


| Basic Information | |
|---|---|
| Family ID | F022735 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 213 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAA |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 213 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.08 % |
| % of genes near scaffold ends (potentially truncated) | 91.08 % |
| % of genes from short scaffolds (< 2000 bps) | 88.73 % |
| Associated GOLD sequencing projects | 162 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.836 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.554 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.127 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.315 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 8.82% Coil/Unstructured: 86.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 213 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 17.84 |
| PF00497 | SBP_bac_3 | 12.21 |
| PF00589 | Phage_integrase | 5.16 |
| PF11794 | HpaB_N | 3.76 |
| PF02016 | Peptidase_S66 | 3.76 |
| PF13781 | DoxX_3 | 2.82 |
| PF01979 | Amidohydro_1 | 1.88 |
| PF13406 | SLT_2 | 1.88 |
| PF04909 | Amidohydro_2 | 1.88 |
| PF03928 | HbpS-like | 1.88 |
| PF01042 | Ribonuc_L-PSP | 1.41 |
| PF02798 | GST_N | 1.41 |
| PF02899 | Phage_int_SAM_1 | 1.41 |
| PF08245 | Mur_ligase_M | 1.41 |
| PF13356 | Arm-DNA-bind_3 | 0.94 |
| PF00106 | adh_short | 0.94 |
| PF01520 | Amidase_3 | 0.94 |
| PF12471 | GTP_CH_N | 0.94 |
| PF01427 | Peptidase_M15 | 0.94 |
| PF13343 | SBP_bac_6 | 0.94 |
| PF13379 | NMT1_2 | 0.47 |
| PF00708 | Acylphosphatase | 0.47 |
| PF06186 | DUF992 | 0.47 |
| PF07958 | DUF1688 | 0.47 |
| PF06123 | CreD | 0.47 |
| PF13594 | Obsolete Pfam Family | 0.47 |
| PF00924 | MS_channel | 0.47 |
| PF01717 | Meth_synt_2 | 0.47 |
| PF01361 | Tautomerase | 0.47 |
| PF00005 | ABC_tran | 0.47 |
| PF00239 | Resolvase | 0.47 |
| PF13546 | DDE_5 | 0.47 |
| PF03869 | Arc | 0.47 |
| PF13531 | SBP_bac_11 | 0.47 |
| PF14588 | YjgF_endoribonc | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 213 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 17.84 |
| COG1619 | Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling) | Cell wall/membrane/envelope biogenesis [M] | 3.76 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.41 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.41 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.41 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.47 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.47 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.84 % |
| Unclassified | root | N/A | 5.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10132094 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300000858|JGI10213J12805_10024823 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300000955|JGI1027J12803_100843404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 745 | Open in IMG/M |
| 3300001431|F14TB_100072588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
| 3300001990|JGI24737J22298_10050984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300003890|Ga0063162_1214005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis methanolica group → Amycolatopsis thermoflava | 513 | Open in IMG/M |
| 3300004114|Ga0062593_101538065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300004156|Ga0062589_102329083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300004643|Ga0062591_102497959 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005093|Ga0062594_101400299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300005178|Ga0066688_10393446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 899 | Open in IMG/M |
| 3300005187|Ga0066675_10102414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1892 | Open in IMG/M |
| 3300005332|Ga0066388_100155637 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
| 3300005332|Ga0066388_103440078 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005332|Ga0066388_107569827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300005336|Ga0070680_100129750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2108 | Open in IMG/M |
| 3300005337|Ga0070682_101411409 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005347|Ga0070668_101456065 | Not Available | 625 | Open in IMG/M |
| 3300005355|Ga0070671_101035926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300005365|Ga0070688_101264358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300005367|Ga0070667_100850845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
| 3300005367|Ga0070667_102022271 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005438|Ga0070701_10944939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 598 | Open in IMG/M |
| 3300005445|Ga0070708_100533212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1107 | Open in IMG/M |
| 3300005539|Ga0068853_101660056 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005545|Ga0070695_100731289 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005548|Ga0070665_102088585 | Not Available | 571 | Open in IMG/M |
| 3300005549|Ga0070704_101805225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300005614|Ga0068856_100576013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300005617|Ga0068859_100657094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| 3300005618|Ga0068864_102445722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005713|Ga0066905_100146592 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300005764|Ga0066903_100234031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2806 | Open in IMG/M |
