


| Basic Information | |
|---|---|
| Family ID | F021064 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 220 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LNCIPLDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA |
| Number of Associated Samples | 189 |
| Number of Associated Scaffolds | 220 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 52.73 % |
| % of genes from short scaffolds (< 2000 bps) | 45.91 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.455 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (20.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 220 Family Scaffolds |
|---|---|---|
| PF03161 | LAGLIDADG_2 | 20.45 |
| PF00033 | Cytochrome_B | 5.91 |
| PF13631 | Cytochrom_B_N_2 | 5.45 |
| PF00961 | LAGLIDADG_1 | 2.73 |
| PF00032 | Cytochrom_B_C | 2.27 |
| PF00361 | Proton_antipo_M | 2.27 |
| PF07460 | NUMOD3 | 0.91 |
| PF00115 | COX1 | 0.91 |
| PF07453 | NUMOD1 | 0.91 |
| PF08032 | SpoU_sub_bind | 0.45 |
| PF00116 | COX2 | 0.45 |
| PF13302 | Acetyltransf_3 | 0.45 |
| PF02790 | COX2_TM | 0.45 |
| PF05933 | Fun_ATP-synt_8 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
|---|---|---|---|
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 8.18 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.91 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.45 % |
| All Organisms | root | All Organisms | 29.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_100662229 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 758 | Open in IMG/M |
| 3300005553|Ga0066695_10225597 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1179 | Open in IMG/M |
| 3300005562|Ga0058697_10305994 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales | 759 | Open in IMG/M |
| 3300006804|Ga0079221_10225234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1046 | Open in IMG/M |
| 3300009093|Ga0105240_12133106 | Not Available | 581 | Open in IMG/M |
| 3300009100|Ga0075418_10207284 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
| 3300009144|Ga0058702_10289839 | Not Available | 656 | Open in IMG/M |
| 3300009162|Ga0075423_13089187 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 510 | Open in IMG/M |
| 3300010082|Ga0127469_154985 | Not Available | 687 | Open in IMG/M |
| 3300010092|Ga0127468_1052092 | Not Available | 1119 | Open in IMG/M |
| 3300010100|Ga0127440_1112127 | Not Available | 765 | Open in IMG/M |
| 3300010106|Ga0127472_1130111 | Not Available | 503 | Open in IMG/M |
| 3300010108|Ga0127474_1021496 | Not Available | 560 | Open in IMG/M |
| 3300010121|Ga0127438_1149871 | Not Available | 506 | Open in IMG/M |
| 3300010132|Ga0127455_1016236 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes | 585 | Open in IMG/M |
| 3300010136|Ga0127447_1138021 | Not Available | 561 | Open in IMG/M |
| 3300010141|Ga0127499_1155652 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 806 | Open in IMG/M |
| 3300010146|Ga0126320_1006824 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 511 | Open in IMG/M |
| 3300010331|Ga0123336_10086457 | Not Available | 1895 | Open in IMG/M |
| 3300010337|Ga0134062_10287859 | Not Available | 775 | Open in IMG/M |
| 3300010375|Ga0105239_12325360 | Not Available | 624 | Open in IMG/M |
| 3300010376|Ga0126381_101525683 | Not Available | 966 | Open in IMG/M |
| 3300010857|Ga0126354_1256555 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1337 | Open in IMG/M |
| 3300010861|Ga0126349_1098921 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 830 | Open in IMG/M |
| 3300010865|Ga0126346_1064569 | Not Available | 1128 | Open in IMG/M |
| 3300011073|Ga0138584_1131605 | Not Available | 1093 | Open in IMG/M |
| 3300011079|Ga0138569_1076279 | Not Available | 1173 | Open in IMG/M |
| 3300011089|Ga0138573_1002872 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300011110|Ga0138578_1020417 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae → Physalacriaceae → Armillaria | 933 | Open in IMG/M |
| 3300011120|Ga0150983_12085280 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2343 | Open in IMG/M |
| 3300011120|Ga0150983_13449539 | Not Available | 1945 | Open in IMG/M |
| 3300011120|Ga0150983_13638434 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2376 | Open in IMG/M |
| 3300011120|Ga0150983_13759024 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1873 | Open in IMG/M |
| 3300011120|Ga0150983_14687669 | Not Available | 693 | Open in IMG/M |
| 3300011120|Ga0150983_16026176 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
| 3300011400|Ga0137312_1002624 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 1781 | Open in IMG/M |
| 3300011425|Ga0137441_1127284 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae → Physalacriaceae → Armillaria | 629 | Open in IMG/M |
| 3300012019|Ga0120139_1105198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 711 | Open in IMG/M |
