


| Basic Information | |
|---|---|
| Family ID | F026576 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LATAIGLRATLLTVGVLGLALAAAAMLWSPVRRHRQLPAVAGE |
| Number of Associated Samples | 178 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.48 % |
| % of genes from short scaffolds (< 2000 bps) | 93.40 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.005 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (10.660 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.178 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF04996 | AstB | 30.96 |
| PF00202 | Aminotran_3 | 10.66 |
| PF00009 | GTP_EFTU | 3.55 |
| PF13414 | TPR_11 | 2.54 |
| PF00884 | Sulfatase | 2.54 |
| PF00515 | TPR_1 | 2.54 |
| PF03401 | TctC | 2.03 |
| PF16868 | NMT1_3 | 1.52 |
| PF00390 | malic | 1.02 |
| PF07452 | CHRD | 1.02 |
| PF12727 | PBP_like | 1.02 |
| PF13650 | Asp_protease_2 | 1.02 |
| PF01411 | tRNA-synt_2c | 1.02 |
| PF01507 | PAPS_reduct | 1.02 |
| PF03949 | Malic_M | 1.02 |
| PF00106 | adh_short | 0.51 |
| PF13379 | NMT1_2 | 0.51 |
| PF05023 | Phytochelatin | 0.51 |
| PF01494 | FAD_binding_3 | 0.51 |
| PF07973 | tRNA_SAD | 0.51 |
| PF04015 | DUF362 | 0.51 |
| PF04241 | DUF423 | 0.51 |
| PF00562 | RNA_pol_Rpb2_6 | 0.51 |
| PF07589 | PEP-CTERM | 0.51 |
| PF00990 | GGDEF | 0.51 |
| PF07690 | MFS_1 | 0.51 |
| PF07519 | Tannase | 0.51 |
| PF07927 | HicA_toxin | 0.51 |
| PF00924 | MS_channel | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG3724 | Succinylarginine dihydrolase | Amino acid transport and metabolism [E] | 30.96 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 2.03 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.03 |
| COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.02 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.02 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 1.02 |
| COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 0.51 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.51 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.51 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.51 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.51 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.51 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.51 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.01 % |
| Unclassified | root | N/A | 32.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2046860006|LWAeNiSIP_F6BA1ZZ02JKI8L | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 505 | Open in IMG/M |
| 2170459009|GA8DASG01BX3CM | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107097836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300001991|JGI24743J22301_10035967 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300003859|Ga0031653_10065519 | Not Available | 965 | Open in IMG/M |
| 3300003861|Ga0031654_10147473 | Not Available | 666 | Open in IMG/M |
| 3300004114|Ga0062593_102808380 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300004282|Ga0066599_100384031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 867 | Open in IMG/M |
| 3300004463|Ga0063356_101544450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 985 | Open in IMG/M |
| 3300004479|Ga0062595_102348519 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004781|Ga0062379_10167099 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005093|Ga0062594_100235117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1321 | Open in IMG/M |
| 3300005187|Ga0066675_10877515 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005293|Ga0065715_10918800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300005328|Ga0070676_10669611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300005355|Ga0070671_100752577 | Not Available | 847 | Open in IMG/M |
| 3300005364|Ga0070673_100499455 | Not Available | 1100 | Open in IMG/M |
| 3300005434|Ga0070709_11346702 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005441|Ga0070700_100130236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1697 | Open in IMG/M |
| 3300005441|Ga0070700_101987802 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005456|Ga0070678_100549016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1025 | Open in IMG/M |
| 3300005457|Ga0070662_101396522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 603 | Open in IMG/M |
| 3300005466|Ga0070685_10805225 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005518|Ga0070699_100424782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1203 | Open in IMG/M |
| 3300005543|Ga0070672_100834614 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005543|Ga0070672_100912770 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005546|Ga0070696_101243900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300005566|Ga0066693_10157427 | Not Available | 857 | Open in IMG/M |
| 3300005577|Ga0068857_101949638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
