059 | Soil | KLAYPVSALGHVWTAPPWQELSDLAAALVGCGHVSGLFVRP |
| Ga0318514_101438362 | 3300032066 | Soil | FALSHVWTAPPWQKLSDAAAALLGCGHVSGLFVRR |
| Ga0318577_101669242 | 3300032091 | Soil | SYVAKAAMSALGHVWTAPWQELSDVSAALVGCGHVSGLLVRRMCRWP |
| Ga0311301_101647348 | 3300032160 | Peatlands Soil | MLSLMMSAVGHVWTAPWQELSDVAAALVGCGHVSGLFVRPVWPLAIMLC |
| Ga0311301_102130561 | 3300032160 | Peatlands Soil | VRYGKFGGLMSALGHVWTAPWQELSDAAAALVGCGHVSGLLMRRGWPLALMLFAD |
| Ga0335081_101140691 | 3300032892 | Soil | MSHLGHVWTAPWQELFDVFAALVGCGHVSGLLMRLGWPLALMLCA |
| Ga0310914_104097322 | 3300033289 | Soil | MSALGHVWTTPWQELSDASAALVGCGHVSGLFVRPMWPLAI |
| Ga0310914_113663592 | 3300033289 | Soil | MIIHAMTAMSALGHVWTAPWQELSDASAALVGCGH |
| ⦗Top⦘ |