| 3300012205|Ga0137362_10053295 | Not Available | 3305 | Open in IMG/M |
| 3300012212|Ga0150985_119435363 | Not Available | 630 | Open in IMG/M |
| 3300012391|Ga0134035_1289861 | Not Available | 721 | Open in IMG/M |
| 3300012392|Ga0134043_1219206 | Not Available | 552 | Open in IMG/M |
| 3300012393|Ga0134052_1331796 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Phaeosphaeriaceae → Parastagonospora → Parastagonospora nodorum | 1134 | Open in IMG/M |
| 3300012395|Ga0134044_1305699 | Not Available | 1031 | Open in IMG/M |
| 3300012400|Ga0134048_1268840 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Trichocomaceae → Talaromyces → Talaromyces sect. Talaromyces → Talaromyces marneffei | 831 | Open in IMG/M |
| 3300012403|Ga0134049_1384760 | All Organisms → cellular organisms → Eukaryota | 1084 | Open in IMG/M |
| 3300012405|Ga0134041_1205741 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 854 | Open in IMG/M |
| 3300012406|Ga0134053_1147584 | Not Available | 971 | Open in IMG/M |
| 3300012410|Ga0134060_1537992 | Not Available | 873 | Open in IMG/M |
| 3300012469|Ga0150984_100231759 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 2069 | Open in IMG/M |
| 3300012676|Ga0137341_1071591 | Not Available | 577 | Open in IMG/M |
| 3300012683|Ga0137398_10721481 | Not Available | 694 | Open in IMG/M |
| 3300012894|Ga0160427_10223780 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 762 | Open in IMG/M |
| 3300012902|Ga0157291_10000211 | Not Available | 4627 | Open in IMG/M |
| 3300012903|Ga0157289_10230047 | Not Available | 621 | Open in IMG/M |
| 3300012924|Ga0137413_10106568 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Phaeosphaeriaceae → Parastagonospora → Parastagonospora nodorum | 1759 | Open in IMG/M |
| 3300012975|Ga0134110_10333814 | Not Available | 660 | Open in IMG/M |
| 3300013105|Ga0157369_11854442 | Not Available | 612 | Open in IMG/M |
| 3300013308|Ga0157375_12727502 | Not Available | 591 | Open in IMG/M |
| 3300013867|Ga0181467_121279 | Not Available | 533 | Open in IMG/M |
| 3300013870|Ga0181465_108617 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1618 | Open in IMG/M |
| 3300013914|Ga0121410_11368 | Not Available | 776 | Open in IMG/M |
| 3300014150|Ga0134081_10124286 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Trichocomaceae → Talaromyces → Talaromyces sect. Talaromyces → Talaromyces marneffei | 830 | Open in IMG/M |
| 3300014497|Ga0182008_10399315 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 738 | Open in IMG/M |
| 3300014745|Ga0157377_10055347 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2249 | Open in IMG/M |
| 3300015053|Ga0137405_1207634 | Not Available | 571 | Open in IMG/M |
| 3300015200|Ga0173480_10932419 | Not Available | 566 | Open in IMG/M |
| 3300015292|Ga0182141_1036589 | Not Available | 664 | Open in IMG/M |
| 3300015350|Ga0182163_1139428 | Not Available | 751 | Open in IMG/M |
| 3300015354|Ga0182167_1260584 | Not Available | 623 | Open in IMG/M |
| 3300015356|Ga0134073_10386634 | Not Available | 524 | Open in IMG/M |
| 3300015373|Ga0132257_104213842 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 523 | Open in IMG/M |
| 3300015374|Ga0132255_105367343 | Not Available | 542 | Open in IMG/M |
| 3300017446|Ga0182217_1049710 | Not Available | 970 | Open in IMG/M |
| 3300019270|Ga0181512_1347313 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1346 | Open in IMG/M |
| 3300019881|Ga0193707_1145096 | Not Available | 668 | Open in IMG/M |
| 3300020069|Ga0197907_10097334 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 1202 | Open in IMG/M |
| 3300020816|Ga0214090_11623589 | Not Available | 972 | Open in IMG/M |
| 3300021170|Ga0210400_10231259 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales | 1508 | Open in IMG/M |
| 3300021406|Ga0210386_11421076 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 581 | Open in IMG/M |
| 3300022500|Ga0242643_101726 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1201 | Open in IMG/M |
| 3300022532|Ga0242655_10006899 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2023 | Open in IMG/M |
| 3300022533|Ga0242662_10047278 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1100 | Open in IMG/M |
| 3300022722|Ga0242657_1019584 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1265 | Open in IMG/M |
| 3300022894|Ga0247778_1001242 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 12285 | Open in IMG/M |
| 3300023092|Ga0247740_1006966 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4211 | Open in IMG/M |
| 3300027521|Ga0209524_1040600 | Not Available | 978 | Open in IMG/M |
| 3300027768|Ga0209772_10265833 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 544 | Open in IMG/M |
| 3300027869|Ga0209579_10666999 | Not Available | 563 | Open in IMG/M |
| 3300028478|Ga0233375_1056266 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 611 | Open in IMG/M |