| 3300005578|Ga0068854_100125568 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300005578|Ga0068854_101845055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300005615|Ga0070702_101886542 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005618|Ga0068864_100230756 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300005618|Ga0068864_100491393 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300005718|Ga0068866_10049284 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300005719|Ga0068861_100550462 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300005719|Ga0068861_101451397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 672 | Open in IMG/M |
| 3300005840|Ga0068870_10008249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4675 | Open in IMG/M |
| 3300005842|Ga0068858_101589452 | Not Available | 645 | Open in IMG/M |
| 3300005844|Ga0068862_101592756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 660 | Open in IMG/M |
| 3300005994|Ga0066789_10019324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3016 | Open in IMG/M |
| 3300006358|Ga0068871_102337151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 510 | Open in IMG/M |
| 3300006794|Ga0066658_10182675 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300006796|Ga0066665_11072036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300006844|Ga0075428_101922206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300006852|Ga0075433_11311506 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006881|Ga0068865_100161791 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300006881|Ga0068865_100754252 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006914|Ga0075436_100298785 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300006953|Ga0074063_13334148 | Not Available | 785 | Open in IMG/M |
| 3300006953|Ga0074063_13615132 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300006954|Ga0079219_12045054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300009093|Ga0105240_11608455 | Not Available | 680 | Open in IMG/M |
| 3300009111|Ga0115026_11467943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300009147|Ga0114129_10946899 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300009156|Ga0111538_10679607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300009174|Ga0105241_12491722 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009545|Ga0105237_10662752 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300009553|Ga0105249_10712869 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300009553|Ga0105249_13436413 | Not Available | 510 | Open in IMG/M |
| 3300009711|Ga0116166_1215635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300009873|Ga0131077_10588544 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300010048|Ga0126373_13178110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300010341|Ga0074045_10853330 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010360|Ga0126372_13104615 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010376|Ga0126381_101824284 | Not Available | 878 | Open in IMG/M |
| 3300010399|Ga0134127_11914281 | Not Available | 670 | Open in IMG/M |
| 3300010403|Ga0134123_11557214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 707 | Open in IMG/M |
| 3300012092|Ga0136621_1269130 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012205|Ga0137362_11735884 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012209|Ga0137379_10419006 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300012210|Ga0137378_11650563 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012353|Ga0137367_10727699 | Not Available | 690 | Open in IMG/M |
| 3300012354|Ga0137366_10909521 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012905|Ga0157296_10194017 | Not Available | 643 | Open in IMG/M |
| 3300012971|Ga0126369_12078022 | Not Available | 656 | Open in IMG/M |
| 3300013104|Ga0157370_12085413 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300013308|Ga0157375_10198798 | Not Available | 2160 | Open in IMG/M |
| 3300014056|Ga0120125_1000881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6046 | Open in IMG/M |
| 3300014325|Ga0163163_11493512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 737 | Open in IMG/M |
| 3300014326|Ga0157380_11938822 | Not Available | 650 | Open in IMG/M |
| 3300014880|Ga0180082_1072795 | Not Available | 752 | Open in IMG/M |
| 3300014969|Ga0157376_10655988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1050 | Open in IMG/M |
| 3300015200|Ga0173480_10316997 | Not Available | 877 | Open in IMG/M |
| 3300015201|Ga0173478_10843834 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300015372|Ga0132256_103115250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300015374|Ga0132255_101852846 | Not Available | 917 | Open in IMG/M |
| 3300016357|Ga0182032_11483315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300017972|Ga0187781_11345292 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018029|Ga0187787_10451330 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018072|Ga0184635_10128274 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300018073|Ga0184624_10128175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum | 1104 | Open in IMG/M |
