


| Basic Information | |
|---|---|
| Family ID | F024001 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.62 % |
| % of genes near scaffold ends (potentially truncated) | 80.29 % |
| % of genes from short scaffolds (< 2000 bps) | 83.17 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.288 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.096 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 1.92 |
| PF13248 | zf-ribbon_3 | 1.44 |
| PF02518 | HATPase_c | 1.44 |
| PF00398 | RrnaAD | 1.44 |
| PF07992 | Pyr_redox_2 | 1.44 |
| PF07883 | Cupin_2 | 1.44 |
| PF13478 | XdhC_C | 1.44 |
| PF13439 | Glyco_transf_4 | 0.96 |
| PF03480 | DctP | 0.96 |
| PF06808 | DctM | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF00004 | AAA | 0.96 |
| PF07683 | CobW_C | 0.96 |
| PF03313 | SDH_alpha | 0.96 |
| PF02464 | CinA | 0.96 |
| PF00561 | Abhydrolase_1 | 0.96 |
| PF00491 | Arginase | 0.96 |
| PF01326 | PPDK_N | 0.96 |
| PF02190 | LON_substr_bdg | 0.96 |
| PF07963 | N_methyl | 0.96 |
| PF01073 | 3Beta_HSD | 0.96 |
| PF13588 | HSDR_N_2 | 0.96 |
| PF00528 | BPD_transp_1 | 0.96 |
| PF02317 | Octopine_DH | 0.96 |
| PF01510 | Amidase_2 | 0.96 |
| PF01676 | Metalloenzyme | 0.96 |
| PF01790 | LGT | 0.96 |
| PF03739 | LptF_LptG | 0.96 |
| PF00679 | EFG_C | 0.48 |
| PF07298 | NnrU | 0.48 |
| PF11716 | MDMPI_N | 0.48 |
| PF00476 | DNA_pol_A | 0.48 |
| PF01810 | LysE | 0.48 |
| PF03061 | 4HBT | 0.48 |
| PF01144 | CoA_trans | 0.48 |
| PF00496 | SBP_bac_5 | 0.48 |
| PF17186 | Lipocalin_9 | 0.48 |
| PF01106 | NifU | 0.48 |
| PF01734 | Patatin | 0.48 |
| PF01042 | Ribonuc_L-PSP | 0.48 |
| PF13589 | HATPase_c_3 | 0.48 |
| PF02625 | XdhC_CoxI | 0.48 |
| PF01645 | Glu_synthase | 0.48 |
| PF00266 | Aminotran_5 | 0.48 |
| PF10672 | Methyltrans_SAM | 0.48 |
| PF06050 | HGD-D | 0.48 |
| PF06271 | RDD | 0.48 |
| PF13414 | TPR_11 | 0.48 |
| PF01238 | PMI_typeI_C | 0.48 |
| PF00990 | GGDEF | 0.48 |
| PF02085 | Cytochrom_CIII | 0.48 |
| PF01699 | Na_Ca_ex | 0.48 |
| PF00575 | S1 | 0.48 |
| PF02913 | FAD-oxidase_C | 0.48 |
| PF12710 | HAD | 0.48 |
| PF11967 | RecO_N | 0.48 |
| PF03009 | GDPD | 0.48 |
| PF09585 | Lin0512_fam | 0.48 |
| PF13365 | Trypsin_2 | 0.48 |
| PF00582 | Usp | 0.48 |
| PF01493 | GXGXG | 0.48 |
| PF13561 | adh_short_C2 | 0.48 |
| PF14691 | Fer4_20 | 0.48 |
| PF00475 | IGPD | 0.48 |
| PF08220 | HTH_DeoR | 0.48 |
| PF00850 | Hist_deacetyl | 0.48 |
| PF01019 | G_glu_transpept | 0.48 |
| PF02775 | TPP_enzyme_C | 0.48 |
| PF00107 | ADH_zinc_N | 0.48 |
| PF02080 | TrkA_C | 0.48 |
| PF16822 | ALGX | 0.48 |
| PF01165 | Ribosomal_S21 | 0.48 |
| PF09754 | PAC2 | 0.48 |
| PF00675 | Peptidase_M16 | 0.48 |
| PF03477 | ATP-cone | 0.48 |
| PF03764 | EFG_IV | 0.48 |
| PF13416 | SBP_bac_8 | 0.48 |
| PF02310 | B12-binding | 0.48 |
| PF08241 | Methyltransf_11 | 0.48 |
| PF11059 | DUF2860 | 0.48 |
| PF00460 | Flg_bb_rod | 0.48 |
| PF01425 | Amidase | 0.48 |
| PF02739 | 5_3_exonuc_N | 0.48 |
| PF14815 | NUDIX_4 | 0.48 |
| PF10276 | zf-CHCC | 0.48 |
| PF00829 | Ribosomal_L21p | 0.48 |
| PF03601 | Cons_hypoth698 | 0.48 |
| PF04324 | Fer2_BFD | 0.48 |
| PF07238 | PilZ | 0.48 |
| PF01926 | MMR_HSR1 | 0.48 |
| PF06415 | iPGM_N | 0.48 |
| PF07973 | tRNA_SAD | 0.48 |
| PF02779 | Transket_pyr | 0.48 |
| PF01799 | Fer2_2 | 0.48 |
| PF13380 | CoA_binding_2 | 0.48 |
| PF00437 | T2SSE | 0.48 |
| PF08352 | oligo_HPY | 0.48 |
| PF02653 | BPD_transp_2 | 0.48 |
| PF07977 | FabA | 0.48 |
| PF00206 | Lyase_1 | 0.48 |
| PF02635 | DrsE | 0.48 |
| PF13489 | Methyltransf_23 | 0.48 |
| PF00583 | Acetyltransf_1 | 0.48 |
| PF07228 | SpoIIE | 0.48 |
| PF07878 | RHH_5 | 0.48 |
| PF00903 | Glyoxalase | 0.48 |
| PF00080 | Sod_Cu | 0.48 |
| PF01738 | DLH | 0.48 |
| PF13597 | NRDD | 0.48 |
| PF01566 | Nramp | 0.48 |
| PF13590 | DUF4136 | 0.48 |
| PF08899 | DUF1844 | 0.48 |
| PF01408 | GFO_IDH_MocA | 0.48 |
| PF13692 | Glyco_trans_1_4 | 0.48 |
| PF08279 | HTH_11 | 0.48 |
| PF06897 | DUF1269 | 0.48 |
| PF14334 | DUF4390 | 0.48 |
| PF13304 | AAA_21 | 0.48 |
| PF00498 | FHA | 0.48 |
| PF01547 | SBP_bac_1 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 1.44 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.96 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 0.96 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.96 |
| COG1760 | L-serine deaminase | Amino acid transport and metabolism [E] | 0.96 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.48 |
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 0.48 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.48 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.48 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.48 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.48 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.48 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.48 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.48 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.48 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.48 |
| COG1482 | Mannose-6-phosphate isomerase, class I | Carbohydrate transport and metabolism [G] | 0.48 |
| COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.48 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.48 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.48 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.48 |
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.48 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.48 |
| COG1815 | Flagellar basal body rod protein FlgB | Cell motility [N] | 0.48 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.48 |
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.48 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.48 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.48 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.48 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.48 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.48 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.48 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.48 |
| COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.48 |
| COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.48 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.25 % |
| Unclassified | root | N/A | 18.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10072986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 873 | Open in IMG/M |
| 3300000241|BS_KBA_SWE21_205mDRAFT_10086504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 684 | Open in IMG/M |
| 3300001371|BBDRAFT_10404881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 793 | Open in IMG/M |