| 3300005764|Ga0066903_100566713 | Not Available | 1954 | Open in IMG/M |
| 3300005764|Ga0066903_102994039 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005764|Ga0066903_104080097 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005764|Ga0066903_104234938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300005764|Ga0066903_107975979 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005937|Ga0081455_10954230 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006173|Ga0070716_100160662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300006173|Ga0070716_100800768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300006173|Ga0070716_101483947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300006175|Ga0070712_100229508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
| 3300006353|Ga0075370_10487486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300006794|Ga0066658_10585733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 607 | Open in IMG/M |
| 3300006844|Ga0075428_101190973 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006844|Ga0075428_102338486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300006853|Ga0075420_101516766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300006853|Ga0075420_101756062 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006854|Ga0075425_100084243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3598 | Open in IMG/M |
| 3300006871|Ga0075434_100211686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1958 | Open in IMG/M |
| 3300006881|Ga0068865_100741896 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300007076|Ga0075435_101356951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300009012|Ga0066710_103031111 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009090|Ga0099827_10721731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 861 | Open in IMG/M |
| 3300009090|Ga0099827_11777760 | Not Available | 537 | Open in IMG/M |
| 3300009092|Ga0105250_10562689 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 524 | Open in IMG/M |
| 3300009137|Ga0066709_103470080 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009147|Ga0114129_10058949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5369 | Open in IMG/M |
| 3300009156|Ga0111538_12384555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 664 | Open in IMG/M |
| 3300009156|Ga0111538_12477379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 651 | Open in IMG/M |
| 3300009551|Ga0105238_11958519 | Not Available | 619 | Open in IMG/M |
| 3300009553|Ga0105249_11559613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 733 | Open in IMG/M |
| 3300009813|Ga0105057_1117777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300010036|Ga0126305_11215810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 521 | Open in IMG/M |
| 3300010041|Ga0126312_11381195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300010044|Ga0126310_10910600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300010044|Ga0126310_11468137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 558 | Open in IMG/M |
| 3300010046|Ga0126384_10008228 | All Organisms → cellular organisms → Bacteria | 6424 | Open in IMG/M |
| 3300010046|Ga0126384_10862370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300010046|Ga0126384_11667887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 602 | Open in IMG/M |
| 3300010046|Ga0126384_11956921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300010048|Ga0126373_10043301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3970 | Open in IMG/M |
| 3300010359|Ga0126376_12758870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300010360|Ga0126372_10289748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1432 | Open in IMG/M |
| 3300010360|Ga0126372_11088947 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010361|Ga0126378_11616641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300010362|Ga0126377_10020318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5448 | Open in IMG/M |
| 3300010362|Ga0126377_11887911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300010362|Ga0126377_12209593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300010366|Ga0126379_11346590 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300010371|Ga0134125_10508531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1334 | Open in IMG/M |
| 3300010375|Ga0105239_13467134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300010376|Ga0126381_103607975 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010396|Ga0134126_12796891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 529 | Open in IMG/M |
| 3300010398|Ga0126383_10047953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3537 | Open in IMG/M |
| 3300010398|Ga0126383_11278031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300010398|Ga0126383_11502201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300010398|Ga0126383_12124315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300011107|Ga0151490_1265799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300012199|Ga0137383_10265553 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012200|Ga0137382_10945260 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012208|Ga0137376_10048096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3476 | Open in IMG/M |