| 3300028586|Ga0265798_10799771 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 653 | Open in IMG/M |
| 3300030532|Ga0210290_1497131 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae → Physalacriaceae → Armillaria | 807 | Open in IMG/M |
| 3300030587|Ga0257209_1000556 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2430 | Open in IMG/M |
| 3300030692|Ga0268250_10034502 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Phaeosphaeriaceae → Parastagonospora → Parastagonospora nodorum | 1905 | Open in IMG/M |
| 3300030779|Ga0075378_10088417 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 876 | Open in IMG/M |
| 3300030784|Ga0102758_10050177 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 524 | Open in IMG/M |
| 3300030800|Ga0074032_10122723 | Not Available | 1065 | Open in IMG/M |
| 3300030862|Ga0265753_1021562 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 968 | Open in IMG/M |
| 3300030979|Ga0068589_10141398 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae → Physalacriaceae → Armillaria | 700 | Open in IMG/M |
| 3300031012|Ga0315887_106544 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Bipolaris | 1104 | Open in IMG/M |
| 3300031057|Ga0170834_108796857 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 501 | Open in IMG/M |
| 3300031093|Ga0308197_10211986 | Not Available | 665 | Open in IMG/M |
| 3300031592|Ga0310117_127931 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 550 | Open in IMG/M |
| 3300031708|Ga0310686_101647731 | Not Available | 3800 | Open in IMG/M |
| 3300031939|Ga0308174_10068797 | All Organisms → cellular organisms → Eukaryota | 2451 | Open in IMG/M |
| 3300032159|Ga0268251_10527709 | Not Available | 532 | Open in IMG/M |
| 3300032465|Ga0214493_1033642 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1173 | Open in IMG/M |
| 3300032466|Ga0214503_1000658 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 5113 | Open in IMG/M |
| 3300032466|Ga0214503_1056702 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 1181 | Open in IMG/M |
| 3300032515|Ga0348332_10074699 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2301 | Open in IMG/M |
| 3300032515|Ga0348332_10589979 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 1038 | Open in IMG/M |
| 3300032515|Ga0348332_14224370 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1099 | Open in IMG/M |
| 3300032824|Ga0314735_1066175 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 682 | Open in IMG/M |
| 3300033523|Ga0314768_1035492 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 1587 | Open in IMG/M |
| 3300033542|Ga0314769_1134875 | Not Available | 823 | Open in IMG/M |
| 3300033807|Ga0314866_020519 | Not Available | 964 | Open in IMG/M |
| 3300034130|Ga0370494_001167 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 6856 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 4.55% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.18% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.18% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.73% |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 2.27% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.82% |
| Solar Cell Surface | Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.36% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.36% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.36% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.36% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.36% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.91% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 0.91% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.45% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.45% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.45% |
| Elk Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces | 0.45% |
| Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal | 0.45% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.45% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 0.45% |
| City Subway Metal | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004294 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009384 | Microbial communities of water from Amazon river, Brazil - RCM21 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010331 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010874 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3) | Environmental | Open in IMG/M |
| 3300010976 | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 4) | Host-Associated | Open in IMG/M |
| 3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012062 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC076 MetaG | Host-Associated | Open in IMG/M |
