


| Basic Information | |
|---|---|
| Family ID | F021062 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 220 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 220 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.29 % |
| % of genes near scaffold ends (potentially truncated) | 94.55 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (40.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 220 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 43.64 |
| PF05063 | MT-A70 | 12.27 |
| PF12728 | HTH_17 | 11.82 |
| PF01507 | PAPS_reduct | 5.45 |
| PF00145 | DNA_methylase | 4.55 |
| PF02086 | MethyltransfD12 | 2.73 |
| PF05869 | Dam | 2.27 |
| PF00436 | SSB | 0.45 |
| PF00589 | Phage_integrase | 0.45 |
| PF01170 | UPF0020 | 0.45 |
| PF01041 | DegT_DnrJ_EryC1 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
|---|---|---|---|
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 44.09 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 43.64 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 43.64 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 24.55 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 4.55 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 2.73 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 2.73 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.45 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.45 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.45 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.45 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.45 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.45 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.45 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.45 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.45 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.45 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.09 % |
| All Organisms | root | All Organisms | 30.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 40.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.45% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 8.64% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 5.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.09% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 3.64% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 3.18% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.27% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 1.82% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.36% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.36% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.91% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.91% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.91% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.45% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.45% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.45% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.45% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.45% |
| Hypersaline Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Hypersaline Water | 0.45% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.45% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.45% |
| Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 0.45% |
| Hypersaline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypersaline Water | 0.45% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000557 | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005939 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006999 | Non-marine hypersaline water viral communities from A?ana, Logroño, Spain -Vir_A?ana_2_PRE | Environmental | Open in IMG/M |
| 3300007029 | Non-marine hypersaline water viral communities from A?ana, Logro?o,Spain - Vir_A?ana_3_PRE | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
| 3300009769 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013086 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m | Environmental | Open in IMG/M |
| 3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300014613 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG | Environmental | Open in IMG/M |
| 3300014656 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300019227 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300023246 | Saline water microbial communities from Ace Lake, Antarctica - #1008 | Environmental | Open in IMG/M |
| 3300023295 | Saline water microbial communities from Ace Lake, Antarctica - #1075 | Environmental | Open in IMG/M |
| 3300023297 | Saline water microbial communities from Ace Lake, Antarctica - #187 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025555 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025691 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025824 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes) | Environmental | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028624 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp | Engineered | Open in IMG/M |