| 3300012210|Ga0137378_11784807 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012211|Ga0137377_10524739 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300012211|Ga0137377_11604625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300012358|Ga0137368_10102138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2222 | Open in IMG/M |
| 3300012497|Ga0157319_1010561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300012508|Ga0157315_1051714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300012931|Ga0153915_10297871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1800 | Open in IMG/M |
| 3300012961|Ga0164302_10496585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300012961|Ga0164302_11233024 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012971|Ga0126369_10219789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1848 | Open in IMG/M |
| 3300012971|Ga0126369_11542679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 754 | Open in IMG/M |
| 3300012984|Ga0164309_10211828 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300012984|Ga0164309_10650087 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300013297|Ga0157378_12949418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300014968|Ga0157379_12300515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300015371|Ga0132258_10649744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2652 | Open in IMG/M |
| 3300015373|Ga0132257_100409112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1650 | Open in IMG/M |
| 3300015373|Ga0132257_103507987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300015374|Ga0132255_100505462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1776 | Open in IMG/M |
| 3300016319|Ga0182033_11481105 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300016341|Ga0182035_11117164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300016387|Ga0182040_10002333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8897 | Open in IMG/M |
| 3300016387|Ga0182040_11267580 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300016445|Ga0182038_11953372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300017947|Ga0187785_10021066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2304 | Open in IMG/M |
| 3300018060|Ga0187765_10743440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300018429|Ga0190272_13237513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300018432|Ga0190275_13434346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300018433|Ga0066667_11065566 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018469|Ga0190270_10912200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300018469|Ga0190270_12245846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 606 | Open in IMG/M |
| 3300018482|Ga0066669_10018821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3801 | Open in IMG/M |
| 3300018482|Ga0066669_11582315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300019356|Ga0173481_10895120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 500 | Open in IMG/M |
| 3300021073|Ga0210378_10333886 | Not Available | 567 | Open in IMG/M |
| 3300021081|Ga0210379_10366124 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021432|Ga0210384_10203319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1781 | Open in IMG/M |
| 3300021560|Ga0126371_10524818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1333 | Open in IMG/M |
| 3300021560|Ga0126371_11058336 | Not Available | 951 | Open in IMG/M |
| 3300022756|Ga0222622_10798989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 689 | Open in IMG/M |
| 3300025898|Ga0207692_10122473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1458 | Open in IMG/M |
| 3300025899|Ga0207642_11063320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 522 | Open in IMG/M |
| 3300025917|Ga0207660_10151363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300025925|Ga0207650_10651875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 888 | Open in IMG/M |
| 3300025928|Ga0207700_11225265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300025941|Ga0207711_11912430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 536 | Open in IMG/M |
| 3300025945|Ga0207679_10911127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300025986|Ga0207658_10084863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2438 | Open in IMG/M |
| 3300026277|Ga0209350_1042877 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300026312|Ga0209153_1268372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300026819|Ga0207765_101096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3099 | Open in IMG/M |
| 3300026822|Ga0207498_104851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300026853|Ga0207443_1011096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300026960|Ga0207582_1000497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2616 | Open in IMG/M |
| 3300027435|Ga0207553_1007389 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027560|Ga0207981_1081064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300027680|Ga0207826_1142104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300027824|Ga0209040_10276532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300027874|Ga0209465_10577767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300027915|Ga0209069_10019236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3215 | Open in IMG/M |
| 3300027915|Ga0209069_10272055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300028379|Ga0268266_11781540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 590 | Open in IMG/M |
| 3300028811|Ga0307292_10515204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300028878|Ga0307278_10197481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