| 3300018075|Ga0184632_10453908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300018481|Ga0190271_12544428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 613 | Open in IMG/M |
| 3300020070|Ga0206356_11619381 | Not Available | 535 | Open in IMG/M |
| 3300021432|Ga0210384_11436625 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300021445|Ga0182009_10196590 | Not Available | 980 | Open in IMG/M |
| 3300023263|Ga0247800_1117616 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300025898|Ga0207692_10207524 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300025901|Ga0207688_10300000 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300025907|Ga0207645_10095952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1910 | Open in IMG/M |
| 3300025908|Ga0207643_10003856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 8066 | Open in IMG/M |
| 3300025918|Ga0207662_10466933 | Not Available | 865 | Open in IMG/M |
| 3300025923|Ga0207681_10318713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1236 | Open in IMG/M |
| 3300025923|Ga0207681_10497672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300025925|Ga0207650_11768181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300025926|Ga0207659_11745652 | Not Available | 529 | Open in IMG/M |
| 3300025928|Ga0207700_11742016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300025931|Ga0207644_10168577 | Not Available | 1707 | Open in IMG/M |
| 3300025935|Ga0207709_10659358 | Not Available | 834 | Open in IMG/M |
| 3300025940|Ga0207691_10529239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300025940|Ga0207691_11543562 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025941|Ga0207711_10108756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2463 | Open in IMG/M |
| 3300025945|Ga0207679_10766112 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300025945|Ga0207679_12051443 | Not Available | 520 | Open in IMG/M |
| 3300025960|Ga0207651_10422688 | Not Available | 1138 | Open in IMG/M |
| 3300025960|Ga0207651_11471827 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025961|Ga0207712_10892528 | Not Available | 785 | Open in IMG/M |
| 3300025972|Ga0207668_11528950 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300025986|Ga0207658_11228668 | Not Available | 685 | Open in IMG/M |
| 3300026035|Ga0207703_12394956 | Not Available | 503 | Open in IMG/M |
| 3300026041|Ga0207639_10792984 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300026057|Ga0208294_1014796 | Not Available | 876 | Open in IMG/M |
| 3300026067|Ga0207678_10172004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1849 | Open in IMG/M |
| 3300026075|Ga0207708_10869632 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026088|Ga0207641_10031076 | All Organisms → cellular organisms → Bacteria | 4427 | Open in IMG/M |
| 3300026088|Ga0207641_11125703 | Not Available | 784 | Open in IMG/M |
| 3300026121|Ga0207683_10223970 | Not Available | 1714 | Open in IMG/M |
| 3300026142|Ga0207698_10174601 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300026310|Ga0209239_1167627 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 846 | Open in IMG/M |
| 3300026334|Ga0209377_1129965 | Not Available | 995 | Open in IMG/M |
| 3300027587|Ga0209220_1046442 | Not Available | 1160 | Open in IMG/M |
| 3300027840|Ga0209683_10236778 | Not Available | 839 | Open in IMG/M |
| 3300027890|Ga0209496_10342680 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027897|Ga0209254_10895832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300027899|Ga0209668_10401430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 897 | Open in IMG/M |
| 3300028381|Ga0268264_10191525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1865 | Open in IMG/M |
| 3300028381|Ga0268264_11732397 | Not Available | 635 | Open in IMG/M |
| 3300028589|Ga0247818_10389946 | Not Available | 937 | Open in IMG/M |
| 3300028596|Ga0247821_11051399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. Aa7 | 548 | Open in IMG/M |
| 3300028739|Ga0302205_10142171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300028802|Ga0307503_10413977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas subvibrioides | 707 | Open in IMG/M |
| 3300028869|Ga0302263_10206783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300029923|Ga0311347_10068078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2230 | Open in IMG/M |
| 3300029980|Ga0302298_10004719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3323 | Open in IMG/M |
| 3300029984|Ga0311332_10724065 | Not Available | 791 | Open in IMG/M |
| 3300029989|Ga0311365_10700506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
| 3300029990|Ga0311336_11262050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300030000|Ga0311337_10249300 | Not Available | 1471 | Open in IMG/M |
| 3300030010|Ga0302299_10449736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 653 | Open in IMG/M |
| 3300030114|Ga0311333_10291570 | Not Available | 1295 | Open in IMG/M |
| 3300030294|Ga0311349_10247674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1680 | Open in IMG/M |