| 3300028626 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Phe | Engineered | Open in IMG/M |
| 3300028629 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Leu | Engineered | Open in IMG/M |
| 3300028631 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Arg | Engineered | Open in IMG/M |
| 3300028640 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala | Engineered | Open in IMG/M |
| 3300029255 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110 | Engineered | Open in IMG/M |
| 3300029440 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111 | Engineered | Open in IMG/M |
| 3300029781 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 | Engineered | Open in IMG/M |
| 3300030616 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-2O | Environmental | Open in IMG/M |
| 3300031216 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060 | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SL_8KL_010_SEDDRAFT_101785111 | 3300000557 | Alkaline Sediment | DEKVYFFEPLEKEISVEDMQKIVDANDKFVKGELKDGNK* |
| MLSed_101847081 | 3300001533 | Benthic | FEPLEKEISVEDMQKLVDASKKLVKELKDVELLRQ* |
| MLSed_103098602 | 3300001533 | Benthic | VYFFEPLEKEISVEDMQKVVDANEKLVKELKDEYSKF* |
| Ga0007787_106403122 | 3300004240 | Freshwater Lake | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKGLKDVKD* |
| Ga0074648_10512361 | 3300005512 | Saline Water And Sediment | CFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVREMEDAKD* |
| Ga0074649_10373321 | 3300005613 | Saline Water And Sediment | YFETEDEKVYFFDPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0074649_11140203 | 3300005613 | Saline Water And Sediment | YFETEDEKVYFFDPLEKEISVEDMQKIVDANEKLVKELKDGKD* |
| Ga0075123_101408561 | 3300005939 | Saline Lake | DEKVYFFNPLEKEISVEDMQKIVDASEKLIKELLDEYS* |
| Ga0075464_111039802 | 3300006805 | Aqueous | EKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK* |
| Ga0102676_1084311 | 3300006999 | Hypersaline Water | YFFEPLEKEISVEDMQKIVDINEKLIKEIKNGKSSNRL* |
| Ga0102677_1045761 | 3300007029 | Hypersaline Water | YETEDEKVYFFEPLEKEISVEDMQKIVDINEKLVKDMKDGKSSNRL* |
| Ga0105050_104441463 | 3300007516 | Freshwater | EDEKIYFFEPLEKEISVEDMQQIINANEKIIKEMKDGTNTISK* |
| Ga0102934_15474461 | 3300007537 | Pond Soil | KVYFFEPLEKEISVEDMQKVVDANEKLVKELKNEHSKF* |
| Ga0099850_10812671 | 3300007960 | Aqueous | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGDR* |
| Ga0114918_101446922 | 3300009149 | Deep Subsurface | VVYFFEPLEKEISVEDMQKIVDANEKLVKELKSK* |
| Ga0114918_103350192 | 3300009149 | Deep Subsurface | VYFFEPLEKEISVEDMQKIVDANEKLVKELKYGKD* |
| Ga0114918_103678471 | 3300009149 | Deep Subsurface | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKDWTDTR* |
| Ga0114918_103884812 | 3300009149 | Deep Subsurface | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKVNEIYG* |
| Ga0114918_104050722 | 3300009149 | Deep Subsurface | YFFEPLEKEISVEDMQKIVEANEKLVKELKDGKD* |
| Ga0114918_104836472 | 3300009149 | Deep Subsurface | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKR* |
| Ga0114918_106911192 | 3300009149 | Deep Subsurface | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKKLKDQ* |
| Ga0114919_102843441 | 3300009529 | Deep Subsurface | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKGVGRWK* |
| Ga0114919_104702761 | 3300009529 | Deep Subsurface | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTISK* |
| Ga0114919_104979021 | 3300009529 | Deep Subsurface | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKN* |
| Ga0116190_11255711 | 3300009655 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116190_13121362 | 3300009655 | Anaerobic Digestor Sludge | EKVYFFEPLGKEISLEDMQKIVDANEKLVKELEDRTNPISK* |
| Ga0116182_10008941 | 3300009666 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDNAIHGK* |
| Ga0116182_11339311 | 3300009666 | Anaerobic Digestor Sludge | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDEDKRT* |
| Ga0116182_11973223 | 3300009666 | Anaerobic Digestor Sludge | EKVYFFEPMEKEVSVEDMQKIVDANEKLVKEMKDADR* |
| Ga0116182_12097871 | 3300009666 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDDGSK* |
| Ga0116148_10830301 | 3300009669 | Anaerobic Digestor Sludge | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116148_11146761 | 3300009669 | Anaerobic Digestor Sludge | VYFFEPLEKEISVEDMQKIVDANEKLVKEMKDDGSK* |
| Ga0116148_11893322 | 3300009669 | Anaerobic Digestor Sludge | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELNEK* |
| Ga0116148_12175081 | 3300009669 | Anaerobic Digestor Sludge | QFLASKDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116148_12363451 | 3300009669 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116183_13170751 | 3300009670 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKKVKDYAIYGKQK* |
| Ga0116185_12065561 | 3300009673 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVNEMKDGSK* |
| Ga0116149_11240363 | 3300009675 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDDGSK* |
| Ga0116149_11918482 | 3300009675 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK* |
| Ga0116149_12461001 | 3300009675 | Anaerobic Digestor Sludge | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK* |
| Ga0116149_13077392 | 3300009675 | Anaerobic Digestor Sludge | YFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116187_10105731 | 3300009676 | Anaerobic Digestor Sludge | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116187_11396551 | 3300009676 | Anaerobic Digestor Sludge | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNPISK* |
| Ga0116187_12438321 | 3300009676 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVNEMKDGSK* |
| Ga0116172_103277012 | 3300009682 | Anaerobic Digestor Sludge | FEPLEKEISVEDMQKIVDANEKLVKELKDGKSSNRL* |
| Ga0116142_103346252 | 3300009685 | Anaerobic Digestor Sludge | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116142_105615111 | 3300009685 | Anaerobic Digestor Sludge | EPLEKEISVEDMQKIVDANEKLVNELKDGKSSNRL* |
| Ga0116144_102999871 | 3300009687 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116144_103160663 | 3300009687 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELEDGTNTISK* |
| Ga0116176_102104551 | 3300009688 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKD* |
| Ga0116176_102869401 | 3300009688 | Anaerobic Digestor Sludge | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK* |
| Ga0116176_103010462 | 3300009688 | Anaerobic Digestor Sludge | VYFFEPLEKEISVEDMQKIVDANEKLVKDVKDEHSKF* |
| Ga0116143_102130131 | 3300009690 | Anaerobic Digestor Sludge | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116143_102432421 | 3300009690 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116141_102818053 | 3300009693 | Anaerobic Digestor Sludge | FEPLEKEISVEDMQKIVDANEKLVKELKDGTNPISK* |
| Ga0116145_11995951 | 3300009704 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGDNRVFREL* |
| Ga0116163_12438551 | 3300009713 | Anaerobic Digestor Sludge | PLEKEISVKDMQKIVNANEKLVKEFKNGTDTISE* |
| Ga0116189_11747401 | 3300009714 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNKQNI* |
| Ga0116189_12854391 | 3300009714 | Anaerobic Digestor Sludge | TKDYYETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116160_11409511 | 3300009715 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116161_10559225 | 3300009767 | Anaerobic Digestor Sludge | LQTEDEKVYFFEPLEKEISVEDMHKIVGANEKTFKELKDADR* |
| Ga0116161_10933844 | 3300009767 | Anaerobic Digestor Sludge | FFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTISK* |
| Ga0116193_11698792 | 3300009768 | Anaerobic Digestor Sludge | IKEYFQTEDEKVYFFEPLEKEISVADMQKIVDANEKLVKELKDAKD* |
| Ga0116184_101114353 | 3300009769 | Anaerobic Digestor Sludge | EKVYFFEPLEKEISVEDMQKIVDANENLVKELKDGKSSNRL* |
| Ga0116162_100925561 | 3300009772 | Anaerobic Digestor Sludge | MKIYKILEKEISVEDMQKIVDANEKLVKELEDGTNTISE* |
| Ga0116162_101875372 | 3300009772 | Anaerobic Digestor Sludge | YYEIEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEVKDGSK* |
| Ga0116154_101145161 | 3300009776 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKVVDANEKLVKELKYAKD* |
| Ga0116151_102108771 | 3300009778 | Anaerobic Digestor Sludge | VIKVTKEYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116156_102340053 | 3300009780 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEVKDEHSKF* |
| Ga0116178_104893841 | 3300009781 | Anaerobic Digestor Sludge | FFEPLEKEISVEDMQKIVDANEKLVKELKDGTNPISK* |
| Ga0116245_104622921 | 3300010338 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGDKRT* |
| Ga0116252_102737293 | 3300010342 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDAKD* |
| Ga0116243_1002132310 | 3300010344 | Anaerobic Digestor Sludge | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVNEMKDGSK* |
| Ga0116243_103722251 | 3300010344 | Anaerobic Digestor Sludge | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKD* |
| Ga0116253_105097052 | 3300010345 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNPISK* |
| Ga0116239_102978382 | 3300010346 | Anaerobic Digestor Sludge | LASKDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116239_109335682 | 3300010346 | Anaerobic Digestor Sludge | KEYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK* |
| Ga0116238_101621353 | 3300010347 | Anaerobic Digestor Sludge | YETEDEKIYFFEPLEKEISVEDMQKIVDANEKLVKELKTDECIKFI* |
| Ga0116238_102042781 | 3300010347 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDADR* |