| 3300001685|JGI24024J18818_10119973 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300002822|BMAI_1057237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1232 | Open in IMG/M |
| 3300002822|BMAI_1062064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1848 | Open in IMG/M |
| 3300003886|Ga0063293_10759800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300004000|Ga0055458_10247309 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300004001|Ga0055450_10134891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 898 | Open in IMG/M |
| 3300004003|Ga0055445_10089482 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300004004|Ga0055451_10259698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 714 | Open in IMG/M |
| 3300004011|Ga0055460_10036704 | Not Available | 1203 | Open in IMG/M |
| 3300004014|Ga0055456_10078112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1034 | Open in IMG/M |
| 3300004018|Ga0055452_10330723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_87 | 516 | Open in IMG/M |
| 3300004048|Ga0055494_10075509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 693 | Open in IMG/M |
| 3300004073|Ga0055516_10189923 | Not Available | 516 | Open in IMG/M |
| 3300004113|Ga0065183_10588014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 568 | Open in IMG/M |
| 3300004147|Ga0055515_10039703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1018 | Open in IMG/M |
| 3300004148|Ga0055521_10020720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1231 | Open in IMG/M |
| 3300005588|Ga0070728_10536563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| 3300005590|Ga0070727_10865335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 508 | Open in IMG/M |
| 3300005600|Ga0070726_10612306 | Not Available | 550 | Open in IMG/M |
| 3300005612|Ga0070723_10714763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
| 3300005826|Ga0074477_1356064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 555 | Open in IMG/M |
| 3300005832|Ga0074469_10006156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
| 3300005832|Ga0074469_11023518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11355 | Open in IMG/M |
| 3300005939|Ga0075123_10009608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4134 | Open in IMG/M |
| 3300006467|Ga0099972_10277893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans | 6230 | Open in IMG/M |
| 3300006467|Ga0099972_11071005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 825 | Open in IMG/M |
| 3300006467|Ga0099972_11185683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 608 | Open in IMG/M |
| 3300006467|Ga0099972_11239727 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006467|Ga0099972_12222289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1838 | Open in IMG/M |
| 3300006467|Ga0099972_12249328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1058 | Open in IMG/M |
| 3300006467|Ga0099972_12283296 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006467|Ga0099972_13228193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 781 | Open in IMG/M |
| 3300006467|Ga0099972_13252407 | Not Available | 913 | Open in IMG/M |
| 3300006467|Ga0099972_13287139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 1551 | Open in IMG/M |
| 3300007510|Ga0105013_1108202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1936 | Open in IMG/M |
| 3300007764|Ga0102950_1206912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 590 | Open in IMG/M |
| 3300008409|Ga0114885_10421 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 12639 | Open in IMG/M |
| 3300008468|Ga0115358_10006739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1756 | Open in IMG/M |
| 3300008627|Ga0115656_1071689 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300009060|Ga0102962_1066581 | Not Available | 1018 | Open in IMG/M |
| 3300009138|Ga0102959_1171158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300009149|Ga0114918_10030677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3844 | Open in IMG/M |
| 3300009494|Ga0127413_10217705 | Not Available | 778 | Open in IMG/M |
| 3300009506|Ga0118657_10370483 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300009509|Ga0123573_10483939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 1179 | Open in IMG/M |
| 3300009509|Ga0123573_11470312 | Not Available | 634 | Open in IMG/M |
| 3300010292|Ga0126326_1000257 | All Organisms → cellular organisms → Bacteria | 19819 | Open in IMG/M |
| 3300010295|Ga0126334_10002494 | All Organisms → cellular organisms → Bacteria | 6448 | Open in IMG/M |
| 3300010298|Ga0126325_10000271 | All Organisms → cellular organisms → Bacteria | 13864 | Open in IMG/M |
| 3300010392|Ga0118731_100130730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 595 | Open in IMG/M |
| 3300010392|Ga0118731_102123608 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1525 | Open in IMG/M |
| 3300010392|Ga0118731_102683734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius lutimaris | 580 | Open in IMG/M |
| 3300010392|Ga0118731_103749611 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
| 3300010392|Ga0118731_105460011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2026 | Open in IMG/M |
| 3300010392|Ga0118731_108219693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
| 3300010392|Ga0118731_109275674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 11802 | Open in IMG/M |
| 3300010392|Ga0118731_109794030 | Not Available | 956 | Open in IMG/M |
| 3300010392|Ga0118731_111278893 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300010392|Ga0118731_111328073 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 919 | Open in IMG/M |
| 3300010392|Ga0118731_111586743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2102 | Open in IMG/M |
| 3300010392|Ga0118731_112948831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 813 | Open in IMG/M |
| 3300010413|Ga0136851_10525962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 1177 | Open in IMG/M |
| 3300010430|Ga0118733_100286526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3258 | Open in IMG/M |
| 3300010430|Ga0118733_100291255 | All Organisms → cellular organisms → Bacteria | 3229 | Open in IMG/M |
| 3300010430|Ga0118733_101535999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
| 3300010430|Ga0118733_103720140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 824 | Open in IMG/M |
| 3300010430|Ga0118733_106290054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 621 | Open in IMG/M |
| 3300010430|Ga0118733_106318504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 619 | Open in IMG/M |