| 3300030294|Ga0311349_12141111 | Not Available | 513 | Open in IMG/M |
| 3300030294|Ga0311349_12191216 | Not Available | 507 | Open in IMG/M |
| 3300030491|Ga0302211_10030212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
| 3300030838|Ga0311335_10183177 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300030838|Ga0311335_10192680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1358 | Open in IMG/M |
| 3300030838|Ga0311335_10574827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031521|Ga0311364_10589591 | Not Available | 1122 | Open in IMG/M |
| 3300031538|Ga0310888_10470865 | Not Available | 747 | Open in IMG/M |
| 3300031549|Ga0318571_10253054 | Not Available | 648 | Open in IMG/M |
| 3300031572|Ga0318515_10082261 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300031707|Ga0315291_11084918 | Not Available | 666 | Open in IMG/M |
| 3300031720|Ga0307469_10885966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 825 | Open in IMG/M |
| 3300031722|Ga0311351_10942413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300031726|Ga0302321_101813123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300031792|Ga0318529_10058538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1677 | Open in IMG/M |
| 3300031833|Ga0310917_10982267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031862|Ga0315280_10267979 | Not Available | 887 | Open in IMG/M |
| 3300031902|Ga0302322_100051687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4092 | Open in IMG/M |
| 3300031939|Ga0308174_10086190 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300031946|Ga0310910_10901148 | Not Available | 694 | Open in IMG/M |
| 3300031996|Ga0308176_12148804 | Not Available | 596 | Open in IMG/M |
| 3300031997|Ga0315278_11878828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300032074|Ga0308173_10498581 | Not Available | 1090 | Open in IMG/M |
| 3300032075|Ga0310890_10168979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1467 | Open in IMG/M |
| 3300032122|Ga0310895_10105328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300032143|Ga0315292_11041725 | Not Available | 678 | Open in IMG/M |
| 3300032156|Ga0315295_12050193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300032164|Ga0315283_11731220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300032275|Ga0315270_10306665 | Not Available | 997 | Open in IMG/M |
| 3300032275|Ga0315270_11222383 | Not Available | 501 | Open in IMG/M |
| 3300032342|Ga0315286_10547934 | Not Available | 1199 | Open in IMG/M |
| 3300032397|Ga0315287_10677306 | Not Available | 1219 | Open in IMG/M |
| 3300032401|Ga0315275_11139935 | Not Available | 851 | Open in IMG/M |
| 3300032770|Ga0335085_11766643 | Not Available | 635 | Open in IMG/M |
| 3300032782|Ga0335082_10523398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300032955|Ga0335076_10962615 | Not Available | 735 | Open in IMG/M |
| 3300033004|Ga0335084_10472952 | Not Available | 1288 | Open in IMG/M |
| 3300033413|Ga0316603_10140222 | Not Available | 1984 | Open in IMG/M |
| 3300033419|Ga0316601_100275850 | Not Available | 1525 | Open in IMG/M |
| 3300033433|Ga0326726_10921180 | Not Available | 848 | Open in IMG/M |
| 3300033482|Ga0316627_102171134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| 3300033483|Ga0316629_10312089 | Not Available | 1068 | Open in IMG/M |
| 3300034149|Ga0364929_0175769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas subvibrioides | 702 | Open in IMG/M |
| 3300034690|Ga0364923_0222344 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 10.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.02% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.02% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.51% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.51% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.51% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.51% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2046860006 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C methane aerobic+nitrate | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009711 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026057 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAeNiSIP_957060 | 2046860006 | Freshwater Sediment | LATAIGLRATLLTVGVLGLALAAAAMLWSPVRRHRQLPAVAGE |
| F47_04332860 | 2170459009 | Grass Soil | SAPLGSLVGGALATGIGLRGTLLTVAGLGVALSVAAVLWSPVRQHRVLPTMLL |
| JGIcombinedJ13530_1070978361 | 3300001213 | Wetland | TAVGLRNTLLTVGVMALLLTAGAVLWSPVRRHRTLPVVPAE* |
| JGI24743J22301_100359673 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGGALASIIGLRQTLWVVGVLGLALAIGAMAWSPVRRHRTLPTPAAD* |
| Ga0031653_100655192 | 3300003859 | Freshwater Lake Sediment | TAIGLRPTLLTIGVLGLLLLAGAMVWSPVRRHREMPMVTGD* |
| Ga0031654_101474732 | 3300003861 | Freshwater Lake Sediment | LATYVGLRSTLLTVGVLGLILTAAAVYWSPVRQHMKLPAVAGD* |
| Ga0062593_1028083801 | 3300004114 | Soil | GALASQIGLRSTLLTVGLLGLLLSAAAVLWSPVRRHRTLPEPLID* |
| Ga0066599_1003840313 | 3300004282 | Freshwater | GSFAGGALATAIGLRNTLLTVGVLGLALAAGAIAWSPVRRHHRLPDVASD* |