| 3300012132 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA062 MetaG | Host-Associated | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012888 | Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - R | Engineered | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012894 | Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - L | Engineered | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012973 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Day 36 Metagenome | Host-Associated | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013866 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In2P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013867 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013870 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013872 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013914 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -PAB003 | Engineered | Open in IMG/M |
| 3300014123 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In3P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020816 | Food waste microbial community from Durham, Ontario, Canada - FW1 megahit | Engineered | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300023092 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L148-409B-2 | Environmental | Open in IMG/M |
| 3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
| 3300023272 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4 | Environmental | Open in IMG/M |
| 3300025835 | Groundwater microbial communities from aquifer - Crystal Geyser CG17_big_fil_post_rev_8/21/14_2.50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028478 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E16 | Host-Associated | Open in IMG/M |
| 3300028586 | Plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T30 | Environmental | Open in IMG/M |
| 3300028588 | Plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300030532 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030587 | Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-LITTER (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030692 | Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030779 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030800 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030899 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031012 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031453 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud | Environmental | Open in IMG/M |
| 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_00693350 | 2170459013 | Grass Soil | KAILLKGLNCIPLNLDKSVNGKANNANIAENIAITPSNLLGIDLNIA |
| CNXas_10195752 | 3300000545 | Quercus Rhizosphere | TTKTQKAYLLKGLNCKPFDLPKSVIGNNIMANIALNIAITPNNLLGIDLNIA* |
| Ga0006760J45825_1042413 | 3300003158 | Avena Fatua Rhizosphere | KKANLLNGLNWKPFDLPKSVIGNSIIAKIAANIAITPNNLFGIDLNIA* |
| JGI26337J50220_10441731 | 3300003370 | Bog Forest Soil | MKKAILLKGLNCIPLNLDKSVNGKDNNANIAENIAITPNNLLGIDLNI |
| Ga0062387_1006622291 | 3300004091 | Bog Forest Soil | LYVLPFIALVSVNGNANKIKIATNIETTPNNLFGIDLKIA* |
| Ga0068945_11507442 | 3300004294 | Peatlands Soil | FINIKKLTTKIQKANLLKGLNCKPLDLLKSVIGKINIINIALNIAITPNNLLGIDLKIA* |
| Ga0070688_1015268761 | 3300005365 | Switchgrass Rhizosphere | NIKKAALLKGLNCIPLDLLISVIGNNNNIRIAENIAITPNNLLGIDLSIA* |
| Ga0066695_102255974 | 3300005553 | Soil | SLDISVKGITNNIKRAENIAITPNNLLGIDLNIA* |
| Ga0058697_103059943 | 3300005562 | Agave | PLDLL*SVIGKISIINITENIAIRPNNLLGIDISIA* |
| Ga0068854_1004778171 | 3300005578 | Corn Rhizosphere | KKAALLKGLNCIPLDLLTSVIGNSNNARIAANIAITPNNLLGIDLNIA* |
| Ga0068863_1024808662 | 3300005841 | Switchgrass Rhizosphere | LLKGLNCIPLDLLISVIGNNNIIRIAENIAITPNNLLGIDLNIA* |
| Ga0079221_102252341 | 3300006804 | Agricultural Soil | NCIPLDLLTSVIGSNSNIRIAENIAITPNNLLGIDLSIA* |
| Ga0105240_121331061 | 3300009093 | Corn Rhizosphere | NCIPLDLLTSVIGSNSKLRIAANIAITPNNLLGIDLNIA* |
| Ga0075418_102072844 | 3300009100 | Populus Rhizosphere | KPLVLPKSVNGKANIATNEANIATTPNNLLGIDLNIA* |
| Ga0058702_102898391 | 3300009144 | Agave | PLLLPKSVNGIVNSINIAENIAITPSSLLGIDLNMA* |
| Ga0111538_120480201 | 3300009156 | Populus Rhizosphere | AILLKGLNCIPLKLDKSVKGNVSKAKIAANIAITPNNLLGIDLKIA* |
| Ga0075423_130891871 | 3300009162 | Populus Rhizosphere | LNCKPLDLPKSVTGNNIIASMALNIAITPNNLLGIDLNIA* |
| Ga0103861_100701461 | 3300009247 | River Water | IKKLLTNIKKDNLLNGLNCTPLVLLKSVNGMANNIKIAASIAITPNNLLGIDLNIA* |
| Ga0103868_10033541 | 3300009384 | River Water | AILLNGLNCIPLLLLKSVKGIANNIKIAENIAITPNNLLGIDLNIA* |
| Ga0116229_100329041 | 3300009500 | Host-Associated | KAILLKGLNWIPLLLLKSVNGITNKAKIALSIAITPNNLLGIDLNIA* |
| Ga0116229_104004783 | 3300009500 | Host-Associated | KGLNCIPLLLLKSVKGIANNIKIALSIAITPNNLLGIDLKIA* |
| Ga0105237_121980651 | 3300009545 | Corn Rhizosphere | KAILLKGLNCKPLLLPRSVKGITNNINIAANIDITPNNLLGIDLNIA* |
| Ga0116135_10169921 | 3300009665 | Peatland | AILLKGLNCIPLDLLKSVYGIANNINIALNIAITPNNLLGIDLSIA* |
| Ga0116226_104704013 | 3300009787 | Host-Associated | LKGLNCKPLVKPKSALGNIKIINIAANIAITPNNLLGIDLKIA* |