| 3300010430|Ga0118733_107177438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 579 | Open in IMG/M |
| 3300010430|Ga0118733_107645008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 560 | Open in IMG/M |
| 3300010997|Ga0139324_1065849 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300013103|Ga0164318_11289627 | Not Available | 591 | Open in IMG/M |
| 3300013118|Ga0171656_1221758 | Not Available | 752 | Open in IMG/M |
| 3300014260|Ga0075307_1002549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2796 | Open in IMG/M |
| 3300014264|Ga0075308_1004449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 2360 | Open in IMG/M |
| 3300014264|Ga0075308_1119618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 582 | Open in IMG/M |
| 3300014295|Ga0075305_1028643 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300014295|Ga0075305_1069235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 675 | Open in IMG/M |
| 3300014307|Ga0075304_1003437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3342 | Open in IMG/M |
| 3300014307|Ga0075304_1012670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1709 | Open in IMG/M |
| 3300014307|Ga0075304_1016165 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300014307|Ga0075304_1016227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1514 | Open in IMG/M |
| 3300014315|Ga0075350_1186369 | Not Available | 541 | Open in IMG/M |
| 3300014316|Ga0075339_1049443 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300014316|Ga0075339_1070026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 904 | Open in IMG/M |
| 3300014316|Ga0075339_1136051 | Not Available | 669 | Open in IMG/M |
| 3300014316|Ga0075339_1214696 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300014317|Ga0075343_1045912 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300014319|Ga0075348_1045889 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300014319|Ga0075348_1151768 | Not Available | 615 | Open in IMG/M |
| 3300014903|Ga0164321_10445124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 645 | Open in IMG/M |
| 3300017990|Ga0180436_11059556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 616 | Open in IMG/M |
| 3300017990|Ga0180436_11529431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 515 | Open in IMG/M |
| 3300017992|Ga0180435_10459195 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300017992|Ga0180435_10688380 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300017992|Ga0180435_11586268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 568 | Open in IMG/M |
| 3300017992|Ga0180435_11633214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 560 | Open in IMG/M |
| 3300019707|Ga0193989_1047742 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300019710|Ga0194009_1015320 | Not Available | 841 | Open in IMG/M |
| 3300019711|Ga0193993_1015295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 818 | Open in IMG/M |
| 3300019713|Ga0193987_1024211 | Not Available | 683 | Open in IMG/M |
| 3300019716|Ga0193984_1043664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 578 | Open in IMG/M |
| 3300019718|Ga0193999_1025218 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300019729|Ga0193968_1050323 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300019743|Ga0193992_1075762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_123 | 513 | Open in IMG/M |
| 3300021351|Ga0210365_10510694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 760 | Open in IMG/M |
| 3300021351|Ga0210365_10548293 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300021351|Ga0210365_10634428 | Not Available | 1481 | Open in IMG/M |
| 3300021351|Ga0210365_10657345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300021351|Ga0210365_10872761 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300021351|Ga0210365_11240937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 755 | Open in IMG/M |
| 3300021351|Ga0210365_11240946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2993 | Open in IMG/M |
| 3300022188|Ga0190313_1141699 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300022202|Ga0224498_10062386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 1057 | Open in IMG/M |
| 3300022206|Ga0224499_10221704 | Not Available | 643 | Open in IMG/M |
| 3300022206|Ga0224499_10318433 | Not Available | 525 | Open in IMG/M |
| 3300022218|Ga0224502_10080442 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300022220|Ga0224513_10174435 | Not Available | 839 | Open in IMG/M |
| 3300022306|Ga0224509_10033424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 1710 | Open in IMG/M |
| 3300023298|Ga0222638_1026549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1105 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10493718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
| 3300025561|Ga0210119_1057626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 741 | Open in IMG/M |
| 3300025568|Ga0210095_1017930 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300025568|Ga0210095_1043246 | Not Available | 1064 | Open in IMG/M |
| 3300025568|Ga0210095_1079345 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025568|Ga0210095_1131311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 602 | Open in IMG/M |
| 3300025583|Ga0210085_1026427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1773 | Open in IMG/M |
| 3300025583|Ga0210085_1052462 | Not Available | 1161 | Open in IMG/M |
| 3300025628|Ga0208902_1025983 | Not Available | 1988 | Open in IMG/M |
| 3300025698|Ga0208771_1021125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2182 | Open in IMG/M |
| 3300025698|Ga0208771_1080723 | Not Available | 944 | Open in IMG/M |
| 3300025801|Ga0210097_1038325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1079 | Open in IMG/M |
| 3300025883|Ga0209456_10019013 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300025995|Ga0210079_1033916 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300025995|Ga0210079_1046395 | Not Available | 707 | Open in IMG/M |
| 3300026031|Ga0208909_1034024 | Not Available | 520 | Open in IMG/M |
| 3300026033|Ga0208652_1042513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 515 | Open in IMG/M |
| 3300026042|Ga0208538_1011454 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026072|Ga0208292_1005984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1405 | Open in IMG/M |
| 3300027758|Ga0209379_10198960 | Not Available | 691 | Open in IMG/M |
| 3300027852|Ga0209345_10709347 | Not Available | 549 | Open in IMG/M |
| 3300027858|Ga0209013_10010816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 7425 | Open in IMG/M |