| 3300029990|Ga0311336_11381728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031199|Ga0307495_10123945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031199|Ga0307495_10184709 | Not Available | 563 | Open in IMG/M |
| 3300031200|Ga0307496_10141789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031543|Ga0318516_10333552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031543|Ga0318516_10349961 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031546|Ga0318538_10146246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1247 | Open in IMG/M |
| 3300031546|Ga0318538_10265171 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031549|Ga0318571_10210654 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031561|Ga0318528_10127241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1349 | Open in IMG/M |
| 3300031561|Ga0318528_10229893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
| 3300031561|Ga0318528_10773622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300031564|Ga0318573_10062175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1848 | Open in IMG/M |
| 3300031564|Ga0318573_10305623 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300031573|Ga0310915_10321274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300031573|Ga0310915_10874215 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031680|Ga0318574_10176986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1220 | Open in IMG/M |
| 3300031713|Ga0318496_10622250 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031744|Ga0306918_10378964 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300031747|Ga0318502_10222177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1097 | Open in IMG/M |
| 3300031748|Ga0318492_10393644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300031765|Ga0318554_10727873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300031770|Ga0318521_10269252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300031778|Ga0318498_10019553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2855 | Open in IMG/M |
| 3300031781|Ga0318547_10132160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1455 | Open in IMG/M |
| 3300031794|Ga0318503_10009246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2543 | Open in IMG/M |
| 3300031820|Ga0307473_11446151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 519 | Open in IMG/M |
| 3300031833|Ga0310917_10397650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300031912|Ga0306921_10414141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1572 | Open in IMG/M |
| 3300031938|Ga0308175_100927272 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031940|Ga0310901_10063354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
| 3300031942|Ga0310916_10628624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300031944|Ga0310884_11070676 | Not Available | 503 | Open in IMG/M |
| 3300031946|Ga0310910_11055418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300031954|Ga0306926_11999192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 652 | Open in IMG/M |
| 3300031959|Ga0318530_10307679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300032002|Ga0307416_101096164 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300032002|Ga0307416_102436603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300032010|Ga0318569_10025994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2401 | Open in IMG/M |
| 3300032025|Ga0318507_10061963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1498 | Open in IMG/M |
| 3300032039|Ga0318559_10299442 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300032063|Ga0318504_10174462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300032076|Ga0306924_10127703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2897 | Open in IMG/M |
| 3300032076|Ga0306924_10334998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1735 | Open in IMG/M |
| 3300032126|Ga0307415_101623092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300032159|Ga0268251_10485015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300032180|Ga0307471_102228602 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300032205|Ga0307472_100043848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2728 | Open in IMG/M |
| 3300032205|Ga0307472_100391765 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300032205|Ga0307472_101695296 | Not Available | 624 | Open in IMG/M |
| 3300032261|Ga0306920_101741268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300032421|Ga0310812_10537504 | Not Available | 525 | Open in IMG/M |
| 3300033004|Ga0335084_12313138 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300033233|Ga0334722_10897511 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300033289|Ga0310914_11568320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300034818|Ga0373950_0076748 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.35% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.41% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.47% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
| Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.47% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.47% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.47% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026822 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027435 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101320941 | 3300000597 | Forest Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCA |
| JGI10213J12805_100248231 | 3300000858 | Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVEG |
| JGI1027J12803_1008434043 | 3300000955 | Soil | MATLTRKSPQGAHKPFAQYSHVVTAQGANKLVFCAGQVAADPTGKVLPP |
| F14TB_1000725881 | 3300001431 | Soil | MATLTRKSSAKAHKPFANYSHVVTAEGANKLVFCAGQVAADPT |
| JGI24737J22298_100509841 | 3300001990 | Corn Rhizosphere | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVA |
| Ga0063162_12140051 | 3300003890 | Hot Spring Sediments | MAKISRSNPDNIAKPFSNYSHVVTVEGAQKLVFCAGQVAA |
| Ga0062593_1015380651 | 3300004114 | Soil | MAKITRINPKTISKPFTNYAHVVTVEGAKKLVFCAGQVAADVDG |
| Ga0062589_1023290831 | 3300004156 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGASKLVFCAGQVAADPTGKV |
| Ga0062591_1024979591 | 3300004643 | Soil | MAKITRINPKTISKPFTNYAHVVTVEGAKKLVFCAGQVAADVKGR |
| Ga0062594_1014002991 | 3300005093 | Soil | MAKITRTNPKTISKPFASYSHVVTAEGAKKLVFCAGQVAAGVDGNV |
| Ga0066688_103934461 | 3300005178 | Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAADPDGK |
| Ga0066675_101024145 | 3300005187 | Soil | VEQEGAMAMITRKNPEGISKPFSNYSHVVTAEGAQKLVF* |
| Ga0066388_1001556373 | 3300005332 | Tropical Forest Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFWRGYPA* |
| Ga0066388_1034400782 | 3300005332 | Tropical Forest Soil | TGREAMAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCA* |
| Ga0066388_1075698271 | 3300005332 | Tropical Forest Soil | MAKISRTNPDGMHKPFAGYSHVVTAEGAQKLVFCAGQVPADPEGKV |
| Ga0070680_1001297501 | 3300005336 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPAG |
| Ga0070682_1014114091 | 3300005337 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAEGASKLVFCAGQVAADPTGKVLPPDD |
| Ga0070668_1014560652 | 3300005347 | Switchgrass Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGADKLVFCAGQVAADP |
| Ga0070671_1010359262 | 3300005355 | Switchgrass Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPAGKVLPPDDFAA |
| Ga0070688_1012643581 | 3300005365 | Switchgrass Rhizosphere | MAKITRLNPEGIAKPFANYSHVVTAEGAQKLVFCAGQVAA |
| Ga0070667_1008508452 | 3300005367 | Switchgrass Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPAGKVLPPDDFAAQTKM |
| Ga0070667_1020222712 | 3300005367 | Switchgrass Rhizosphere | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADVD |
| Ga0070701_109449392 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKITRTNPKTISKPFASYSHVVTAEGAKKLVFCAGQVAAGVDGNVLPPDD |
| Ga0070708_1005332122 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVAADPTGKVLPPDDFAA |
| Ga0068853_1016600562 | 3300005539 | Corn Rhizosphere | MAKITRTNPPTISKPFSNYAHVVTVEEAKKFVFCAGQVAADVDGTVLPPTSFEA |
| Ga0070695_1007312893 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAADPTGKVLPPDDFAA |
| Ga0070665_1020885851 | 3300005548 | Switchgrass Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQ |
| Ga0070704_1018052252 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKITRTNPKTISKPFASYSHVVTAEGAKKLVFCAGQVAAGVDGNVL |
| Ga0068856_1005760133 | 3300005614 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAADPT |
| Ga0068859_1006570941 | 3300005617 | Switchgrass Rhizosphere | MATLTRKSSAKAHKPFANYSHVVTAQGASKLVFCAGQVAADPTGKVLPPDNFGAQTKMV |
| Ga0068864_1024457222 | 3300005618 | Switchgrass Rhizosphere | MAKLNRMNPEGINKPFANYSHVVTAEEGKKFVFCAGQVAADVNGNVLPPDDFEAQAKM |
| Ga0066905_1001465921 | 3300005713 | Tropical Forest Soil | MATLTRRSSAKAHKPFANYSHVVTAQGASKLVFCAGQVAADPTGNVLP |
| Ga0066903_1002340311 | 3300005764 | Tropical Forest Soil | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPTGKVL |
| Ga0066903_1005667132 | 3300005764 | Tropical Forest Soil | GGQTMAKITRTNPEGISKPFSNYSHVVTAEGAQKLVF* |
| Ga0066903_1029940392 | 3300005764 | Tropical Forest Soil | MAMIKRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADVD |
| Ga0066903_1040800972 | 3300005764 | Tropical Forest Soil | QGEKAMAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAER* |
| Ga0066903_1042349382 | 3300005764 | Tropical Forest Soil | RERNAMAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCGCCFVL* |
| Ga0066903_1079759791 | 3300005764 | Tropical Forest Soil | MAKITRTNPEGIAKPFSNYSHVVTAEGAQKLVFCAGQVGADV |
| Ga0081455_109542302 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVA |
| Ga0070716_1001606623 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAADPTGKVLPPDDFA |
| Ga0070716_1008007682 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKISRISPEGIHKPFASYSHVVTAEGAQKLVFCAGQV |
| Ga0070716_1014839471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKISRISPEGIHKPFANYSHVVTAEGAQKLVFCAGQVPADPDG |
| Ga0070712_1002295081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAADPTGKVLPPDD |
| Ga0075370_104874862 | 3300006353 | Populus Endosphere | MATLTRKSSAKAHKPFANYSHVVTAQGASKLVFCAGQVAADPTGKVLPPDNF |
| Ga0066658_105857331 | 3300006794 | Soil | MAKITRLNPEGIATPFANYSHVVTAEGAQKLVFCAGQ |
| Ga0075428_1011909731 | 3300006844 | Populus Rhizosphere | MAKITRINPDGMSKPLANYSHVVTAEGAQKLVFCAGQVAADEDGKV |
| Ga0075428_1023384862 | 3300006844 | Populus Rhizosphere | ITRINPEGISKPFSNYSHVVTAEGAQKLVFDDGHPV* |
| Ga0075420_1015167661 | 3300006853 | Populus Rhizosphere | MATLTRKSSAKAHKPFANYSHVVTAQGASKLVFCAGQVAADPT |
| Ga0075420_1017560622 | 3300006853 | Populus Rhizosphere | MAKITRINPEGVSKPFANYSHVVTAEGAQKLVFCA |
| Ga0075425_1000842431 | 3300006854 | Populus Rhizosphere | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVAADPTGKVL |
| Ga0075434_1002116863 | 3300006871 | Populus Rhizosphere | MATLTRKSSANAHKPCANYSHVVTAQGANKLVFCAGQVAADPAGKVLPPDDFGAQKKW* |
| Ga0068865_1007418962 | 3300006881 | Miscanthus Rhizosphere | MANITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADVDGKV |
| Ga0075435_1013569511 | 3300007076 | Populus Rhizosphere | MAKISRISPEGIHKPFASYSHVVTAEGAQKLVFCAG |
| Ga0066710_1030311112 | 3300009012 | Grasslands Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAG |
| Ga0099827_107217311 | 3300009090 | Vadose Zone Soil | MAKITRINPDGMSKPLANYSHVVTAEGAQKLVFCAGQVAAD |
| Ga0099827_117777601 | 3300009090 | Vadose Zone Soil | MAKITRINPDGIAKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0105250_105626892 | 3300009092 | Switchgrass Rhizosphere | MATLTRKSPQGAHKPFAHYSHVVTAQGANKLVFCAGQVA |
| Ga0066709_1034700803 | 3300009137 | Grasslands Soil | MAMITRKNPEGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0114129_100589494 | 3300009147 | Populus Rhizosphere | MESPMATLTRKSSANAHKPCANYSHVVTAQGANKLVFCAGQVAADPAGKVLPPDDFGAQKKW* |
| Ga0111538_123845551 | 3300009156 | Populus Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGAGKLVFCAGQVAADQTGKVLPPDDFD |
| Ga0111538_124773792 | 3300009156 | Populus Rhizosphere | VAKITRTNPKTISKPFSNYSHVVTAEGAKKLVFCAGQVAADVD |
| Ga0105238_119585191 | 3300009551 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVA |
| Ga0105249_115596131 | 3300009553 | Switchgrass Rhizosphere | MAKITRINPKTISKPFTNYAHVVTVEGAKKLVFCAG |
| Ga0105057_11177772 | 3300009813 | Groundwater Sand | MAKITRINPAEIAKPFSNYAHVVTAEGAQKLVFCA |
| Ga0126305_112158101 | 3300010036 | Serpentine Soil | MAKITRINPKTISKPFTNYAHVVTVEGAKKLVFCAGQVGADVDGQVLPP |
| Ga0126312_113811952 | 3300010041 | Serpentine Soil | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVDG |
| Ga0126310_109106002 | 3300010044 | Serpentine Soil | MAKITRINPDGMSKPPANYSHVVTAEAAQKLVFCA |
| Ga0126310_114681372 | 3300010044 | Serpentine Soil | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADIDGKVLPPD |
| Ga0126384_100082281 | 3300010046 | Tropical Forest Soil | MATLTRKSPQGAHKPFAHYSHVVTAQAANKLVFCAGQVAADPTGKVLPPDD |
| Ga0126384_108623702 | 3300010046 | Tropical Forest Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCA* |
| Ga0126384_116678871 | 3300010046 | Tropical Forest Soil | QGEKAMAKITRSNPEGISKPFSNYSHVVTAEGAQKLVCA* |
| Ga0126384_119569211 | 3300010046 | Tropical Forest Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVSKLVFCAGQVAADPTGKV |
| Ga0126373_100433015 | 3300010048 | Tropical Forest Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCA* |
| Ga0126376_127588702 | 3300010359 | Tropical Forest Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCGCCFVL* |
| Ga0126372_102897481 | 3300010360 | Tropical Forest Soil | MPKISRTNPEGISKPFSNYSHVVTAEGAQKLVFCGCCFVL |
| Ga0126372_110889471 | 3300010360 | Tropical Forest Soil | MAKISRISPEGIHKPFASYSHVVTAEGAQKLVFCAGQVP |
| Ga0126378_116166412 | 3300010361 | Tropical Forest Soil | MAKITRINPDGISKPFSNYSHVVTAEGAQKLVFCAGQVAADV |
| Ga0126377_100203181 | 3300010362 | Tropical Forest Soil | MAKIIRTNPDGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVDGK |
| Ga0126377_118879112 | 3300010362 | Tropical Forest Soil | MAKITRINPDGVAKPFANYSHVVTAEGAQKLVFCAGQVAADADG |
| Ga0126377_122095931 | 3300010362 | Tropical Forest Soil | MATLTRKSSAKAHKPFANYSHVVTAQGASKFVFCAGQ |
| Ga0126379_113465902 | 3300010366 | Tropical Forest Soil | MAKISRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADADGRVLPP |
| Ga0134125_105085312 | 3300010371 | Terrestrial Soil | MIGSKRRTRMTKITRTNPKNIAKPFSNYAHVVTVEGAQKLVFCAGQVA |
| Ga0105239_134671342 | 3300010375 | Corn Rhizosphere | MAKITRTNPKTISKPFTNYAHVVAVEGAKKLIFCAGQVAADVDGKV |
| Ga0126381_1036079752 | 3300010376 | Tropical Forest Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGAD |
| Ga0134126_127968911 | 3300010396 | Terrestrial Soil | MATLTRKSPQGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPTGKVLPPD |
| Ga0126383_100479531 | 3300010398 | Tropical Forest Soil | MAKITRVNPDGIAKPFANYSHVVTAEGAQKLVFCAGQVAA |
| Ga0126383_112780312 | 3300010398 | Tropical Forest Soil | MAKITRINPDGMSKPLANYSHVVTAEGAQKLVFCAGQVA |
| Ga0126383_115022012 | 3300010398 | Tropical Forest Soil | MITRTNPEGISKPFSNYSHVVTVEGAKKLVFCAGQVGAD |
| Ga0126383_121243152 | 3300010398 | Tropical Forest Soil | MATIKRISPPDIAKPFANYSHVVTAEGAQKLVFCA* |
| Ga0151490_12657992 | 3300011107 | Soil | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAG* |
| Ga0137383_102655532 | 3300012199 | Vadose Zone Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLAFCAGQVG |
| Ga0137382_109452601 | 3300012200 | Vadose Zone Soil | MAKIVRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0137376_100480964 | 3300012208 | Vadose Zone Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADV |
| Ga0137378_117848072 | 3300012210 | Vadose Zone Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVLRACFPL* |
| Ga0137377_105247392 | 3300012211 | Vadose Zone Soil | AKIVRTNPEGISKPFSNYSHVVTAEGAQKLVLRACFPL* |
| Ga0137377_116046251 | 3300012211 | Vadose Zone Soil | MAKITRINPDGVSKPFSNYSHLVTAEGAQKLVFCAGQVAADV |
| Ga0137368_101021381 | 3300012358 | Vadose Zone Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVA |
| Ga0157319_10105613 | 3300012497 | Arabidopsis Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGAGKLVFCAGQV |
| Ga0157315_10517142 | 3300012508 | Arabidopsis Rhizosphere | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAPTWTA |
| Ga0153915_102978711 | 3300012931 | Freshwater Wetlands | MIEGGAAMAKITRTNPSNISKPFSNYAHTVTVEGAQKLV |
| Ga0164302_104965852 | 3300012961 | Soil | MAKITRLNPEGIAKPFANYSHVVTAEGAQKLVFCAGQVAAD |
| Ga0164302_112330242 | 3300012961 | Soil | MAKITRINPDGLSKPLANYSHVVTAEGAQKLVFCAGQVA |
| Ga0126369_102197892 | 3300012971 | Tropical Forest Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVCA* |