| Ga0123355_106730651 | 3300009826 | Termite Gut | KAILLKGLNCKPLVLPKSVAGKIIIINIANNIATTPNNLLGIDLNIA* |
| Ga0126382_104349801 | 3300010047 | Tropical Forest Soil | KAILLKGLNCIPLNLDISVKGITNNIKIAENIAITPNNLLGIDLKIA* |
| Ga0127439_1538831 | 3300010074 | Grasslands Soil | LPINTKNAILLKGLNCIPLNLDKSVNGINNKIKRAENIAITPNNLLGIDLNIA* |
| Ga0127469_1549851 | 3300010082 | Grasslands Soil | LNCKPFDLPKSVIGNNIIANIAENIAITPNNLLGIDLNIA* |
| Ga0127492_10544861 | 3300010087 | Grasslands Soil | LKGLNCRPLLLPKSAKGIANNIKIALSIAITPNNLLGIDLKIA* |
| Ga0127468_10520921 | 3300010092 | Grasslands Soil | NCIPLDLLTSVIGNNNKIRIAENIAITPNNLLGIDLNIA* |
| Ga0127440_10742291 | 3300010100 | Grasslands Soil | ALLKGLNCKPLVKPRSVLGNIKIINIAANIAITPNNLLGIDLKIA* |
| Ga0127440_11121271 | 3300010100 | Grasslands Soil | LNCIPLKLDKSVKGNTNNAKIAENIAITPNNLLGIDLKIA* |
| Ga0127472_11301111 | 3300010106 | Grasslands Soil | LDLLKSTKGNVNNIRIAENVAITPNNLLGIDLNIA* |
| Ga0127474_10214961 | 3300010108 | Grasslands Soil | NCIPLFLPKSVNGITNNINIAENIAITPNNLLGIDLKIA* |
| Ga0127465_10497253 | 3300010118 | Grasslands Soil | MKKAILLKGLNCIPLNLDKSVKGKDNNANIAENIAITPNNLLGIDLNIA* |
| Ga0127438_11498712 | 3300010121 | Grasslands Soil | CIPLDLLISVTGNNINIRIAENIAITPNNLLGIDLNIA* |
| Ga0127482_10957242 | 3300010126 | Grasslands Soil | ILLKGLNCIPLDLLKSTKGNVNNIRIAANIATTPNNLLGIDLNIA* |
| Ga0127493_10732232 | 3300010130 | Grasslands Soil | KGLNCKPLVAPKSLIGNNIIINIAANIAITPNSLLGIDLKIA* |
| Ga0127455_10162361 | 3300010132 | Grasslands Soil | LDLDKSVKGIANKIKIAENIAITPNNLLGIDLNIA* |
| Ga0127459_11345141 | 3300010133 | Grasslands Soil | NTKKAILLKGLNCIPLKLDKSVKGNINNAKIAENIAITPNNLLGIDLNIA* |
| Ga0127447_10663262 | 3300010136 | Grasslands Soil | INIKKLLIKIKKAILLKGLNCIPLDLDKSVKGIINKINIAENIAITPNNLLGMDLNIA* |
| Ga0127447_11380211 | 3300010136 | Grasslands Soil | NCIPLDLLISVTGKRSNINIAENIAITPNNLLGIDLNMA* |
| Ga0127456_11214851 | 3300010140 | Grasslands Soil | KKPILLKGLNCIPLDLLISIKGNNSKIRIAENIAITPNNLLGIDLKIA* |
| Ga0127499_10843711 | 3300010141 | Grasslands Soil | KAHLLKGLNCIPLDLLTSVIGSNSNIRIAENMAITPNNLLGIDLNIA* |
| Ga0127499_11556523 | 3300010141 | Grasslands Soil | PLVNPKSALGNSKIISIAANIAITPNNLLGIDLKIA* |
| Ga0127483_11666951 | 3300010142 | Grasslands Soil | KKAILLKGLNCTPLNFDKSVIGITIKANMAANIAITPNNLLGIDLNIA* |
| Ga0126320_10068241 | 3300010146 | Soil | FDLPKSVIGNNIMANIALNIAITPNNLLGIDLNIA* |
| Ga0134084_100608621 | 3300010322 | Grasslands Soil | NIKNAILLKGLNCTPLNLDKSVNGIAIKAKIAANIAITPNNLLGIDLNIA* |
| Ga0123336_100864571 | 3300010331 | Glacier Valley | LNCIPLDLDRSVIGIASSTNIAENIAITPNNLLGIDLSIA* |
| Ga0123336_106525432 | 3300010331 | Glacier Valley | LPKGLNCIPLLLLISVNGMANKIKIALNIAITPNNLLGIDLNIA* |
| Ga0134063_102774711 | 3300010335 | Grasslands Soil | AILLKGLNCIPLNLDKSVNGIDNNANIAENIAITPRSLLGIDLNIA* |
| Ga0134062_102878592 | 3300010337 | Grasslands Soil | LLLKSVNGIANSITNAPNIAITPNNLLGIDLNIA* |
| Ga0074044_105580191 | 3300010343 | Bog Forest Soil | KKLATKTQKAILLKGLNCIPLDLLKSVYGIANNINIALNIAITPNNLLGIDLSIA* |
| Ga0134128_108459663 | 3300010373 | Terrestrial Soil | GLNCIPLNLDKSEKGITNKAKIAENMAITPNNLLGIDLNIA* |
| Ga0105239_123253602 | 3300010375 | Corn Rhizosphere | DLLISVIGNNNNIKMAENIAITPNSLFGIDLNIA* |
| Ga0126381_1015256832 | 3300010376 | Tropical Forest Soil | FVLPKSVNGNIKIITKAPNIAKTPNSLLGIDLNIA* |
| Ga0126354_12565555 | 3300010857 | Boreal Forest Soil | RILDVCSNGIANNINSELNIAITPNNLFGIDLKIA* |
| Ga0126345_12283652 | 3300010858 | Boreal Forest Soil | MKKAILLNGLNCIPLNLEKSVNGKDNNANIAENIAITPSNLLGIDLNMA* |
| Ga0126352_11305292 | 3300010859 | Boreal Forest Soil | AILLKGLNWKPLVLPKSLKGNIIILNIAENIAITPNNLLGIDLNIA* |
| Ga0126349_10989214 | 3300010861 | Boreal Forest Soil | LILFVSVNGNTNNIRIATNILITPNNLLGIDLNIA* |
| Ga0126348_11097562 | 3300010862 | Boreal Forest Soil | MKKAILLKGLNCIPLNLDKSVNGKDNNANKAENIAITPSNLLGIDLNIA* |
| Ga0126346_10645691 | 3300010865 | Boreal Forest Soil | LILLVSVNGNTNNIKIATNILITPNSLLGIDLNIA* |
| Ga0126359_10832522 | 3300010869 | Boreal Forest Soil | MKKAILLNGLNCIPLNLDKSANGKDNNVNIAENIAITPSNLLGIDLNIA* |
| Ga0136264_103632992 | 3300010874 | Soil | ANLLKGLNCKPLLLPRSVNGIINRIRMAENIAITPNNLFGIDLNIA* |
| Ga0138317_10982851 | 3300010976 | Fungi-Associated Bovine Rumen | GLNCIPLDLLTSVTGNSNNIRIAANIAITPNNLLGIDLNIA* |
| Ga0138571_1358032 | 3300011050 | Peatlands Soil | IKKLTTKIQKANLLKGLNCKPLDLLKSVIGKINIINIALNIAITPNNLLGIDLKIA* |
| Ga0138584_11316051 | 3300011073 | Peatlands Soil | FPFTLLVSVNGNANNINIATNILITPNNLLGIDLKIA* |
| Ga0138569_10762793 | 3300011079 | Peatlands Soil | PFILLVSVNGNANKIKIATNILTTPNNLFGIDLSMA* |
| Ga0138562_10432801 | 3300011084 | Peatlands Soil | TKNQKAILLRGLNCIPLFLLRSVYGIANSINRAENIAITPNSLLGIDLSIA* |
| Ga0138573_10028723 | 3300011089 | Peatlands Soil | TLLVSVNGNANNINIATNILITPNNLLGIDLKIA* |
| Ga0138578_10204173 | 3300011110 | Peatlands Soil | FTLLVSVNGNANNINIATNILITPNNLLGIDLKIA* |
| Ga0150983_120852801 | 3300011120 | Forest Soil | LILETSANGNTNKINNEPNIAITPNNLLGIDLKIA* |
| Ga0150983_134495391 | 3300011120 | Forest Soil | FILLVSVNGNANSINIATNILITPNSLLGIDLNIA* |