| 3300027858|Ga0209013_10045323 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| 3300027917|Ga0209536_100217637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2396 | Open in IMG/M |
| 3300027917|Ga0209536_101671678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 771 | Open in IMG/M |
| 3300028920|Ga0272441_10521591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 960 | Open in IMG/M |
| 3300028920|Ga0272441_10762063 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300030616|Ga0272442_10470778 | Not Available | 824 | Open in IMG/M |
| 3300030616|Ga0272442_10868384 | Not Available | 538 | Open in IMG/M |
| 3300031256|Ga0315556_1170332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 787 | Open in IMG/M |
| 3300031256|Ga0315556_1204377 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031359|Ga0307426_1001823 | All Organisms → cellular organisms → Bacteria | 13665 | Open in IMG/M |
| 3300031364|Ga0307445_10124916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 949 | Open in IMG/M |
| 3300031367|Ga0307440_1189565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300031371|Ga0307423_1025326 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300031371|Ga0307423_1111290 | Not Available | 815 | Open in IMG/M |
| 3300031371|Ga0307423_1215353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 536 | Open in IMG/M |
| 3300031665|Ga0316575_10032121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2055 | Open in IMG/M |
| 3300031665|Ga0316575_10289640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 691 | Open in IMG/M |
| 3300031691|Ga0316579_10344490 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031727|Ga0316576_10005641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7687 | Open in IMG/M |
| 3300031727|Ga0316576_10343573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1111 | Open in IMG/M |
| 3300031728|Ga0316578_10138953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1463 | Open in IMG/M |
| 3300031728|Ga0316578_10153528 | Not Available | 1387 | Open in IMG/M |
| 3300031728|Ga0316578_10193881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1224 | Open in IMG/M |
| 3300031733|Ga0316577_10150352 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300031733|Ga0316577_10357567 | Not Available | 829 | Open in IMG/M |
| 3300031733|Ga0316577_10577911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
| 3300032061|Ga0315540_10126462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1155 | Open in IMG/M |
| 3300032061|Ga0315540_10173850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 946 | Open in IMG/M |
| 3300032061|Ga0315540_10243762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13 | 762 | Open in IMG/M |
| 3300032133|Ga0316583_10026259 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 2078 | Open in IMG/M |
| 3300032133|Ga0316583_10165860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 769 | Open in IMG/M |
| 3300032136|Ga0316201_10382192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1214 | Open in IMG/M |
| 3300032137|Ga0316585_10006434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3358 | Open in IMG/M |
| 3300032137|Ga0316585_10095826 | All Organisms → cellular organisms → Archaea → TACK group | 972 | Open in IMG/M |
| 3300032137|Ga0316585_10096723 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300032168|Ga0316593_10188053 | Not Available | 760 | Open in IMG/M |
| 3300032231|Ga0316187_10621095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 804 | Open in IMG/M |
| 3300032251|Ga0316198_10006963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7021 | Open in IMG/M |
| 3300032251|Ga0316198_10012144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5346 | Open in IMG/M |
| 3300032251|Ga0316198_10049249 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300032251|Ga0316198_10107228 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300032252|Ga0316196_10353050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300032259|Ga0316190_10984400 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032263|Ga0316195_10196022 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300032263|Ga0316195_10246008 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300032263|Ga0316195_10276511 | Not Available | 884 | Open in IMG/M |
| 3300032272|Ga0316189_10025371 | All Organisms → cellular organisms → Bacteria | 5305 | Open in IMG/M |
| 3300032272|Ga0316189_10040629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4041 | Open in IMG/M |
| 3300032272|Ga0316189_10392237 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300032272|Ga0316189_10577563 | Not Available | 862 | Open in IMG/M |
| 3300032272|Ga0316189_11060531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 613 | Open in IMG/M |
| 3300032276|Ga0316188_10080806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1571 | Open in IMG/M |
| 3300032276|Ga0316188_10102673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1398 | Open in IMG/M |
| 3300033429|Ga0316193_10000699 | All Organisms → cellular organisms → Bacteria | 21512 | Open in IMG/M |
| 3300033429|Ga0316193_10546202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Algihabitans → Algihabitans albus | 923 | Open in IMG/M |
| 3300033429|Ga0316193_10611659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodocaloribacter → Rhodocaloribacter litoris | 868 | Open in IMG/M |
| 3300033429|Ga0316193_10710379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 800 | Open in IMG/M |
| 3300033429|Ga0316193_10766629 | Not Available | 768 | Open in IMG/M |
| 3300033429|Ga0316193_10938285 | Not Available | 688 | Open in IMG/M |
| 3300033429|Ga0316193_10940566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 687 | Open in IMG/M |
| 3300033429|Ga0316193_11486352 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300033524|Ga0316592_1111091 | Not Available | 634 | Open in IMG/M |