| Ga0126369_115426793 | 3300012971 | Tropical Forest Soil | MATLTRKSPAAAHEPFAHYSHVVTAQGANKLVFCAGQVAAD |
| Ga0164309_102118281 | 3300012984 | Soil | MANITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADVDGKVLP |
| Ga0164309_106500871 | 3300012984 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVAADPTGKVLPPDDF |
| Ga0157378_129494181 | 3300013297 | Miscanthus Rhizosphere | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAG |
| Ga0157379_123005152 | 3300014968 | Switchgrass Rhizosphere | MAKITRLNPEGIAKPFANYSHVVTAEGAQKLVFCAGQV |
| Ga0132258_106497446 | 3300015371 | Arabidopsis Rhizosphere | NSTGGQTMARIARTNPKGISKPFSNYSHVVTVEGAQKLVF* |
| Ga0132257_1004091121 | 3300015373 | Arabidopsis Rhizosphere | MGKINRINPNTISKPFTNYAHVVTVEGAQKLVFCAGQVAADVDGR |
| Ga0132257_1035079871 | 3300015373 | Arabidopsis Rhizosphere | MAKITRINPDGISKPLANYSHVVTAEGAQKLVFCAGQVAAD |
| Ga0132255_1005054621 | 3300015374 | Arabidopsis Rhizosphere | MAKINRINPNTISKPFTNYAHVVTVEGAQKLVFCAGQVAADVDGRV |
| Ga0182033_114811051 | 3300016319 | Soil | MARIARINPDGMAKPFANYAHVVTAEGAQKLVFCAGQVAADAD |
| Ga0182035_111171641 | 3300016341 | Soil | MAKITRINPEGISKPLANYSHVVTAEGTQKLVFCA |
| Ga0182040_1000233311 | 3300016387 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCYRHIA |
| Ga0182040_112675802 | 3300016387 | Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAG |
| Ga0182038_119533722 | 3300016445 | Soil | MAKITRINPTGLGKPLANYSHVVTAEGAQKLVFCAGQVAADVEGNVLPP |
| Ga0187785_100210661 | 3300017947 | Tropical Peatland | MATLTRKSPAGAHKPFAHYSHVVIAQGASKLVFCAGQ |
| Ga0187765_107434403 | 3300018060 | Tropical Peatland | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAAD |
| Ga0190272_132375132 | 3300018429 | Soil | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVA |
| Ga0190275_134343461 | 3300018432 | Soil | MAKITRINPSNISKPFASYSHVVTAEGTQKLVFAAGQVA |
| Ga0066667_110655662 | 3300018433 | Grasslands Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0190270_109122002 | 3300018469 | Soil | MAKITRINPGNISKPFASYSHLVTAEGAQKLVFAAGQVAADVDGKVLPPDDFAPRPRW |
| Ga0190270_122458462 | 3300018469 | Soil | VAKITRTNPKTISKPFSNYSHVVTAEGAKKLVFCAGQVAADVDG |
| Ga0066669_100188211 | 3300018482 | Grasslands Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKPVFCA |
| Ga0066669_115823151 | 3300018482 | Grasslands Soil | MAKITRINPDGMSKPLANYSHVVTAEAAQKLVFCA |
| Ga0173481_108951201 | 3300019356 | Soil | MAKITRINPKTISKPFTNYAHVVTVEGARKLVFCAGQVAADVDGK |
| Ga0210378_103338861 | 3300021073 | Groundwater Sediment | MATLTRKSPAKAHKPFANYSHVVTAQGANKLVFCAGQV |
| Ga0210379_103661241 | 3300021081 | Groundwater Sediment | MAKITRTNPDTISKPFSNYSHVVTAEGAQKLVFCAGQVAADVE |
| Ga0210384_102033191 | 3300021432 | Soil | MAKITRINPDGLSKPLANYSHVVTAEGAQKLVFCAGQVAADADG |
| Ga0126371_105248181 | 3300021560 | Tropical Forest Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCA |
| Ga0126371_110583361 | 3300021560 | Tropical Forest Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGAD |
| Ga0222622_107989891 | 3300022756 | Groundwater Sediment | MATLTRKSPAGAHKPFANYSHVVTAQGTGKLVFCAGQVA |
| Ga0207692_101224732 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMITRTNPDGISKPFSNYSHVVTAEGAQKLVFCAGQVG |
| Ga0207642_110633201 | 3300025899 | Miscanthus Rhizosphere | MAKITRTNPKTISKPFTNYAHVVTVEGAKKLVFCAGQVAADV |
| Ga0207660_101513632 | 3300025917 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPAGKV |
| Ga0207650_106518751 | 3300025925 | Switchgrass Rhizosphere | MAKITRINPKTISKPFTNYAHVVTVEGARKLVFCAGQVAADVDG |
| Ga0207700_112252651 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMITRTNPDGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0207711_119124301 | 3300025941 | Switchgrass Rhizosphere | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADIK |
| Ga0207679_109111273 | 3300025945 | Corn Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCA |
| Ga0207658_100848634 | 3300025986 | Switchgrass Rhizosphere | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQV |
| Ga0209350_10428773 | 3300026277 | Grasslands Soil | MAKITRTNPEGISKPFSNYSHVVTAEGAQKLVLRACFPL |
| Ga0209153_12683723 | 3300026312 | Soil | FEVEQEGAMAMITRKNPEGISKPFSNYSHVVTAEGAQKLVF |
| Ga0207765_1010961 | 3300026819 | Tropical Forest Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADVAGNVL |
| Ga0207498_1048512 | 3300026822 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVAADPTG |
| Ga0207443_10110961 | 3300026853 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAG |
| Ga0207582_10004974 | 3300026960 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQV |
| Ga0207553_10073891 | 3300027435 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCAGQVAADPTGKVLPPDDFAAAIDCLLARML |
| Ga0207981_10810641 | 3300027560 | Soil | MAKINRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVD |
| Ga0207826_11421041 | 3300027680 | Tropical Forest Soil | MARIARINPDGMAKPFANYAHVVTAEGAQKLVFCAGQVAADADGR |
| Ga0209040_102765322 | 3300027824 | Bog Forest Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAG |
| Ga0209465_105777671 | 3300027874 | Tropical Forest Soil | MAKITRINPDGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVD |
| Ga0209069_100192361 | 3300027915 | Watersheds | MATLTRKSPATAHKPFANYSHVVTAQGANKLVFCAGQVAADPSGRVLPPD |
| Ga0209069_102720552 | 3300027915 | Watersheds | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADV |
| Ga0268266_117815402 | 3300028379 | Switchgrass Rhizosphere | MATLTRKSPAGAHKPFAHYSHVVTAEGASKLVFCAGQVAADPT |
| Ga0307292_105152042 | 3300028811 | Soil | MATLTRKSPAGAHKPFANYSHVVTAQGTGKLVFCAGQVAADPTGKVLPPDDFAAQT |