| Ga0150983_136384344 | 3300011120 | Forest Soil | LILEKSANGNINKINNEPNIAITPNNLLGIDLKIA* |
| Ga0150983_137590241 | 3300011120 | Forest Soil | LILDISVKGNINKINNEPNIAITPNNLLGIDLNIA* |
| Ga0150983_146876691 | 3300011120 | Forest Soil | LNCNPLDLPKSTRGNAKIIKIALNIAITPNNLLGIDLRIA* |
| Ga0150983_160261761 | 3300011120 | Forest Soil | TPLNLDKSVIGIINNIKIAENIAITPNNLLGIDLNIA* |
| Ga0137312_10026241 | 3300011400 | Soil | PLDLDKSVNGIINNIKRAENIAITPNNLLGIDLNIA* |
| Ga0137441_11272841 | 3300011425 | Soil | PFILLVSVNGNANNIKIATNIDTTPNNLLGIDLKIA* |
| Ga0120139_11051982 | 3300012019 | Permafrost | LNLDKSVKGIVNKAKIAENIAITPNNLLGIDLNIA* |
| Ga0153992_1139262 | 3300012062 | Attine Ant Fungus Gardens | NRKSVTNKKKAILLRGLNCIPLDLPKSVNDIANSIKIALNIAITPSNLLGIDLNIA* |
| Ga0153978_10215862 | 3300012132 | Attine Ant Fungus Gardens | AILLNGLNCKPLVLPKSTTGNNNKASKAPNMARTPNNLLGIDLKIA* |
| Ga0137362_100532955 | 3300012205 | Vadose Zone Soil | LDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA* |
| Ga0150985_1137516983 | 3300012212 | Avena Fatua Rhizosphere | MKLATNIKNTILLNGLNCIPLVLDRSAYGNANNASNALNIAITPKSLLGIERNIA* |
| Ga0150985_1194353631 | 3300012212 | Avena Fatua Rhizosphere | CIPLDLLTSVIGKSNSIKIAENIAITPNNLLGIDLNIA* |
| Ga0134032_11586671 | 3300012376 | Grasslands Soil | KKAALLKGLNCIPLDLLTSVIGNSNNIRIAENIAITPNNLLGIDLSIA* |
| Ga0134032_12244161 | 3300012376 | Grasslands Soil | IKIRKLATKTKKAILLKGLNCIPLNLFKSVKGIINNINIAENIAITPNSLLGIDLNIA* |
| Ga0134029_11025471 | 3300012377 | Grasslands Soil | KAALLKGLNCIPLDLLISVTGNNNSAKIAANIAMTPNNLLGIDLNIA* |
| Ga0134058_11078312 | 3300012379 | Grasslands Soil | ILLNGLNCIPLNLLKSVKGIANKIKIAENIAITPNNLLGIDLNIA* |
| Ga0134058_11337402 | 3300012379 | Grasslands Soil | TKTKKAILLKGLNCTPLNFDKSVIGITIKANMAANIAITPNNLLGIDLNIA* |
| Ga0134038_12396081 | 3300012382 | Grasslands Soil | ATNNQKPNLLKGLNCKPFDIPKSVIGNNIIANIALNIAITPNNLLGIDLSIA* |
| Ga0134033_11830811 | 3300012383 | Grasslands Soil | KKAALLKGLNCIPLDLLTSVIGSNSSIRIAENIAITPNNLLGIDLNIA* |
| Ga0134030_12374031 | 3300012387 | Grasslands Soil | KINKLATNIKKIILLKGLNCIPLDLDKSVNGNINNIAIALNIAITPNNLLGIDLSMA* |
| Ga0134031_11896411 | 3300012388 | Grasslands Soil | TNTKKAALLKGLNCIPLDLLKSTKGNVNNIRIAANIATTPNNLLGIDLNIA* |
| Ga0134035_12898611 | 3300012391 | Grasslands Soil | LNWKPLDLPKSVIGNINIISIAISIAITPNNLLGIDLNIA* |
| Ga0134043_12192062 | 3300012392 | Grasslands Soil | LNCIPLDLLISVIGNNNKIRIAENIAITPNNLLGIDLNIA* |
| Ga0134052_13317963 | 3300012393 | Grasslands Soil | LDLLTSVIGRINNIKIALNMAITPNSLFGMDLKIA* |
| Ga0134044_13056992 | 3300012395 | Grasslands Soil | LNLDKSVNGIAIKAKIAANIAITPNNLLGIDLNIA* |
| Ga0134048_12688401 | 3300012400 | Grasslands Soil | NLDKSVNDIVNNIKIAENIAITPNSLLGIDLNIA* |
| Ga0134055_13781501 | 3300012401 | Grasslands Soil | ILLKGLNCKPFDLPKSVIGNNIMANIALNIAITPNNLLGIDLNIA* |
| Ga0134049_13847602 | 3300012403 | Grasslands Soil | LNCTPLNLDKSVNGIAIKAKIAANIAITPNNLLGIDLNIA* |
| Ga0134041_12057411 | 3300012405 | Grasslands Soil | LLPKSVNGIANSITNAPNIAITPNNSFGIDLSIA* |
| Ga0134053_11475842 | 3300012406 | Grasslands Soil | LNCTPLNFDKSVIGITIKANMAANIAITPNNLLGIDLNIA* |
| Ga0134060_15379921 | 3300012410 | Grasslands Soil | NCIPLDLPKSVNGIINNIKREVNIAITPNNLLGIDLNIA* |
| Ga0150984_1002317597 | 3300012469 | Avena Fatua Rhizosphere | FDLPKSVIGNNIIINIAASIAITPNNLLGIDLSIA* |
| Ga0150984_1199662051 | 3300012469 | Avena Fatua Rhizosphere | KIQNPNLLKGLNCKPFDLPKSVIGNNIIATNAENIAITPNNLLGIDLSIA* |
| Ga0157347_10355091 | 3300012502 | Arabidopsis Rhizosphere | NTQKENILKGLNCKPFNLPKSATGNNIIANNALNIAITPNNLLGIDLNIA* |
| Ga0137341_10715911 | 3300012676 | Soil | LLLPKSVNGITNNINIAENIAITPNNLLGIDLKIA* |
| Ga0137398_107214811 | 3300012683 | Vadose Zone Soil | KGLNWIPLLLLKSVNGMINKAKIALNIAITPNNLLGIDLNIA* |
| Ga0160429_10464113 | 3300012888 | Solar Cell Surface | TNTKNAILLKGLNCIPLKLDKSVKGITSKANIAENIAITPNNLLGIDLKIA* |
| Ga0160429_13121201 | 3300012888 | Solar Cell Surface | IKKLATKIKKAILLKGLNCKPLLLPRSVKGITNNINIAANIDITPNNLLGIDLKIA* |
| Ga0157284_100685301 | 3300012893 | Soil | NIQKANLLKGLNCKPFDLPKSVIGNNIIANIAANIAITPNNLLGIDLNIA* |
| Ga0160427_102237802 | 3300012894 | Solar Cell Surface | IPLDLLTSVIGNNNNIRIAENMAITPNNLLGIDLNIA* |
| Ga0160427_103951822 | 3300012894 | Solar Cell Surface | AILLKGLNCIPLKLDKSVKGIVSRAKIAENIAITPNNLLGIDLNIA* |
| Ga0157303_102180712 | 3300012896 | Soil | LLNGLNCIPLDLLTSIIGKSSSIKIAENIAITPNSLLGIDLNIA* |
| Ga0157291_100002111 | 3300012902 | Soil | LNCKPFDLPKSVIGNNIIANIAASIAITPNNLLGIDLNIA* |
| Ga0157289_102300471 | 3300012903 | Soil | PLNLDKSEKGRTNKANKAENIAITPNNLLGIDLNIA* |
| Ga0157310_100245673 | 3300012916 | Soil | MANKIKNVATKQKKAILEKGVNSLPLVLEKSVRGSTSKISSEANIPITPKSLLGIDLKIA |
| Ga0137394_101983461 | 3300012922 | Vadose Zone Soil | LKGLNCIPLYLDKSVIGIINIIKIAASIATTPNNLLGIDLNIA* |
| Ga0137413_101065681 | 3300012924 | Vadose Zone Soil | LLLLKSVNGMINKAKIALNIAITPNNLLGIDLNMA* |
| Ga0137416_115515931 | 3300012927 | Vadose Zone Soil | KGLNCIPLNLDKSEKGIAKSAKRAENIAITPNNLLGIDLNIA* |