| 3300033524|Ga0316592_1168622 | Not Available | 521 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 10.58% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 10.10% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 10.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 9.13% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 8.17% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 6.25% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 4.81% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.37% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.88% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.88% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.88% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.40% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 1.92% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.92% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.92% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.44% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.44% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Marine Gutless Worms | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms | 1.44% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.96% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil | 0.96% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.48% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.48% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.48% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.48% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.48% |
| Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.48% |
| Methane Seep Sediment | Environmental → Aquatic → Marine → Cold Seeps → Sediment → Methane Seep Sediment | 0.48% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.48% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300002822 | Illumina_Fosmid_Bertioga | Environmental | Open in IMG/M |
| 3300003886 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004018 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004073 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
| 3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005939 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007510 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300008409 | Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binC | Environmental | Open in IMG/M |
| 3300008468 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10T | Environmental | Open in IMG/M |
| 3300008627 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009494 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010292 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG | Host-Associated | Open in IMG/M |
| 3300010295 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG | Host-Associated | Open in IMG/M |
| 3300010298 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG | Host-Associated | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013118 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300017992 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG | Environmental | Open in IMG/M |
| 3300019707 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MG | Environmental | Open in IMG/M |
| 3300019710 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MG | Environmental | Open in IMG/M |
| 3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
| 3300019713 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019716 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019718 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MG | Environmental | Open in IMG/M |
| 3300019729 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MG | Environmental | Open in IMG/M |
| 3300019743 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_3-4_MG | Environmental | Open in IMG/M |
| 3300021351 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022188 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-10-11_MG | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023298 | Saline water microbial communities from Ace Lake, Antarctica - #183 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025561 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025628 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025801 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025995 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026031 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd (SPAdes) | Environmental | Open in IMG/M |
| 3300026033 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026042 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026072 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300030616 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-2O | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031359 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-40 | Environmental | Open in IMG/M |
| 3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
| 3300031367 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10 | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
| 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_100729862 | 3300000124 | Marine | MFTGTVFIVDAKGSRKNKFAILGVEALAWQGXKTQEYLDIPSFRNAARRDASASKM* |
| BS_KBA_SWE21_205mDRAFT_100865042 | 3300000241 | Marine | GSRKNKFAILVVEAPGWQGAKRQEYLDIPLDIPSFRNAAGRDASASKM* |
| BBDRAFT_104048811 | 3300001371 | Marine Estuarine | FKISGAEAPDWQGANTQEYLDIPSFRNAARQDASAYKM* |
| JGI24024J18818_101199733 | 3300001685 | Marine | NKFTFLGVEAPDWQGTKAKEYQDIPCFSNAARRDGSTDKM* |
| BMAI_10572372 | 3300002822 | Mangrove Soil | LASTTKGSRKNKFAILGVEAPGWQCVKTQEYLEIPSFRTGGRDASTAKM* |
| BMAI_10620643 | 3300002822 | Mangrove Soil | MMRRFHEKNRFAILGVEAPGRQGVKTLEYMDIPSFRTVARRDASASKM* |
| Ga0063293_107598002 | 3300003886 | Hydrothermal Vents | MNNFTFLGVEAPVWQGAKVAEIGDISSFRNAVRQAVRQDESA |
| Ga0055458_102473092 | 3300004000 | Natural And Restored Wetlands | GSRKNKFAILGVEAPAWQGVKTQEYLDIPSFRNAARRDASASRM* |
| Ga0055450_101348912 | 3300004001 | Natural And Restored Wetlands | MISSAKGSRKNKFAILAVEALAWQGAKTQEYLDIPIFRNAARRDAAASKT* |
| Ga0055445_100894821 | 3300004003 | Natural And Restored Wetlands | FGVVTPGRQGTKTQVYFDIPKFRNAAGRDVLAPEMVSCF* |
| Ga0055451_102596981 | 3300004004 | Natural And Restored Wetlands | SGFNGSRKSKFAILGVEAPALQGAKKQEYWDIPSFRNAAGRDASASKM* |
| Ga0055460_100367041 | 3300004011 | Natural And Restored Wetlands | SAYQPNNKIAKGSRKNKFTILGVAAPDWQGTKTQEYLDIPSFHNAAGRDASAYKM* |
| Ga0055456_100781122 | 3300004014 | Natural And Restored Wetlands | MNGATAVKGSRKNLFTILGVEAPVGQGAKAQEYLDIPSFRNAAGRDASA |
| Ga0055452_103307232 | 3300004018 | Natural And Restored Wetlands | GSRKNKFAILGVEAPAWQGAKTQEYLDIPSFCNAARRDASASKM* |
| Ga0055494_100755092 | 3300004048 | Natural And Restored Wetlands | VVTADANTQGSRKNEFAIMGVEAPDRQGAKTQEYLDIPSFRNTAERDASAAKM* |
| Ga0055516_101899231 | 3300004073 | Natural And Restored Wetlands | MLNRLVSKGSRKNKFTILGIQAPGRQNAKTQEYLDIPSFRNAVGRDASA |
| Ga0065183_105880141 | 3300004113 | Pelagic Marine | LMIFAPKGSRKNKFKIFAVEAPVRQGTKRQDYLDIPDFRNAAGQNASACKM* |
| Ga0055515_100397031 | 3300004147 | Natural And Restored Wetlands | MYRFTVLTGKDSRKNKLAILDVVAPGQQGTKTHEYLDIQSLRNAAGRDASASKM* |
| Ga0055521_100207204 | 3300004148 | Natural And Restored Wetlands | MGSLKNKIAFLGVAAPDRQGAKTQEYLDIPGFGNTAGRVAPTSKM* |