| Ga0063356_1015444501 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NVIGLRATLWTIGVLGVLLAAAALFWSPVRRHRTLPAVAQG* |
| Ga0062595_1023485191 | 3300004479 | Soil | SLAGGALATGIGLRATLLVVGGLGIALALVATAWSPVRTHRQLPRAVPE* |
| Ga0062379_101670991 | 3300004781 | Wetland Sediment | SLAGGALATAVGLRTTLLTIGVLGLLLVGGAIVWSPVRRHRTMPVVAAD* |
| Ga0062594_1002351171 | 3300005093 | Soil | LSVAMAPLGSLVGGALATAIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHQTLPATAVE* |
| Ga0066675_108775151 | 3300005187 | Soil | PLGSLVGGALATAIGLRGTLLTVGVLGLVLSGAAVMWSPVRRHRTLPAPAAE* |
| Ga0065715_109188001 | 3300005293 | Miscanthus Rhizosphere | GALATAIGLRNTLLTVGVLALALTAGAVLWSPVRQHRTLPVVPAE* |
| Ga0070676_106696111 | 3300005328 | Miscanthus Rhizosphere | AAPLGSLAGGALATAIGLRGTLLTVGVLSVALVAGAVVWSPVRRHREMPVPAND* |
| Ga0070671_1007525772 | 3300005355 | Switchgrass Rhizosphere | TAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0070673_1004994551 | 3300005364 | Switchgrass Rhizosphere | LASAIGLRETLLTIGVLGILLVVGAVLWSPVRRHRKMPAVVGD* |
| Ga0070709_113467022 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | CGGALATVIGLRGTLLTVGVLGLVLAAAAVMWSPVRRHRQLPAPAAD* |
| Ga0070700_1001302362 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LTVAAAPLGSLAGGALATAIGLRATLLTIGVLALLLVAAAVLWSPVRRHLKMPVVAGD* |
| Ga0070700_1019878022 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAPLGSLAGGALATGIGLRNTLLTIGVLGILLVAGTVLWSPVRRHREMPAVASE* |
| Ga0070678_1005490161 | 3300005456 | Miscanthus Rhizosphere | AAAPLGSLAGGALATAIGLRATLLTIGVLAVLLVAAAVLWSPVRRHLKMPVVAGD* |
| Ga0070662_1013965221 | 3300005457 | Corn Rhizosphere | VGGALATGIGTRSTLLTVGVLGLLLAAAAVLWSPVRRHQTLPATVAE* |
| Ga0070685_108052252 | 3300005466 | Switchgrass Rhizosphere | VAAAPLGSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0070699_1004247823 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGGALATAVGLRATLLTVGVLGLVLTAAAVYWSPVRRHMTLPAVASD* |
| Ga0070672_1008346141 | 3300005543 | Miscanthus Rhizosphere | TLLTVGVLGLLLAAAAVLWSPVRRHQTLPATVAE* |
| Ga0070672_1009127701 | 3300005543 | Miscanthus Rhizosphere | GSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0070696_1012439002 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGSLVGGALATGIGLRQTLWVVGVLGLILSIVAMRWSPVRRHRHLPAVALD* |
| Ga0066693_101574271 | 3300005566 | Soil | GLRGTLLTVGVLGLALAGSAVMWSPVRRHRQLPAPAAD* |
| Ga0068857_1019496381 | 3300005577 | Corn Rhizosphere | LTVAAAPLGSLAGGALATAVGLRATLLVIGALGIALAGVATMWSPVRRHRRLPQAAL* |
| Ga0068854_1001255683 | 3300005578 | Corn Rhizosphere | RSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD* |
| Ga0068854_1018450552 | 3300005578 | Corn Rhizosphere | SLAGGALATAIGLRATLLTVGALGLLLALGAVLRSPVRRHVRLPATSEA* |
| Ga0070702_1018865421 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VAMAPLGSLVGGALATAIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHQTLPATAVE* |
| Ga0068864_1002307562 | 3300005618 | Switchgrass Rhizosphere | APLGSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0068864_1004913933 | 3300005618 | Switchgrass Rhizosphere | STLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLID* |
| Ga0068866_100492843 | 3300005718 | Miscanthus Rhizosphere | STLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD* |
| Ga0068861_1005504622 | 3300005719 | Switchgrass Rhizosphere | AAAPLGSLVGGALATAIGLRATLLTIGVLALLLVVAAVLWSPVRRHRKMPVVAGD* |
| Ga0068861_1014513972 | 3300005719 | Switchgrass Rhizosphere | AAAPLGSLVGGALATAIGLRETLLTIGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0068870_100082495 | 3300005840 | Miscanthus Rhizosphere | VGGVLATVIGLRGTLLTVGVLGLVLAGAAVLWSPVRRHRALPAVSVE* |
| Ga0068858_1015894522 | 3300005842 | Switchgrass Rhizosphere | TLLTIGLLGLALAAAAVLWSPLRRHHKLPAVAGD* |
| Ga0068862_1015927561 | 3300005844 | Switchgrass Rhizosphere | VAMAPLGSLVGGALATGIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHHTLPATAVE* |
| Ga0066789_100193241 | 3300005994 | Soil | GSLVGGALATAIGLRPTLLTVAALGLVLSVAAVIWSPLRQHRRLPSHAPE* |
| Ga0068871_1023371511 | 3300006358 | Miscanthus Rhizosphere | GGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0066658_101826753 | 3300006794 | Soil | GGAMATGIGLRGTLLTVGVLGLALAGSAVMWSPVRRHRQLPAPAAD* |
| Ga0066665_110720361 | 3300006796 | Soil | GGALATGIGLRGTLLTVGVLGLVLAGAAVMWSPVRRHRQLPAPAAD* |
| Ga0075428_1019222061 | 3300006844 | Populus Rhizosphere | VAMAPLGSLVGGALATGIGTRGTLLTVGVLGLLLAAAAVLWSPVRRHQTLPATVAE* |
| Ga0075433_113115061 | 3300006852 | Populus Rhizosphere | RATLWTIAALGILLVIGAVLWSPVRRHREMPAVASD* |
| Ga0068865_1001617913 | 3300006881 | Miscanthus Rhizosphere | GSLVGGALATGIGLRQTLWVVGVLGLILSIVAMRWSPVRRHRHLPAVALD* |
| Ga0068865_1007542522 | 3300006881 | Miscanthus Rhizosphere | PLGSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0075436_1002987851 | 3300006914 | Populus Rhizosphere | PLGSLCGGALATVIGLRGTLLTVGVLGLVLAAAAVMWSPVRRHRQLPSPAAD* |
| Ga0074063_133341481 | 3300006953 | Soil | TLLTIGVLGILLVAGTVLWSPVRRHREMPAVASD* |
| Ga0074063_136151321 | 3300006953 | Soil | VGGALATAVGLRPTLLTVGVLGLLLSVAAVIWSPVRHHRRLPAHAPE* |
| Ga0079219_120450541 | 3300006954 | Agricultural Soil | TMRFFTVASAPVGSLVGGALATAIGLRGTLLTVGLLGLLLALMAVLHSPVRQHHRLPVPAVE* |