| Ga0137416_116240741 | 3300012927 | Vadose Zone Soil | KAILLKGLNCIPLLLLKSVKGIANNISIALSIAITPNNLLGIDLNIA* |
| Ga0164242_105985163 | 3300012942 | Compost | LLKGLNCIPLDLLKSVNGIANNIKMALNIAITPNNLLGIDLNIA* |
| Ga0123351_12728061 | 3300012973 | Fecal | KTILLKGLNCIPLDLLISVIGRRSSINIAANIAITPNNLLGIDLNIA* |
| Ga0134110_103338142 | 3300012975 | Grasslands Soil | LDLLTSVIGNNNKLNIAENIAITPNNLLGIDLNIA* |
| Ga0164307_102218371 | 3300012987 | Soil | KLATNTKNAILLKGLNCIPLNLDKSENGIINKAKMAENMAITPNNLFGIDLKIA* |
| Ga0164307_103358291 | 3300012987 | Soil | KFATKTKKAILLKGLNCTPLNFDKSVIGITIKANMAANIAITPNNLLGIDLNIA* |
| Ga0157371_100913861 | 3300013102 | Corn Rhizosphere | VKKLTTNIKKKILLNNLNCIPLDLPKSTKGKTNNINNALNIAITPNNLFGIDLKIA* |
| Ga0157369_103985091 | 3300013105 | Corn Rhizosphere | ANLLKGLNCKPFDLPKSVIGNSIIAKIAANIAITPNNLLGIDLNIA* |
| Ga0157369_105228641 | 3300013105 | Corn Rhizosphere | KTKKAILLKGLNCTPLNFDKSVIGITIKANIAANIAITPNNLLGIDLNIA* |
| Ga0157369_109780363 | 3300013105 | Corn Rhizosphere | KKLTTKTQKANLLKGLNCKPLDLPKSVTGNNIIANMALNIAITPNNLLGIDLNIA* |
| Ga0157369_118544421 | 3300013105 | Corn Rhizosphere | YWKPLVLLLSKKIIDIIINIAANIAITPKSLLGIDLKIA* |
| Ga0157374_110104721 | 3300013296 | Miscanthus Rhizosphere | NLLKGLNCKPLDLPKSVTGNNIIASMALNIAITPNNLLGIDLNIA* |
| Ga0157374_114831023 | 3300013296 | Miscanthus Rhizosphere | IKIKKAALLKGLNCIPLDLLTSVTGNSNNARIAANIAITPNNLLGIDLNIA* |
| Ga0157374_119422921 | 3300013296 | Miscanthus Rhizosphere | NIHSITFNKGLDCDPFNLPISVKDNTNIINIALNIAITPNNLLGIDLNIA* |
| Ga0157378_127394201 | 3300013297 | Miscanthus Rhizosphere | NLLKGLNCKPFDLPKSVIGNNIIINIAASIAITPNNLLGIDLSIA* |
| Ga0163162_104429021 | 3300013306 | Switchgrass Rhizosphere | KLTTKPQKANLLKGLNCKPFDLPKSVTGNNIIANIALNIAITPNNLLGIDLNIA* |
| Ga0157372_114046281 | 3300013307 | Corn Rhizosphere | NTKKAHLLKGLNCIPLDLLISVIGNNNNIRIAENIAITPNNLLGIDLSIA* |
| Ga0157375_127275021 | 3300013308 | Miscanthus Rhizosphere | NCIPLDLLTSVIGNSNNARIAANIAITPNNLLGIDLNIA* |
| Ga0181473_1078593 | 3300013866 | Clean Room | LLKGLNCIPLNLDKSVNGIISKESIAANIAITPNNLLGIDLNIA* |
| Ga0181467_1212793 | 3300013867 | Clean Room | LLLKSVNGITNKIKIAENIAITPNNLLGIDLNIA* |
| Ga0181465_1086172 | 3300013870 | Clean Room | LDLLTSVIGNNNNIRIAENIAITPNNLLGIDLNIA* |
| Ga0181463_10062224 | 3300013872 | Clean Room | MNLQEQKAALLKGLNCIPLDLLTSVIGNSNNIRIAANIAITPNNLLGIDLNIA* |
| Ga0121410_113682 | 3300013914 | City Subway Metal | LNCKPLLLPKSVNGITNNINIAANIAITPSNLLGIDLNIA* |
| Ga0181474_1021082 | 3300014123 | Clean Room | TKKAILLKGLNCIPLLLLKSVKGIANKIKMAENIAITPNNLLGIDLNIA* |
| Ga0134081_101242863 | 3300014150 | Grasslands Soil | LNCKPFDLPKSVIGNNIMANIALNIAITPNNLLGIDLNIA* |
| Ga0182001_101126153 | 3300014488 | Soil | INTKKAILLKGLNCIPLDLLTSVIGKSSNAKIAENIAITPNSLLGMDLNIA* |
| Ga0182008_103993151 | 3300014497 | Rhizosphere | KPLVAPKSLIGNNIIIKIAAIIAITPNNLLGIDLKIA* |
| Ga0157377_100553474 | 3300014745 | Miscanthus Rhizosphere | PFDLPKSVIGNSIIAKIAANIAITPNNLLGIDLNIA* |
| Ga0157376_100575191 | 3300014969 | Miscanthus Rhizosphere | AILLKGLNCIPLSLDKSEKGRTNRANKAENIAITPNNLLGIDLNIA* |
| Ga0157376_111946812 | 3300014969 | Miscanthus Rhizosphere | LLKGLNCKPLDLPKSTKGKTNNINNALNIAITPNNLLGIDLNIA* |
| Ga0137405_12076341 | 3300015053 | Vadose Zone Soil | LLLKSVVKGITNNAKIALNIAITPNNLLGIDLNMA* |
| Ga0173480_100974091 | 3300015200 | Soil | KKAILLKGLNCIPLFLPRSVNGITNKIKSAANIAITPKSLLGIDLNIA* |
| Ga0173480_109324191 | 3300015200 | Soil | NGLNCIPLDLLTSVIGKSNSIKIAENIAITPNNLLGIDLNIA* |
| Ga0182141_10365892 | 3300015292 | Miscanthus Phyllosphere | PLLLPKSVNGITNKIKIAANIDITPSNLLGIDLNIA* |
| Ga0182163_11394283 | 3300015350 | Switchgrass Phyllosphere | CIPLDLLTSVIGNNNNIRIAANIAITPNNLLGIDLNIA* |
| Ga0182167_12505521 | 3300015354 | Switchgrass Phyllosphere | NTKKAPLLKGLNCIPLDLLTSVIGNNSNISIAANIAITPNNLLGIDLKIA* |
| Ga0182167_12605842 | 3300015354 | Switchgrass Phyllosphere | PLLLLKSVKGIANNIKIAENIAITPNNLLGIDLNIA* |
| Ga0134073_102886251 | 3300015356 | Grasslands Soil | QKAILLKGLNCKPFDLPKSVIGKINIISIALNIAITPNNLLGIDLNIA* |
| Ga0134073_103866342 | 3300015356 | Grasslands Soil | LNCIPLNLDKSVNGIVNNANIAENIAITPRSLLGIDLSIA* |
| Ga0132257_1042138421 | 3300015373 | Arabidopsis Rhizosphere | PLNLDKSVIGITIKANIAANIAITPNNLLGIDLKIA* |
| Ga0132255_1053673431 | 3300015374 | Arabidopsis Rhizosphere | PLNLDKSVIGITINANIAANIAITPNNLLGIDLKIA* |
| Ga0182217_10497102 | 3300017446 | Switchgrass Phyllosphere | CIPLDLLISVRGNNNNIRIAENIAITPNNLLGIDLNIA |
| Ga0182205_10068791 | 3300017686 | Miscanthus Phyllosphere | KKAHLLKGLNCIPLDLLISVRSNNNNNIRIAENIAITPNNLLGIDLNIA |
| Ga0190269_102522562 | 3300018465 | Soil | LAIKIKKAILLKGLNCRPLLLLKSVNGIANNINIALSIAITPNNLLGIDLKIA |
| Ga0181512_13473131 | 3300019270 | Peatland | LILDKSVIGNINKINNEPNIANTPNNLLGIDLNIA |
| Ga0193707_11450963 | 3300019881 | Soil | LDLDKSAIGNNIIINNAENIAITPNNLLGIDLKIA |
| Ga0197907_100973341 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLPKSAIGIINNINNDANIAITPNNLLGIDLNIA |