| Ga0070728_105365633 | 3300005588 | Marine Sediment | FTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0070727_108653352 | 3300005590 | Marine Sediment | ILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0070726_106123062 | 3300005600 | Marine Sediment | PNISKSDFKLLVAKSLRKNKFAVLGVEAPGRQGAKTQEYLDIPSFCNTAGRDASASKM* |
| Ga0070723_107147632 | 3300005612 | Marine Sediment | GSRRNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0074477_13560641 | 3300005826 | Sediment (Intertidal) | GSRINKFTILGVEARVWQGAKTQEYLDIPSFHNAARRDASVYKM* |
| Ga0074469_100061562 | 3300005832 | Sediment (Intertidal) | LGRAIRGSRKNQFAVLGVEALLRQGAKTQGYLDIPSFRNAAERDASAYKM* |
| Ga0074469_110235182 | 3300005832 | Sediment (Intertidal) | MMGKRSAKGSRKNKFTNLGVEAPVGQGAKTQEYLDIPSFRNAARQDASAYKM* |
| Ga0075123_100096082 | 3300005939 | Saline Lake | MKLTKGSRKNKFAISDVEAPVRQGVGTQEYKHIPSFHNAAGRDVSAPEM* |
| Ga0099972_102778939 | 3300006467 | Marine | RNKFTILGVEAPVWQGAKAQEYRDIPSFRNAARRDASAYKM* |
| Ga0099972_110710051 | 3300006467 | Marine | NKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKI* |
| Ga0099972_111856832 | 3300006467 | Marine | GSRKYKFAILGVETPGRQGVKTLEYLDIQSFRHAAGQDASAFKI* |
| Ga0099972_112397273 | 3300006467 | Marine | MRLSGKGSRRNKFTILGVEAPVWQDAKAQEYRDIPSFRNAARRDASA |
| Ga0099972_122222891 | 3300006467 | Marine | MGSLKNKFAFLGVEAPNRQGAKTQEYLDIPSFRNTAGRDA |
| Ga0099972_122493281 | 3300006467 | Marine | GVEAPVWQGAKTQEYRDIPSFRNAARRDASAYKM* |
| Ga0099972_122832961 | 3300006467 | Marine | IPQGSRKNKFTILGVETPVWQGAKTQEYLDIPSFRNAARRDGSADKM* |
| Ga0099972_132281931 | 3300006467 | Marine | KFTILSVEVSVWQFTKTHEYLDIPSFRNEAGPNASAYEWN* |
| Ga0099972_132524073 | 3300006467 | Marine | MSEVQMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0099972_132871391 | 3300006467 | Marine | VSFLCSLGFTKKKFTILGIEAPVWQGAKTQEYLDIPSFRNAARRDASAHKM* |
| Ga0105013_11082023 | 3300007510 | Marine | GSHKNKLTDLGVQAPGWQGAKARNIWHIPSFRNAARRDAWAHKM* |
| Ga0102950_12069121 | 3300007764 | Soil | GAKAPAWQGAKTQEYPDIPRFRNAAGQDASAYKR* |
| Ga0114885_104219 | 3300008409 | Sediment | RINKFTILDVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0115358_100067394 | 3300008468 | Sediment | MHKGSHKNKFTILSVEAPDWQGAKAQEYQVIPSFRNAARQDASALKM* |
| Ga0115656_10716891 | 3300008627 | Marine | NKFAILGVEASGRQGAKTKAYLDILSFRNAAGRDASASKM* |
| Ga0102962_10665812 | 3300009060 | Soil | MNKFTILGVEAPVWPCAKPQEYLDIPSFRNAVRRDASAFK |
| Ga0102959_11711581 | 3300009138 | Soil | QMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0114918_100306772 | 3300009149 | Deep Subsurface | MLLDFTRGSRNNKFAILSVEALVWQGAKAQARHIPSFRNAARRDSSAVKM* |
| Ga0127413_102177051 | 3300009494 | Methane Seep Sediment | LKGSHKNKFAILSVEAPVWQGAKAQEYQDIPSFCNAAMRDASALKM* |
| Ga0118657_103704833 | 3300009506 | Mangrove Sediment | FNLKQGRPNDNLGSRKNKFAFLGVEAPAWQGANTQEYLDILSFRDAARRDAAVAKM* |
| Ga0123573_104839391 | 3300009509 | Mangrove Sediment | ILGVEAPDRQGAKAQEYLDIPSFRIAAGRDVSAHKM* |
| Ga0123573_114703122 | 3300009509 | Mangrove Sediment | DVEAPAWQGAKTQEYLDIPSFHNAARRDASVSKM* |
| Ga0126326_10002571 | 3300010292 | Marine Gutless Worms | RRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHNM* |
| Ga0126334_100024941 | 3300010295 | Marine Gutless Worms | GSRRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHKM* |
| Ga0126325_100002711 | 3300010298 | Marine Gutless Worms | RRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHKM* |
| Ga0118731_1001307301 | 3300010392 | Marine | KNKFTILGVEAPGWQGVKAQAYRDIPRFHNTARRDASTLKM* |
| Ga0118731_1021236081 | 3300010392 | Marine | GSRRNKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM* |
| Ga0118731_1026837341 | 3300010392 | Marine | SKGSRRNKFTILGVEAPVWQGAKAQEYQDIPSFRNAARRDESAYKM* |
| Ga0118731_1037496111 | 3300010392 | Marine | KNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0118731_1054600113 | 3300010392 | Marine | GVEAPVWQGAKAQEYRDIPSFRNAARRDASAYKM* |
| Ga0118731_1082196931 | 3300010392 | Marine | KFTILGVEAPVWQDAKAQEYRDIPSFRNAARRDASAYKM* |
| Ga0118731_1092756746 | 3300010392 | Marine | MGSLKNKFAFLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM* |
| Ga0118731_1097940301 | 3300010392 | Marine | NKFTILGVEAPVRQGAKTQEYLDIPSFRNAAGRDASAYKM* |
| Ga0118731_1112788931 | 3300010392 | Marine | GVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0118731_1113280733 | 3300010392 | Marine | LGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM* |
| Ga0118731_1115867434 | 3300010392 | Marine | SRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKV* |
| Ga0118731_1129488311 | 3300010392 | Marine | NKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDVSAYKR* |
| Ga0136851_105259621 | 3300010413 | Mangrove Sediment | ILGVEAPDRQGAKAQEYLDIPSFRNAAGREVSAHKM* |
| Ga0118733_1002865266 | 3300010430 | Marine Sediment | LGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKV* |
| Ga0118733_1002912554 | 3300010430 | Marine Sediment | LGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM* |
| Ga0118733_1015359992 | 3300010430 | Marine Sediment | ICVVTAKGSRKNKLAIMGDEAPGRQGTKTQEYLDIPSFRNAAGRDASASKMLSYF* |
| Ga0118733_1037201403 | 3300010430 | Marine Sediment | GSRKNKFVILGVEASGQQGAKMQEYLDIPSFRNTAGRDASASKM* |
| Ga0118733_1062900542 | 3300010430 | Marine Sediment | KGSHKNKFTILGVEAPGWQGVKAEEYRDIPSFHNAVRRDASTYKM* |
| Ga0118733_1063185041 | 3300010430 | Marine Sediment | SQILRVEAPAWQGAKVQEYLDIPSFRNAARRDASACEM* |
| Ga0118733_1071774381 | 3300010430 | Marine Sediment | KFTILGVEAPVWQGAKAQEYLDISSFRNAARRDASAYKM* |
| Ga0118733_1076450081 | 3300010430 | Marine Sediment | NKFTILGVEASDWQGAKTQEYLDIPSFRNAARRDASVYKM* |
| Ga0139324_10658491 | 3300010997 | Sediment | LVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF* |
| Ga0164318_112896271 | 3300013103 | Marine Sediment | ILSVEAPDWQGAKAQEYQDIPSFRNVARQDASALKM* |
| Ga0171656_12217581 | 3300013118 | Marine | KFAILGVEAPGRQGAKTLAYLDILSFRNAAGWDASASKM* |
| Ga0075307_10025493 | 3300014260 | Natural And Restored Wetlands | MFAILGVEAPGWQGAKTQEYLDIPSFRNTAGRVASASKM* |
| Ga0075308_10044492 | 3300014264 | Natural And Restored Wetlands | GSRKNKFTILGVEAPVWQGVKTQEYLDIPSFYNAAGQDATAYKM* |
| Ga0075308_11196181 | 3300014264 | Natural And Restored Wetlands | RKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM* |
| Ga0075305_10286433 | 3300014295 | Natural And Restored Wetlands | LIFSPFFNGQGLRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNEARRDASASKM* |
| Ga0075305_10692351 | 3300014295 | Natural And Restored Wetlands | SSAAQGSQKNKFAILGVEAPAWKGAETEEYLDIPSFRYASRRDASASKMWRYF* |
| Ga0075304_10034373 | 3300014307 | Natural And Restored Wetlands | PGRQGVKTQEYQDIPSFRNATGRDASSSKMLILF* |