| Ga0105240_116084552 | 3300009093 | Corn Rhizosphere | LASQIGLRSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD* |
| Ga0115026_114679432 | 3300009111 | Wetland | GVLATYIGLRGTLLTVGVLALLLSGAAVLWSPVRRHRVLPAVAAE* |
| Ga0114129_109468991 | 3300009147 | Populus Rhizosphere | APAPLGSLCGGALATVIGLRGTLLTVGVLGLVLAAAAVMWSPVRRHRQLPSPAAD* |
| Ga0111538_106796072 | 3300009156 | Populus Rhizosphere | VAMAPLGSLVGGVLATYIGLRGTLLAVGALGLVLSAAAVLWSPVRRHQRLPAVAAE* |
| Ga0105241_124917222 | 3300009174 | Corn Rhizosphere | RSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLID* |
| Ga0105237_106627522 | 3300009545 | Corn Rhizosphere | IGSLVGGVLATVIGLRGTLLTVGVLGLVLAGAAVLWSPVRRHRALPAVSVE* |
| Ga0105249_107128692 | 3300009553 | Switchgrass Rhizosphere | AGGALATAIGLRATLLTIGVLALLLVAAAVLWSPVRRHLKMPVVAGD* |
| Ga0105249_134364132 | 3300009553 | Switchgrass Rhizosphere | LRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD* |
| Ga0116166_12156352 | 3300009711 | Anaerobic Digestor Sludge | LGSLAGGAGATAIGLRSTLLAIGVLGLWLAAGAMIRSPVRRHVRLPAVADA* |
| Ga0131077_105885441 | 3300009873 | Wastewater | FLTVAMAPLGSLVGGALATWVGLRGTLLVVGALGLALSAAAVRWSPGRRHRALPAVAVE* |
| Ga0126373_131781101 | 3300010048 | Tropical Forest Soil | VAIAPLGSLVGGALASVIGLRPTLLSVGVLGLILCAGAVFWSPVRRHHKLPAPAAE* |
| Ga0074045_108533302 | 3300010341 | Bog Forest Soil | ALATGIGLRGTLLTVGALGLALAAAAVVWSPVREHHELPAPVAD* |
| Ga0126372_131046152 | 3300010360 | Tropical Forest Soil | AGGALATAIGLRGTLLTIGVLGILLVVGVVLWSPVRRHREMPAIASD* |
| Ga0126381_1018242842 | 3300010376 | Tropical Forest Soil | IGLRGTLLTVGALGLALAVAGVLWSPVRRHRVLPTTVMLE* |
| Ga0134127_119142813 | 3300010399 | Terrestrial Soil | GSLAGGALATAIGLRGTLLTVGVLGIALALAATAWSPVRGHRRLPAIVMD* |
| Ga0134123_115572142 | 3300010403 | Terrestrial Soil | GALATAIGLRGTLLTVGVLSVALVAGAVVWSPVRRHREMPVPAND* |
| Ga0136621_12691302 | 3300012092 | Polar Desert Sand | VIGLRATLLTIGVLGLALAAGAVLWSPVRHHRELPADAAD* |
| Ga0137362_117358841 | 3300012205 | Vadose Zone Soil | TGIGLRGTLLTVAGLGVALSVAAVLWSPVRQHRVLPTVLL* |
| Ga0137379_104190063 | 3300012209 | Vadose Zone Soil | VGGALATGIGLRGTLLTVAGLGVALSVAAVLWSPVRQHRVLPTVLL* |
| Ga0137378_116505631 | 3300012210 | Vadose Zone Soil | SLVGGALATAIGLRGTLLTVGILGLVLSGAAVLWSPVRRHRTLPAPAAE* |
| Ga0137367_107276991 | 3300012353 | Vadose Zone Soil | PAPLGSLCGGALATVIGLRGTLLTVGVLGLVLAAAAVMWSPVRRHRQLPAPAAD* |
| Ga0137366_109095211 | 3300012354 | Vadose Zone Soil | LATGIGLRGTLLAVAGLGVVLSAAAVLWSPVRQHRVLPTVLL* |
| Ga0157296_101940172 | 3300012905 | Soil | GSLAGGALATAIGLRATLLTIGVLGLCLALGAVLRSPVRRHVRLPATADA* |
| Ga0126369_120780221 | 3300012971 | Tropical Forest Soil | LATGIGLRGTLLTVAALGVALSAAAVLWSPVRLHRALPTTVLE* |
| Ga0157370_120854131 | 3300013104 | Corn Rhizosphere | TLLTVGVLGLLLAAGAVLWSPVRRHQTLPAAVAD* |
| Ga0157369_122957412 | 3300013105 | Corn Rhizosphere | SLVGGALATAIGLRATLLVVGGLGIALALAATAWSPVRAHRSLPAPVAE* |
| Ga0157375_101987983 | 3300013308 | Miscanthus Rhizosphere | RATLLTIGVLALLLVVAAVLWSPVRRHRKMPVVAGD* |
| Ga0120125_10008818 | 3300014056 | Permafrost | EIGLRSTLLAVGVLGLLLSAAAVLWSPVRSHRTLPQPVTD* |
| Ga0163163_114935121 | 3300014325 | Switchgrass Rhizosphere | AIGLRGTLLTIGVLSIALVAGAVVWSPVRRHREMPVPAND* |
| Ga0157380_119388221 | 3300014326 | Switchgrass Rhizosphere | RATLLTVGVLGLLLALGAVLRSPVRRHVRLPATADA* |
| Ga0180082_10727951 | 3300014880 | Soil | TAIGLRATLLTIGVLALLLVVAAVLWSPVRRHRKMPVVAGD* |
| Ga0157376_106559882 | 3300014969 | Miscanthus Rhizosphere | SLAGGALATVIGLRQTLWVVGVLGLALAIGAMAWSPVRRHRTLPAPAAD* |
| Ga0173480_103169971 | 3300015200 | Soil | AIGLRATLLTVGALGLLLALGAVLRSPVRRHVRLPATSEA* |
| Ga0173478_108438342 | 3300015201 | Soil | GGALATAIGLRATLLTIGVLALLLVVAAVLWSPVRRHLKMPVVAGD* |
| Ga0132256_1031152502 | 3300015372 | Arabidopsis Rhizosphere | LAGGALATAIGLRYTLLTIAALGVLLAAAALAWSPVRRHRTLPVAAAD* |
| Ga0132255_1018528463 | 3300015374 | Arabidopsis Rhizosphere | TLLTVGVLGLILTAAAVFWSPVRRHMKLPAIAGD* |
| Ga0182032_114833152 | 3300016357 | Soil | APLGSLVGGALATAIGLRATLLSIGVLGLILCAGAVFWSPVRRHHKLPAPAAD |
| Ga0187781_113452922 | 3300017972 | Tropical Peatland | LGSLVGGALATGIGLRGTLLTIGALGLALAASAVLWSPVRQHRELPAPAMD |
| Ga0187787_104513301 | 3300018029 | Tropical Peatland | ALATAIGLRGTLLVVGGLGLALAMAGVFWSPVRQHRALPTTVLE |
| Ga0184635_101282741 | 3300018072 | Groundwater Sediment | GALATGIGLRGTLLTVGALGLALAGAAAVWSPVRRHRQLPAPAAD |
| Ga0184624_101281753 | 3300018073 | Groundwater Sediment | GLRNTLLTVGVLALALTAGAVLWSPVRQHRTLPVVPAE |
| Ga0184632_104539082 | 3300018075 | Groundwater Sediment | AIGLRETLLTIGALALVLVAAAVVWSPVRRHREMPVPAND |
| Ga0190271_125444281 | 3300018481 | Soil | FAGGALATVIGLRGTLWTIAVLGVMLAAGALVWSPVRRHRSLPAVAVE |
| Ga0206356_116193811 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GALATAIGLRGTLLTVGVLGIALALAATAWSPVRGHRRLPAIVMD |
| Ga0210384_114366252 | 3300021432 | Soil | AAAPLGSLAGGALATAIGLRGTLLTIGVLGILLVVGTVLWSPVRRHREMPAVASD |
| Ga0182009_101965903 | 3300021445 | Soil | RGTLLTVGLLGLLLALMAVLHSPVRQHHRLPVPAVE |
| Ga0247800_11176161 | 3300023263 | Soil | AIGLRATLLTVGALGLLLALGAVLRSPVRRHVRLPATADA |