| Ga0214090_116235891 | 3300020816 | Food Waste | GLNCKPLDLPKSTIGKAKIIKIALNIAITPNSLLGIDLSIA |
| Ga0210400_102312594 | 3300021170 | Soil | LNCIPLDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA |
| Ga0210386_114210761 | 3300021406 | Soil | PLDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA |
| Ga0242643_1017261 | 3300022500 | Soil | PLILDKSVKGNINKINNEPNIAITPNNLLGIDLNIA |
| Ga0242655_100068991 | 3300022532 | Soil | LILDISVKGNINKINNEPNIAITPNNLLGIDLNIA |
| Ga0242662_100472782 | 3300022533 | Soil | LILDTSVKGNINKINNEPNIAITPNNLLGIDLKIA |
| Ga0242657_10195843 | 3300022722 | Soil | LILDKSVKGRINNINKDPNIAITPNNLFGIDLKIA |
| Ga0247778_10012421 | 3300022894 | Plant Litter | LNCIPLDLLTSVTGKSNSAKMAENIAITPNNLLGIDLNIA |
| Ga0247740_10069661 | 3300023092 | Plant Litter | KPFDLPKSVIGNNIIINIAASIAITPNNLLGIDLSIA |
| Ga0247762_10352481 | 3300023169 | Plant Litter | LLKGLNCIPLDLLTSVTGKSNSAKMAENIAITPNNLLGIDLNIA |
| Ga0247760_10599552 | 3300023272 | Plant Litter | IKKLATKTKKKNLLIGLNCKPLDLPKSNKGNNIMANIALNIATTPNNLLGIDLKIA |
| Ga0210039_11844282 | 3300025835 | Groundwater | LATNTKKAHLLKGLNCIPLDLLTSVIGNNSSIRIAENIAITPNNLLGIDLNIA |
| Ga0209524_10406001 | 3300027521 | Forest Soil | LKLLPLILLVSTNGNINNIKIATNILITPNNLLGIDLKIA |
| Ga0209772_102658331 | 3300027768 | Bog Forest Soil | NCIPLNLDKSEKGITIKAKSAENIAITPNNLLGIDLKMA |
| Ga0209579_106669991 | 3300027869 | Surface Soil | VFPFILLVSVKGNANSINIATNILITPNSLLGIDLNIA |
| Ga0233375_10562661 | 3300028478 | Elk Feces | PLVLPKSVIGKIKIINIALNIAITPNNLLGIDLNIA |
| Ga0265798_107997711 | 3300028586 | Plant Litter | PLDLLTSVIGNSNNIRIAANIAITPNNLLGIDLNIA |
| Ga0265780_102953922 | 3300028588 | Plant Litter | FATNIKKAALLKGLNCIPLDLLTSVIGNSNNIRIAANIAITPNNLLGIDLNIA |
| Ga0272436_100172121 | 3300030523 | Rock | MKNAALLKGLNCVPLDLERSVKGITSKINIAENIAITPNNLLGIDLSIA |
| Ga0210290_14971311 | 3300030532 | Soil | LILEVSVIGRTNNINKEANIAKTPNNLLGIDLSIA |
| Ga0257209_10005566 | 3300030587 | Host-Associated | LDLLTSVIGNNNNIKMAENIAITPNSLFGIDLNIA |
| Ga0257209_10015821 | 3300030587 | Host-Associated | PNIIKKTKLAKKTKKLILLNGLNXIPLDLAKSTNGIANNARIAENIAITPNSLLGIERNI |
| Ga0268250_100345023 | 3300030692 | Agave | IPLDLLXSVIGKISIINITENIAIRPNNLLGIGISIA |
| Ga0075378_100884173 | 3300030779 | Soil | LDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA |
| Ga0102758_100501771 | 3300030784 | Soil | LDLDKSVKGITNNIKMAENIAITPNNLLGIDLNIA |
| Ga0074032_101227234 | 3300030800 | Soil | LNLDKSVIGIINNIKIAENIAITPNNLLGIDLNIA |
| Ga0308203_10666851 | 3300030829 | Soil | AKIKKAALLKGLNCIPLDLLISVIGNNNIIRIAENIAITPNNLLGIDLNIA |
| Ga0265753_10215621 | 3300030862 | Soil | LILEKSAKGNINKINNEPNIAITPNNLLGIDLKIV |
| Ga0315860_1000941 | 3300030899 | Plant Litter | ILLKGLNCKPLLLLKSVNGITSNINIAENIAITPNNLLGNDINI |
| Ga0068589_101413981 | 3300030979 | Soil | LIFEVSVIGKINNINKEANIAITPNNLLGIDLSIA |
| Ga0315887_1065441 | 3300031012 | Plant Litter | RERDRSVNGITNKIKIAENIASTPANLFGIDLNIA |
| Ga0170834_1087968571 | 3300031057 | Forest Soil | LNLDKSVNGKTNKIKSEPNIANTPSNLLGIDLNMA |
| Ga0308197_102119861 | 3300031093 | Soil | LDLLTSVIGNNNKIRIAENIAITPNSLLGIDLNMA |
| Ga0272433_101448031 | 3300031450 | Rock | KLPTNIKKAALLKGLNCIPLNLDKSVNGIANKIKIAENIAITPNSLLGIDLSIA |
| Ga0272425_10077998 | 3300031453 | Rock | MKFPTNMKNAALLKGLNCVPLDLERSVKGITNNIKIAENIAITPNSLLGIDLSIA |
| Ga0310117_1279311 | 3300031592 | Soil | LILDTSVKGKINNINNEPNIANTPNNLLGIDLKIA |
| Ga0307508_101678713 | 3300031616 | Ectomycorrhiza | KKLATNTKKTALLNGLNCIPLDLLTSVIGNSNKIKIAENIAITPNSLLGIDLNIA |
| Ga0310686_1016477311 | 3300031708 | Soil | XTPLNLDKSVIGIINNIKIAENIAITPNNLLGIDLNIA |
| Ga0308174_100687974 | 3300031939 | Soil | PFDLPKSVIGNSIIAKIAANIAITPNNLFGIDLNIA |
| Ga0268251_105277091 | 3300032159 | Agave | PLDLLXSVIGKISIINITENIAIRPNNLLGIDISIA |
| Ga0214493_10336421 | 3300032465 | Switchgrass Phyllosphere | LDLLTSVIGNSNNARIAANIAITPNNLLGIDLNIA |
| Ga0214503_10006581 | 3300032466 | Switchgrass Phyllosphere | LVLLISVIDNNNNIRIAENIAITPNNLLGIDLNIA |
| Ga0214503_10567021 | 3300032466 | Switchgrass Phyllosphere | LDLPKSVIGNNNIETKAANIAITPNNLLGIDLNIA |
| Ga0348332_100746994 | 3300032515 | Plant Litter | FPLILEKSANGNINKINNEPNIAITPNNLLGIDLKIA |
| Ga0348332_105899791 | 3300032515 | Plant Litter | IPLDLLKSVNGITNNINIALNIAITPNNLLGIDLNIA |
| Ga0348332_142243702 | 3300032515 | Plant Litter | LPLILDTSVKGKINNINNEPNIANTPNNLLGIDLKIA |
| Ga0314735_10661751 | 3300032824 | Switchgrass Phyllosphere | IPLDLLTSVIGNSNNARIAANIAITPNNLLGIDLNIA |
| Ga0314768_10354921 | 3300033523 | Switchgrass Phyllosphere | LLLPKSVKGKIKIIKIAENIAITPNNLLGIDLNIA |
| Ga0314769_11348752 | 3300033542 | Switchgrass Phyllosphere | LDLDKSASGIANNTNIAENIAITPNNLLGIYLSIA |
| Ga0314866_020519_97_234 | 3300033807 | Peatland | MIYNGLYELPLILLVSVNGSNSKINIATNIDITPNNLLGIDRKIA |
| Ga0370494_001167_1_120 | 3300034130 | Untreated Peat Soil | NWIPLLLLKSVNGIANNINIALNIAITPNNLLGIDLNIA |
| Ga0314796_137733_2_157 | 3300034671 | Soil | TKTQKANLLIGLNCKPFDLPKSVIGNSIIAKIAENIAITPNNLFGIDLNIA |
| ⦗Top⦘ |