| Ga0075304_10126703 | 3300014307 | Natural And Restored Wetlands | LIIDIFPFFNGQGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNEARRDASASKM* |
| Ga0075304_10161653 | 3300014307 | Natural And Restored Wetlands | AILDVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM* |
| Ga0075304_10162273 | 3300014307 | Natural And Restored Wetlands | SRKNKFAISSVEAPAWQGAKTQEYLDIPSFRNAARRDTSASKM* |
| Ga0075350_11863692 | 3300014315 | Natural And Restored Wetlands | GSRKNKFANLGVEAPAWQGAKTQEYLDIPRFRNAASRDASASEM* |
| Ga0075339_10494432 | 3300014316 | Natural And Restored Wetlands | FAILGVEAPAWQGAKTQEYLDIPSFRNTAKRDASASKM* |
| Ga0075339_10700263 | 3300014316 | Natural And Restored Wetlands | MFTGTVFIVDAKGSRKNKFAILGVEALAWQGAKTQEYLDIPSFRNAARRDASASKM* |
| Ga0075339_11360511 | 3300014316 | Natural And Restored Wetlands | KNKCAILGVEALGRQGAKTQEYLDIQSFRNAAGRDVSAFKM* |
| Ga0075339_12146961 | 3300014316 | Natural And Restored Wetlands | WGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDALASKM* |
| Ga0075343_10459121 | 3300014317 | Natural And Restored Wetlands | PIRRIHSNAAWGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDALASKM* |
| Ga0075348_10458893 | 3300014319 | Natural And Restored Wetlands | MPSALRGSRKNKLTILGVEAPDRQGAKTQEYLDIPGFRNIDGRDASAYK |
| Ga0075348_11517682 | 3300014319 | Natural And Restored Wetlands | RKNKFAILGVEAPAWQGAKTQEYLYIPSFRNAARRDASASKM* |
| Ga0164321_104451241 | 3300014903 | Marine Sediment | SLGVEAPAWQGAKVQEYLDIPSFRNAARLDASADKM* |
| Ga0180436_110595561 | 3300017990 | Hypersaline Lake Sediment | KNKFTISGVEAPVRQGAKTQGYPDIPSFRNAAGRDASAHKM |
| Ga0180436_115294311 | 3300017990 | Hypersaline Lake Sediment | MSQHAKGSRKNKFTILGVEASVRQGAKTQEYPDIPSFRNAAGRGASAHKM |
| Ga0180435_104591951 | 3300017992 | Hypersaline Lake Sediment | GSRKNKFTISGVEAPVRQGAKTQEYLDIPSFRNAAGQDASAHKM |
| Ga0180435_106883801 | 3300017992 | Hypersaline Lake Sediment | RPPEGSRKNKFTELGVEAPGWQGAKPQEYRNISRFCNVARRDASAAKM |
| Ga0180435_115862682 | 3300017992 | Hypersaline Lake Sediment | FTISGVEAPVRQGAKTQEYLDIPSFRNAAGWDSSAHKM |
| Ga0180435_116332141 | 3300017992 | Hypersaline Lake Sediment | KFTILGVEAPVRQGAKTQEYLDIPSFRNAARQDAPAHKM |
| Ga0193989_10477422 | 3300019707 | Sediment | LVILGVEAPGQQGVKPQEYLDIPKFCNAAGRDASATKMVSYF |
| Ga0194009_10153202 | 3300019710 | Sediment | LGIAAPAWRGAKTQEYLDLPDFRNAARRDASASKM |
| Ga0193993_10152953 | 3300019711 | Sediment | KTNSRYGATKGSRKNKFTILVVEAPVWQGAKTQEYLDIPSFRNAARRDESADKM |
| Ga0193987_10242111 | 3300019713 | Sediment | NLGVEAPDRQGAKTQECLNIPSFRNIAGRDASAPKM |
| Ga0193984_10436642 | 3300019716 | Sediment | FWGVEAPDRQGAKTQEYLDIPSFRNTDGRDASAYKM |
| Ga0193999_10252182 | 3300019718 | Sediment | MIKKKYASDLRRNKFTILGVEAPVWQGTKTQEYLDIPSFRNAAGRDASTYKM |
| Ga0193968_10503231 | 3300019729 | Sediment | AILGVEAPGRQGAKTQEYLDIPSFRNAARRDASASKM |
| Ga0193992_10757621 | 3300019743 | Sediment | APVWQGAKTQEYLDIPSFRNVTGRDASAYKTGSYF |
| Ga0210365_105106941 | 3300021351 | Estuarine | RKNKFTIIGVEAIDWQGAKTQEYLDIPSFRNAARRDASTYKM |
| Ga0210365_105482932 | 3300021351 | Estuarine | EGSRKNKLVILGVEAPDRQGVKSQEYLDIPRFCNAAGRDASASKIVSYF |
| Ga0210365_106344281 | 3300021351 | Estuarine | KGSRKNKFAILGVEAPGRQGAKTQEYLDIPSFRNADGRDASASKT |
| Ga0210365_106573451 | 3300021351 | Estuarine | VILGVEAPGRQGAKSQEYLDIPRFCNADGRDVSASKMASY |
| Ga0210365_108727613 | 3300021351 | Estuarine | SRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNVARRDASASKM |
| Ga0210365_112409372 | 3300021351 | Estuarine | LAILGVEAPGRQGAKTQEYLDIPSFRNAVGRDASASKM |
| Ga0210365_112409461 | 3300021351 | Estuarine | MLEVQVPQVKGSRINKFTILGVEARVWQGAKTQEYLDIPSFHNAARRDASVYKM |
| Ga0190313_11416991 | 3300022188 | Hydrothermal Vent Sediment | LRNNKLAILSVEAPGWQGAKTQEYQDILSFRNAVRQDAS |
| Ga0224498_100623861 | 3300022202 | Sediment | KFTTLGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0224499_102217042 | 3300022206 | Sediment | KFTILDVEALVWQGAKTQEYLDIPSFRNAASRDVSAYKM |
| Ga0224499_103184332 | 3300022206 | Sediment | GAGSTKGSRINKFTILGAEGPVWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0224502_100804421 | 3300022218 | Sediment | LGVEASDWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0224513_101744351 | 3300022220 | Sediment | MIIYDLTNPIFGTKGSRINKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM |
| Ga0224509_100334241 | 3300022306 | Sediment | MFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRVASAYK |
| Ga0222638_10265491 | 3300023298 | Saline Water | KGSRKNKFVISDVEAPVRQGVGTQEYKHIPSFHNAAGRDVSAPEM |
| (restricted) Ga0255045_104937181 | 3300024528 | Seawater | ILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM |
| Ga0210119_10576262 | 3300025561 | Natural And Restored Wetlands | MLNCTNPKGSRKNKFTFLSVEAPAWQGAKAPEYQDISSFRNAAR |
| Ga0210095_10179303 | 3300025568 | Natural And Restored Wetlands | LAGKGSQKNKFAFLADEAPGLQDAKKQEYLDMPSFRNAAGRHGSAFKM |
| Ga0210095_10432462 | 3300025568 | Natural And Restored Wetlands | FATLGAEAPAWQGAKTPEYLDIPSFRNAVRRAASASKM |
| Ga0210095_10793451 | 3300025568 | Natural And Restored Wetlands | NKFAILSVEAPAWQGAKTPEYLDIPSFLNAARRDASVSKM |
| Ga0210095_11313111 | 3300025568 | Natural And Restored Wetlands | KNKFAILADEAPGRQDARKQEYLDMPSFRNAAGRDGSASKM |
| Ga0210085_10264272 | 3300025583 | Natural And Restored Wetlands | MGSRKKKVAILADEAPGRQDAKKQEYLDMPSFRNAAGRDGSASKM |
| Ga0210085_10524621 | 3300025583 | Natural And Restored Wetlands | MISSAKGSRKNKFAILAVEALAWQGAKTQEYLDIPIFRNAARRDAAASKT |
| Ga0208902_10259831 | 3300025628 | Saline Lake | LGVEAPGWQGAKAQEYLDIPSFRNAARRDASAHKM |
| Ga0208771_10211251 | 3300025698 | Saline Lake | LILNKGSRKNKFAISDVEAPVRQGVGTQEYKYIPSFHNAAGRDVSAPEM |
| Ga0208771_10807232 | 3300025698 | Saline Lake | MKLTKGSRKNKFAISDVEAPVRQGVGTQEYKYIPSFHNAAGRDVSA |
| Ga0210097_10383251 | 3300025801 | Natural And Restored Wetlands | MNGATAVKGSRKNLFTILGVEAPVGQGAKAQEYLDIPSFRNAAGRDASAYKM |
| Ga0209456_100190131 | 3300025883 | Pelagic Marine | GLRINKFTTLDVEAPVWQGAKTQEYLDIPSFRNAARRDVSAYKM |
| Ga0210079_10339161 | 3300025995 | Natural And Restored Wetlands | LRIAFSLNLAMATKGSRKNKFAILGVEAPGRQGAKTQEYLGIPSFRNTAGRDASASKM |
| Ga0210079_10463951 | 3300025995 | Natural And Restored Wetlands | LVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF |
| Ga0208909_10340241 | 3300026031 | Natural And Restored Wetlands | YRWWKKPSKGSRKNKFANLGVEAPGRQGAKTKEYLDIPSFCNMAGRDTSAPKM |
| Ga0208652_10425131 | 3300026033 | Natural And Restored Wetlands | KNKLMILGVEAPGRQGVKPQEYLDIPRFCNAAGRDASATKMAGYF |
| Ga0208538_10114541 | 3300026042 | Natural And Restored Wetlands | AKGSRKNKLAILGVEAPGRQGAKTQEYLDIPSFCNAAGRDALASKMLSYF |
| Ga0208292_10059843 | 3300026072 | Natural And Restored Wetlands | MFTGTVFIVDAKGSRKNKFAILGVEALAWQGAKTQEYLDIPSFRNAARRDASASKM |
| Ga0209379_101989602 | 3300027758 | Marine Sediment | TILGVEAPVWQGAKTQEYRDIPSFRNAARRDASAYKM |