| Ga0207692_102075241 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | STLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLID |
| Ga0207688_103000002 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | FLTVAMAPIGSLVGGVLATVIGLRGTLLTVGVLGLVLAGAAVLWSPVRRHRALPAVSVE |
| Ga0207645_100959523 | 3300025907 | Miscanthus Rhizosphere | VAAAPLGSLAGGALATAIGLRATLLTIGVLAVLLVAAAVLWSPVRRHLKMPVVAGD |
| Ga0207643_100038561 | 3300025908 | Miscanthus Rhizosphere | SLVGGVLATVIGLRGTLLTVGVLGLVLAGAAVLWSPVRRHRALPAVSVE |
| Ga0207662_104669331 | 3300025918 | Switchgrass Rhizosphere | LVGGALASQIGLRSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD |
| Ga0207681_103187132 | 3300025923 | Switchgrass Rhizosphere | TVAMAPLGSLVGGVLATYIGLRGTLLAVGALGLVLSAAAVLWSPVRRHQRLPAVAAE |
| Ga0207681_104976723 | 3300025923 | Switchgrass Rhizosphere | GIGTRSTLLTVGVLGLLLAAAAVLWSPVRRHQTLPATVAE |
| Ga0207650_117681811 | 3300025925 | Switchgrass Rhizosphere | RATLLVVGVLGIALAVAASLYSPVRGHRHLPTATSA |
| Ga0207659_117456521 | 3300025926 | Miscanthus Rhizosphere | GGALATGIGLRNTLLTIGVLGILLVAGTVLWSPVRRHREMPAVASD |
| Ga0207700_117420161 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGSLAGGALATGIGLRATLLVVGGLGIALALVATAWSPVRTHRQLPRVVPE |
| Ga0207644_101685773 | 3300025931 | Switchgrass Rhizosphere | PLGSLVGGALATGIGLRQTLWVVGVLGLILSIVAMRWSPVRRHRHLPAVALD |
| Ga0207709_106593581 | 3300025935 | Miscanthus Rhizosphere | GGALASEIGLRSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD |
| Ga0207691_105292392 | 3300025940 | Miscanthus Rhizosphere | LGSLAGGALATAIGLRGTLLTIGVLSIALVAGAVVWSPVRRHREMPVPAND |
| Ga0207691_115435622 | 3300025940 | Miscanthus Rhizosphere | AAPLGSLAGGALATGIGLRNTLLTIGVLGILLVAGTVLWSPVRRHREMPAVASD |
| Ga0207711_101087561 | 3300025941 | Switchgrass Rhizosphere | GLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD |
| Ga0207679_107661122 | 3300025945 | Corn Rhizosphere | AMAPLGSLVGGALATAIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHQSLPATAVE |
| Ga0207679_120514432 | 3300025945 | Corn Rhizosphere | TVAAAPLGSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD |
| Ga0207651_104226882 | 3300025960 | Switchgrass Rhizosphere | LASAIGLRETLLTIGVLGILLVVGAVLWSPVRRHRKMPAVVGD |
| Ga0207651_114718271 | 3300025960 | Switchgrass Rhizosphere | VAAAPLGSLVGGALATAIGLRPTLLTVGVLALLLVAAAVLWSPVRGHRKMPVVAGD |
| Ga0207712_108925281 | 3300025961 | Switchgrass Rhizosphere | LATAIGLRATLLTIGVLALLLVAAAVLWSPVRRHLKMPVVAGD |
| Ga0207668_115289501 | 3300025972 | Switchgrass Rhizosphere | GGALATAIGLRGTLLTIGVFGILLVAGTVLWSPVRRHREMPAVASD |
| Ga0207658_112286682 | 3300025986 | Switchgrass Rhizosphere | LRPTLLTVGVLGLGLAAAAVLWSPVRRHRELPAVAGE |
| Ga0207703_123949562 | 3300026035 | Switchgrass Rhizosphere | ALATVAGLRATLLTIGLLGLALAAAAVLWSPLRRHHKLPAVAGD |
| Ga0207639_107929842 | 3300026041 | Corn Rhizosphere | LGSLVGGALATGIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHQTLPATAVE |
| Ga0208294_10147961 | 3300026057 | Natural And Restored Wetlands | RATLLTVGALGLVLVAAAIAWSPVRRHHKLPAVVGE |
| Ga0207678_101720043 | 3300026067 | Corn Rhizosphere | IGLRNTLLTVGVLALALTAGAVLWSPVRQHRTLPVVPAE |
| Ga0207708_108696322 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSLVGGALATGIGTRGTLLTVGVLGLLLAAGAVLWSPVRRHHTLPATAVE |
| Ga0207641_100310761 | 3300026088 | Switchgrass Rhizosphere | SLVGGALASEIGLRSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLID |
| Ga0207641_111257031 | 3300026088 | Switchgrass Rhizosphere | IGLRETLLTIGVLGILLVVGAVLWSPVRRHRKMPAVVGD |
| Ga0207683_102239703 | 3300026121 | Miscanthus Rhizosphere | ALATAIGLRATLLTIGVLAVLLVAAAVLWSPVRRHLKMPVVAGD |
| Ga0207698_101746013 | 3300026142 | Corn Rhizosphere | LASQIGLRSTLLVVGVLGLLLSAAAVLWSPVRRHRALPDPLMD |
| Ga0209239_11676271 | 3300026310 | Grasslands Soil | LVGGALATAIGLRGTLLTVGILGLVLSGAAVLWSPVRRHRTLPAPAAE |
| Ga0209377_11299651 | 3300026334 | Soil | FLTVAAAPAGSLAGGALATAVGLRATLLTVGVLGLVLTAAAVFWSPVRRHMKLPAIAGD |
| Ga0209220_10464421 | 3300027587 | Forest Soil | SLVGGALATAIGLRGTLLTVGILGLVLSGAAVLWSPVRRHRTLPAPAAE |
| Ga0209683_102367782 | 3300027840 | Wetland Sediment | VAHGLRATLLTVGVLALLLVAGAVIWSPVRRHRKMPVVASE |
| Ga0209496_103426802 | 3300027890 | Wetland | RFLSVAAAPLGSLAGGALATVIGLRGTLITVGVLGLMLAAGAIAWSPVRRHHKLPTVAAD |
| Ga0209254_108958321 | 3300027897 | Freshwater Lake Sediment | LGSLFGGVLATYIGLRGTLLTVGVLALLLSGAAVLWSPVRRHRVLPAVAAE |
| Ga0209668_104014302 | 3300027899 | Freshwater Lake Sediment | VGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0268264_101915251 | 3300028381 | Switchgrass Rhizosphere | PTLLTVCVLALLLVAAAVLWSPVRGHRKMPVVAGD |
| Ga0268264_117323971 | 3300028381 | Switchgrass Rhizosphere | ATAIGLRATLLTVGALGLLLALGAVLRSPVRRHVRLPATADA |
| Ga0247818_103899462 | 3300028589 | Soil | LRATLLTIGALGLVLALAAVLRSPVRRHVRLPATADA |
| Ga0247821_110513991 | 3300028596 | Soil | SVIGLRATLWTIGVLGVLLAAAALVWSPVRRHRTLPAASQV |
| Ga0302205_101421711 | 3300028739 | Fen | GLRNTLLTVGVLALVLTAGAVLWSPVRRHRTLPVVPAD |
| Ga0307503_104139771 | 3300028802 | Soil | GLRGTLLTVGVLALLLTAGAVLWSPVRQHRTLPAVPAE |
| Ga0302263_102067831 | 3300028869 | Fen | LTVAAAPLGSLAGGALATAVGLRNTLLTVGVLALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311347_100680781 | 3300029923 | Fen | GGALATVIGLRNTLLTVGVLALVLTAGAVLWSPVRRHRTLPVVPAD |