| Ga0307278_101974812 | 3300028878 | Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0311336_113817282 | 3300029990 | Fen | MAKITRINPDNLSKPFSNYSHVVTAEGAQKLVFCAGQVAADV |
| Ga0307495_101239451 | 3300031199 | Soil | MAKITRINPDGISKPFSNYSHVVTAEGAQKLVFCA |
| Ga0307495_101847092 | 3300031199 | Soil | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAADPSGKV |
| Ga0307496_101417892 | 3300031200 | Soil | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAADVDGK |
| Ga0318516_103335522 | 3300031543 | Soil | MAKINRINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0318516_103499611 | 3300031543 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAGQ |
| Ga0318538_101462464 | 3300031546 | Soil | MAKITRSNPEGMAKPFANYAHVVTVEGAKKLVFCAGQVAADAEG |
| Ga0318538_102651711 | 3300031546 | Soil | MAKITRSNPEGISKPISNYSHVVTAEGAQKLVFCAGQ |
| Ga0318571_102106541 | 3300031549 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADVD |
| Ga0318528_101272411 | 3300031561 | Soil | MAKISRTNPDGIHKPFACYSHVVTAEGAQKLVFCAGQVPADPDGK |
| Ga0318528_102298932 | 3300031561 | Soil | MAKINHINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0318528_107736221 | 3300031561 | Soil | MTKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADADGKV |
| Ga0318573_100621751 | 3300031564 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQV |
| Ga0318573_103056232 | 3300031564 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAG |
| Ga0310915_103212741 | 3300031573 | Soil | TRINPEGISKPLANYSHVVTAEGTQKLVFCYRRIAG |
| Ga0310915_108742151 | 3300031573 | Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCGCRFVLCRA |
| Ga0318574_101769861 | 3300031680 | Soil | MAKITRINPEGISKPLANYSHVVTAEGTQKLVFCAGQVAADVDGKVL |
| Ga0318496_106222501 | 3300031713 | Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQV |
| Ga0306918_103789641 | 3300031744 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADVDGKVLPP |
| Ga0318502_102221772 | 3300031747 | Soil | GVAMAKINRINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0318492_103936442 | 3300031748 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADVDGKVLPPDD |
| Ga0318554_107278731 | 3300031765 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADVDGKV |
| Ga0318521_102692522 | 3300031770 | Soil | MAKITRINPEGISKPLANYSHVVTAEGTQKLVFCYRRIAG |
| Ga0318498_100195533 | 3300031778 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADA |
| Ga0318547_101321601 | 3300031781 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADVDGKVL |
| Ga0318503_100092463 | 3300031794 | Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVG |
| Ga0307473_114461512 | 3300031820 | Hardwood Forest Soil | MATLTRKSPAGAHKPFAHYSHVVTAEGASKLVFCAGQVAA |
| Ga0310917_103976501 | 3300031833 | Soil | KINRINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0306921_104141413 | 3300031912 | Soil | RSLEIGVAMAKINRINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0308175_1009272721 | 3300031938 | Soil | MAKITRINPKTISKPFTNYAHVVTVEGAKKLVFCAGQVAADVKGRVLPPDN |
| Ga0310901_100633542 | 3300031940 | Soil | MATLTRKSSAKAHKPFANYSHVVTAQGVNKLVFCA |
| Ga0310916_106286241 | 3300031942 | Soil | RINPEGVSRPLANYSHVVTAEGAQKLVFCYRRIAG |
| Ga0310884_110706761 | 3300031944 | Soil | MATLTRKSPAGAHKPFAHYSHVVTAQGANKLVFCAGQVAA |
| Ga0310910_110554181 | 3300031946 | Soil | MAKITRINPEGISKPLANYSHVVTAEGTQKLVFCAGQVAADVDGKVLPPDDFNA |
| Ga0306926_119991921 | 3300031954 | Soil | MAKITRISPKGISKPLANYSHVVTAEGAQKLVFCAGHVA |
| Ga0318530_103076792 | 3300031959 | Soil | MAKITRINPEGMSKPLANYSHVVTAEGAQKLVFCAGQVAADPDGKVL |
| Ga0307416_1010961641 | 3300032002 | Rhizosphere | MTKITRTNPSNISKPFTNYSHVVTVEGAQKLVFCAGQVAADV |
| Ga0307416_1024366031 | 3300032002 | Rhizosphere | VAKIVRTNPKTISKPFTNYSHVVTVEGAKKLVFCAGQVAADVDGK |
| Ga0318569_100259941 | 3300032010 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCG |
| Ga0318507_100619633 | 3300032025 | Soil | KAMAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCA |
| Ga0318559_102994421 | 3300032039 | Soil | MAKISRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGAD |
| Ga0318504_101744621 | 3300032063 | Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGA |
| Ga0306924_101277031 | 3300032076 | Soil | MAKITRSNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADAD |
| Ga0306924_103349981 | 3300032076 | Soil | AQGEKAMAKITRSNPEGISKPFSNYSHVVTAEGAQKLFCA |
| Ga0307415_1016230921 | 3300032126 | Rhizosphere | MAKINRINPDGIAKPFSNYSHVVTAEGAQKLVFCAGQVAADAD |
| Ga0268251_104850151 | 3300032159 | Agave | MAKITRINPEGISKPFSNYSHVVTAEGAQKLVFCAGQVAA |
| Ga0307471_1022286021 | 3300032180 | Hardwood Forest Soil | MPKITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADVD |
| Ga0307472_1000438481 | 3300032205 | Hardwood Forest Soil | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQVAADPTG |
| Ga0307472_1003917651 | 3300032205 | Hardwood Forest Soil | MAEITRTNPEGISKPFSNYSHVVTAEGAQKLVFCAGQVGADVD |
| Ga0307472_1016952962 | 3300032205 | Hardwood Forest Soil | MANITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADVDGT |
| Ga0306920_1017412681 | 3300032261 | Soil | MAKITRINPEGISKPLANYSHVVTAEGAQKLVFCAGQVAADVAGNVLPPDDF |
| Ga0310812_105375042 | 3300032421 | Soil | MAKITRTNPKTISKPFSNYAHVVTVEGAKKLVFCAG |
| Ga0335084_123131381 | 3300033004 | Soil | MAKIARTNPKTISKPFSNYAHVVTVEGAKKLVFCAGQVAADV |
| Ga0334722_108975112 | 3300033233 | Sediment | MAKITRINPDGISKPFASYSHVVTAEGAQKLVFCAGQVA |
| Ga0310914_115683201 | 3300033289 | Soil | MAKITRSNPEGMAKPFANYAHVVTVEGAKKLVFCAGQVAADAEGRVL |
| Ga0373950_0076748_1_111 | 3300034818 | Rhizosphere Soil | MATLTRKSPAGAHKPFAHYSHVVTAQGASKLVFCAGQ |
| ⦗Top⦘ |