| Ga0209345_107093472 | 3300027852 | Marine | KFAILGVEAPGRQGAKTQEYLDIPSFRNAAGRDASASKMLTQVRQNYGQKV |
| Ga0209013_100108161 | 3300027858 | Marine | LAILSVEAPVWQGAKTQEYQDILSFRNAVRRDASALK |
| Ga0209013_100453231 | 3300027858 | Marine | KNKFTILGVEAPGWQGAKVQEYRDIPNFRNAARRDESAHKM |
| Ga0209536_1002176371 | 3300027917 | Marine Sediment | RKNKFAILGVEAPGRQGVKTPEYLDIPSFRNTDGRDASAYKM |
| Ga0209536_1016716782 | 3300027917 | Marine Sediment | FTILGVEASDWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0272441_105215911 | 3300028920 | Marine Sediment | RKNKFAILIVEALGWRGTKTQEYLDIPSFRNADGRDESKSKM |
| Ga0272441_107620632 | 3300028920 | Marine Sediment | MLGVEALGQQGAKTKEYLDIPSFRNAAGRDASVFKM |
| Ga0272442_104707782 | 3300030616 | Marine Sediment | VTKGSRKNKFAILGVEVPDREGAKTQEYLDIPSFRNTAGRDASAAKM |
| Ga0272442_108683841 | 3300030616 | Marine Sediment | LGVEAPAWQGAETQEYLDIPSFRNAVRRDAPIFKRRRRWQNG |
| Ga0315556_11703322 | 3300031256 | Salt Marsh Sediment | ILGVEAPGRQGVKTQEYLDILSFRNAAGRDASASKM |
| Ga0315556_12043772 | 3300031256 | Salt Marsh Sediment | LGSRENKFTILGIAAPGWQGAKTQEYLDIPSFRNAARRDA |
| Ga0307426_10018231 | 3300031359 | Salt Marsh | KYYFIIFFTIQGVEAPVWQDAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0307445_101249162 | 3300031364 | Salt Marsh | FIIFFTIQGVEAPVRQGAKTQEYLDIPSFRNAAGRDASAYKM |
| Ga0307440_11895651 | 3300031367 | Salt Marsh | RPHECVRMTKGSSRKNKFAILGVEAPGRQGVKTQEYLDILSFRNAAGRDASASKM |
| Ga0307423_10253263 | 3300031371 | Salt Marsh | LAGKGSRKNKFAILADEAPGRQGAKKQEYLDIPSLRNAAGWDGSASKM |
| Ga0307423_11112901 | 3300031371 | Salt Marsh | LGVEAPDRQGAKTQEYLDIPSFCNTAGRDASASKM |
| Ga0307423_12153531 | 3300031371 | Salt Marsh | KFTILGVEALDRQGAKAQEYLDIPSFRNAAGRDASTYKM |
| Ga0316575_100321212 | 3300031665 | Rhizosphere | FLLDCLASKGSRKNKFAILGVEAPSRQGAKTPEYLDIPSFRNAAGRDASASKM |
| Ga0316575_102896403 | 3300031665 | Rhizosphere | ILGVEARGRQGVKTQEYLDIPSFRNAAGRDASVSKM |
| Ga0316579_103444902 | 3300031691 | Rhizosphere | KFVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF |
| Ga0316576_100056411 | 3300031727 | Rhizosphere | ILKVEAPGRQGAKTKGYQYISSFRNVAGRDASAPKM |
| Ga0316576_103435732 | 3300031727 | Rhizosphere | LGVEALVWQGAKTQEYLDIPSFRNAAKRDASAFKM |
| Ga0316578_101389532 | 3300031728 | Rhizosphere | KFAILGVEAPAWQDAKTQEYLDIPKFRNTARRDGSVSKM |
| Ga0316578_101535281 | 3300031728 | Rhizosphere | ILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF |
| Ga0316578_101938812 | 3300031728 | Rhizosphere | LSIRKVIVLGVEAPAWQGAKKQEYLDIPSFRNAARRDASAFKM |
| Ga0316577_101503523 | 3300031733 | Rhizosphere | NKFAIFGVEAPVCQGAKPQEYLDIPSFRSAARRGASASKM |
| Ga0316577_103575671 | 3300031733 | Rhizosphere | KGSRKNKFTILGVEAPAWQGVKTQEYLDIPSFRNAARRDASVYKM |
| Ga0316577_105779112 | 3300031733 | Rhizosphere | ILGVEAPAWKGAKTQEYLDIPSFRNAARREASASKV |
| Ga0315540_101264621 | 3300032061 | Salt Marsh Sediment | MTCQAKDSRKNKFTILGVAAPGRQGAKAQEYLDIPNFRNAARRDAAAYKM |
| Ga0315540_101738501 | 3300032061 | Salt Marsh Sediment | ILGVEALAWQGAKTQEYLDIPSFRNAVRRDASASKI |
| Ga0315540_102437621 | 3300032061 | Salt Marsh Sediment | YRSMLPAKGSRKNKFTILGVAAPGWQGAKTQEYLDIPSFRNAARRDAAANKM |
| Ga0316583_100262593 | 3300032133 | Rhizosphere | VILGVEAPGRQGVKLKEYLYIPIFCKAAGRDASAPKMVNDF |
| Ga0316583_101658602 | 3300032133 | Rhizosphere | MGSLKNKFAFLGVAAPDRQGAKTQEYLDIPGFRNTAGRVASPSKM |
| Ga0316201_103821923 | 3300032136 | Worm Burrow | MGSLKNKFALLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASAS |
| Ga0316585_100064341 | 3300032137 | Rhizosphere | GSRNNKFAILGVEAPGRQGVKTQEYLDIPSFRNAAGRDASASKM |
| Ga0316585_100958261 | 3300032137 | Rhizosphere | KNYFTVLGVEAPGRQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0316585_100967232 | 3300032137 | Rhizosphere | ILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM |
| Ga0316593_101880532 | 3300032168 | Rhizosphere | EKGEFAILGVEAPAWLGVKKQEYRDISSFRNAARQDASASKMRRYF |
| Ga0316187_106210952 | 3300032231 | Worm Burrow | MGSLKNKFAFLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM |
| Ga0316198_100069637 | 3300032251 | Sediment | SRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKS |
| Ga0316198_100121441 | 3300032251 | Sediment | MGSLKNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASK |
| Ga0316198_100492493 | 3300032251 | Sediment | SRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM |
| Ga0316198_101072282 | 3300032251 | Sediment | SLKNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASKM |
| Ga0316196_103530502 | 3300032252 | Sediment | ILGVETPVRQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0316190_109844002 | 3300032259 | Worm Burrow | KNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASKM |
| Ga0316195_101960221 | 3300032263 | Sediment | AILGVEAPGRQGAKTQEYLDIPSFRNTVGRDAPASKM |
| Ga0316195_102460081 | 3300032263 | Sediment | MFAILADEASGRQGKKKQEYLDIPSFRNAAGRDGSASKM |
| Ga0316195_102765111 | 3300032263 | Sediment | ILGVEAPDRQGVKSQEYLDIPRFCNVAGRDASASKMVSHV |
| Ga0316189_100253712 | 3300032272 | Worm Burrow | MGDEAPGRQGTKTQEYLDIPSFRNAAGRDASASKMLSYF |
| Ga0316189_100406296 | 3300032272 | Worm Burrow | MFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAAKRDASAYEM |
| Ga0316189_103922372 | 3300032272 | Worm Burrow | KNKFAILGVEAPGRQGAKTQEYLDIPSFRNTDGRDASAYKM |
| Ga0316189_105775631 | 3300032272 | Worm Burrow | RRNKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKMGSYF |
| Ga0316189_110605312 | 3300032272 | Worm Burrow | DTKGSRNNKFAILGTEAPGRQGAKAPEYRDMPSFRNAAGRDASAYKM |
| Ga0316188_100808061 | 3300032276 | Worm Burrow | MGVEAPGRQGVKSQEYLDIPRFCNAAGRDASASKMVIYFG |
| Ga0316188_101026732 | 3300032276 | Worm Burrow | MGSLKNKFAFFGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM |
| Ga0316193_1000069927 | 3300033429 | Sediment | AAKGSRKNKFTILGVKAPDRQGAKTQEYLDIPSFRNADGRDASASKT |
| Ga0316193_105462022 | 3300033429 | Sediment | LSASFFGGLGVEAPVWQGAKTQEYLDIPSFRNAAGRDASAY |
| Ga0316193_106116591 | 3300033429 | Sediment | KKPFKGSRKNKFAILGVEAPGRQGAKTQKYLDIPSFRNTDGRDASAYKM |
| Ga0316193_107103792 | 3300033429 | Sediment | LNKFTILGVEAPIWQGAKTQEYLDIPSFRNAAKRDASAYKM |
| Ga0316193_107666291 | 3300033429 | Sediment | KFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0316193_109382851 | 3300033429 | Sediment | MSEVQMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAAKRDASAYEM |
| Ga0316193_109405661 | 3300033429 | Sediment | ILGVEAPAWQGAKTLEYLDIPSFRNAARRDASVSKI |
| Ga0316193_114863521 | 3300033429 | Sediment | SRRNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM |
| Ga0316592_11110912 | 3300033524 | Rhizosphere | AILGIEAPDRQSAKTQVDQDIPSFGNAAGRDASASKMLSHF |
| Ga0316592_11686222 | 3300033524 | Rhizosphere | KNRFAILGVEAPDWQGAKTQEYLDISSFRNVAGRDASAPKM |
| ⦗Top⦘ |