| Ga0302298_100047191 | 3300029980 | Fen | GGALATAVGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311332_107240652 | 3300029984 | Fen | GLRATLLTVGVLGLILTAAAVFWSPVRRHMKLPAVAGD |
| Ga0311365_107005061 | 3300029989 | Fen | GSLAGGALATAVGLRNTLLTVGVMALVLTALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311336_112620502 | 3300029990 | Fen | TAVGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311337_102493001 | 3300030000 | Fen | ALATAVGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0302299_104497362 | 3300030010 | Fen | LTVAAAPAGSLAGGMLASAIGLRQTLLVIGALGIVLAAIAVVWSPVRRHRKLPVVAAD |
| Ga0311333_102915702 | 3300030114 | Fen | LATAVGLRNTLLTVGVLALALTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311349_102476741 | 3300030294 | Fen | AMAPLGSLVGGALATVIGLRGTLLTVGVLGLALSVAAVLWSPVRRHRTLPAVAGK |
| Ga0311349_121411111 | 3300030294 | Fen | RATLLTVGVLGLILTAAAVFWSPVRRHMKLPAIAGD |
| Ga0311349_121912162 | 3300030294 | Fen | ALETAIGLRATLLTIGVLGLTLVAAAVLWSPVRRQRKMPVAAID |
| Ga0302211_100302121 | 3300030491 | Fen | GALATAVGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311335_101831772 | 3300030838 | Fen | TAIGLLNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311335_101926801 | 3300030838 | Fen | LTVAAAPLGSLAGGALATAVGLRATLLTVGVLGLILTAAAVFWSPVRRHMKLPAIAGD |
| Ga0311335_105748271 | 3300030838 | Fen | LRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0311364_105895912 | 3300031521 | Fen | ALATAIGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0310888_104708651 | 3300031538 | Soil | ATLLTIGALGLVLALAAVLRSPVRRHVRLPATADA |
| Ga0318571_102530542 | 3300031549 | Soil | TLLTVGALGLALAVAGVLWSPVRRHRVLPTTVMLE |
| Ga0318515_100822611 | 3300031572 | Soil | LRGTLLTVGALGLALAVAGVLWSPVRRHRVLPTTVMLE |
| Ga0315291_110849182 | 3300031707 | Sediment | AGGALATAIGLRATLLTVGVLALVLVAGAVIWSPVRRHRKMPMVASD |
| Ga0307469_108859661 | 3300031720 | Hardwood Forest Soil | GALATAIGLRGTLLTVAALGIGLAAAAVLWSPVRRHRALPTAVLK |
| Ga0311351_109424132 | 3300031722 | Fen | FLTVAMAPLGSLVGGALATVIGLRGTLLTVGVLGLALSVAAVLWSPVRRHRTLPAVAGK |
| Ga0302321_1018131232 | 3300031726 | Fen | AAPLGSLAGGALATAVGLRNTLLTVGVMALVLTAGAVLWSPVRRHRTLPVVPAE |
| Ga0318529_100585383 | 3300031792 | Soil | LRGTLLTIGVLGILLVVGVVLWSPVRRHREMPAVASD |
| Ga0310917_109822671 | 3300031833 | Soil | GSLVGGALATAIGLRATLLSIGVLGLILCAGAVFWSPVRRHHKLPAPAAD |
| Ga0315280_102679792 | 3300031862 | Sediment | LRATLLTVGVLGLALAGAAVLWSPVRRHHKLPAVASE |
| Ga0302322_1000516875 | 3300031902 | Fen | LRNTLLTVGVLALVLTAGAVLWSPVRRHRTLPVVPAD |
| Ga0308174_100861901 | 3300031939 | Soil | VAVAPLGSLVGGALATAVGLRVTLLMVGGLGIALALAATAWSPVRAHRQLPRAVPE |
| Ga0310910_109011482 | 3300031946 | Soil | SLVGGALATGIGLRGTLLTVGALGISLSVAGVLWSPVRRHRVLPTTVLE |
| Ga0308176_121488042 | 3300031996 | Soil | VAAAPLGSLVGGGLATAIGLRATLLVVGGLGIALALVATAWSPVRAHRTLPAAVVE |
| Ga0315278_118788282 | 3300031997 | Sediment | AAPLGSLAGGALATAIGLRATLLTVGVLALMLVAGAVIWSPVRRHREMPVVASD |
| Ga0308173_104985811 | 3300032074 | Soil | LGSIAGGALATLIGLRGTLVTVGMLGLLLALAALAWSPVRRHHSLPLAAAE |
| Ga0310890_101689792 | 3300032075 | Soil | GAVATAIGLRATLLTIGALGLVLALAAVLRSPVRRHVRLPATADA |
| Ga0310895_101053283 | 3300032122 | Soil | STLLTVGVLGLLLAAAAVLWSPVRRHQTLPATVAE |
| Ga0315292_110417252 | 3300032143 | Sediment | TAIGLRPTLLTIGVLGLLLVAGAVVWSPVRRHREMPMVASD |
| Ga0315295_120501932 | 3300032156 | Sediment | LATAIGLRATLLTVGVLALMLVAGAVIWSPVRRHREMPVVASD |
| Ga0315283_117312201 | 3300032164 | Sediment | LAGGALATAIGFRATLLTVGVLALMLVAGAVIWSPVRRHRKMPVVASD |
| Ga0315270_103066651 | 3300032275 | Sediment | SLAGGALATEIGLRATLLTIGVLGLLLVACAVLWSPVRRHREMPAVPSD |
| Ga0315270_112223832 | 3300032275 | Sediment | AGGALATAIGLRNTLLTVGVLALVLTAGAVLWSPVRRHRTLPALPAE |
| Ga0315286_105479341 | 3300032342 | Sediment | FLTVAAAPLGSLAGGALATEIGLRATLLTIGVLGLLLVASAVLWSPVRRHREMPAVPSD |
| Ga0315287_106773062 | 3300032397 | Sediment | GLRPTLLTIGVLGLLLVAGAIIWSPVRRHREMPMVASD |
| Ga0315275_111399351 | 3300032401 | Sediment | ATAIGLRATLLTVGVLALVLVAGAVIWSPVRRHRKMPVVASD |
| Ga0335085_117666431 | 3300032770 | Soil | TAVGLRGTLITVGVLGIALVACALLWSPVRRHRKLPAGAAE |
| Ga0335082_105233981 | 3300032782 | Soil | LRATLLTVGALGLVLVAAAIAWSPVRRHRKLPAVVGE |
| Ga0335076_109626152 | 3300032955 | Soil | AIGLRGTLLVVGALGLALALAAVLWSPVRQHRVLPTAVLE |
| Ga0335084_104729522 | 3300033004 | Soil | FLTVAAAPLGSLVGGARASAIGLRETLLTIGVLGILLVVGAVLWSPVRRHREMPAVASE |
| Ga0316603_101402224 | 3300033413 | Soil | SLAGGALATIIGLRATLLTIGVLGLALAAAAVAWSPVRRHHKLPAVASD |
| Ga0316601_1002758501 | 3300033419 | Soil | VAAAPLGSLAGGALATIIGLRATLLTIGVLGLALAAAAVAWSPVRRHHKLPAVASD |
| Ga0326726_109211801 | 3300033433 | Peat Soil | AGGALATYVGLRSTLLTVGVLGLILTAAAVYWSPVRQHMKLPAVAGD |
| Ga0316627_1021711342 | 3300033482 | Soil | GLRATLLTIGVLGLVLAAAAVAWSPVRRHHKLPAVASD |
| Ga0316629_103120891 | 3300033483 | Soil | TVIGLRGTLITVGVLGLMLAAGAIAWSPVRRHHKLPTVAAD |
| Ga0364929_0175769_2_145 | 3300034149 | Sediment | AGGALATAIGLRNTLLTVGVLALALTAGAVLWSPVRRHRTLPVVPAE |
| Ga0364923_0222344_361_510 | 3300034690 | Sediment | SLAGGALASLIGLRETLWVIGVLGLALAVGAMTWSPVRRHRTLPVPAAD |
| ⦗Top⦘ |