| Ga0116244_107073092 | 3300010350 | Anaerobic Digestor Sludge | VYFFEPLEKEILVDDLQKIVDANEKLVKELKDGTNTISK* |
| Ga0116248_110402572 | 3300010351 | Anaerobic Digestor Sludge | DEKVYFFEPLEKEISVEDMQKIVDANKKLVKELKDGKSSNRL* |
| Ga0116236_102406311 | 3300010353 | Anaerobic Digestor Sludge | EKVYFFEPLEKEILVDDLQKIVDANEKLVKELKDADR* |
| Ga0116236_106401041 | 3300010353 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKDLKNDKN* |
| Ga0116236_111707642 | 3300010353 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGDK* |
| Ga0116242_106430881 | 3300010355 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEVKDEHSKF* |
| Ga0116242_113796371 | 3300010355 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0116237_103324314 | 3300010356 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEILVDDLQKIVDANEKLVKELKDENI* |
| Ga0116237_104767571 | 3300010356 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDNEHSKF* |
| Ga0116237_105758843 | 3300010356 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK* |
| Ga0116251_102261853 | 3300010365 | Anaerobic Digestor Sludge | PLEKEISVGDMQKIVDTNEKLVKELKDGTNTISE* |
| Ga0116241_101635681 | 3300010429 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKYAKD* |
| Ga0154020_107503132 | 3300012956 | Active Sludge | LEVYFFEPLEKEISVEDMQKIVDANEKLVKRLKDGTNTISR* |
| Ga0154020_110439012 | 3300012956 | Active Sludge | PLEKEIPVEDMQKIVDANEKLVKELKDGTNAISR* |
| Ga0163202_11369332 | 3300013086 | Freshwater | KVYFFEPLEKEISVDDMQKIVNANEKLVKELKYGNK* |
| Ga0163203_10796473 | 3300013089 | Freshwater | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKIIKGLKNVELLRE* |
| Ga0163203_10917993 | 3300013089 | Freshwater | FEPLEKEISVDDMQKIVDANEKLVKELKDGTNTISK* |
| (restricted) Ga0172365_107787551 | 3300013127 | Sediment | VYFFEPLEKEISVEDMQKIVNANEKLVKKLKDAKD* |
| (restricted) Ga0172363_100745697 | 3300013130 | Sediment | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGKF* |
| (restricted) Ga0172363_104572183 | 3300013130 | Sediment | VYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTLSK* |
| (restricted) Ga0172363_109901012 | 3300013130 | Sediment | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDNEIHGK* |
| (restricted) Ga0172372_102573843 | 3300013132 | Freshwater | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGED* |
| (restricted) Ga0172372_104589741 | 3300013132 | Freshwater | EYFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| (restricted) Ga0172362_107333203 | 3300013133 | Sediment | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGKF* |
| (restricted) Ga0172375_103292493 | 3300013137 | Freshwater | FETEDEKVYFFEPLEKEISVEDMQKIVDVNEKLVKELKSNEIHRK* |
| (restricted) Ga0172375_104291482 | 3300013137 | Freshwater | EYFETEDEKVYFFEPLEKEISVEDMQKIADANEKLVKELKDAKD* |
| Ga0172378_113520381 | 3300014203 | Groundwater | EDEKVYFFEPLEKEISVEDMQKIVNVNKKLVKGVNDENI* |
| Ga0172381_105528843 | 3300014204 | Landfill Leachate | PLEKEISIGDMQKIVDANEKLVKELKDGTNTISR* |
| Ga0172377_108288622 | 3300014206 | Landfill Leachate | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD* |
| Ga0172377_109888582 | 3300014206 | Landfill Leachate | EKVYFFEPLEKEISVEDMQKIVDANEKLVKGLKDGTNTVSK* |
| Ga0180008_12349861 | 3300014613 | Groundwater | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGSK* |
| Ga0180007_102627651 | 3300014656 | Groundwater | PLEKEISVDDMQKIVDANESLVEKLKNGKSLNIL* |
| Ga0180007_107838481 | 3300014656 | Groundwater | TEDEKVYFFEPLEKEISVEDMQKIVDANENLVEELKDGTNTISE* |
| Ga0180437_110417022 | 3300017963 | Hypersaline Lake Sediment | YFQTEDEKIYFFEPLEKEISVEDMQKIVDANEKLVKELKDNENSRIF |
| Ga0180437_111840832 | 3300017963 | Hypersaline Lake Sediment | VYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKD |
| Ga0180438_105409781 | 3300017971 | Hypersaline Lake Sediment | EIEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGD |
| Ga0180438_108574892 | 3300017971 | Hypersaline Lake Sediment | VYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0180431_104098211 | 3300017987 | Hypersaline Lake Sediment | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGDK |
| Ga0180431_104776501 | 3300017987 | Hypersaline Lake Sediment | KVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDNEIYGK |
| Ga0180432_103942101 | 3300017989 | Hypersaline Lake Sediment | KEYFQTEDEKIYFFEPLEKEISVEDMQKIVDANEKLVKELK |
| Ga0180432_104667021 | 3300017989 | Hypersaline Lake Sediment | FETEDEKIYFFEPLEKEISVEDMQKIVNANEKLVKELKDGKSPNRL |
| Ga0180432_104995431 | 3300017989 | Hypersaline Lake Sediment | KIYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0180432_111766031 | 3300017989 | Hypersaline Lake Sediment | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGKSPNRL |
| Ga0180434_104375681 | 3300017991 | Hypersaline Lake Sediment | EYFQTEDEKIYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0180434_106454371 | 3300017991 | Hypersaline Lake Sediment | VYFFEPLEKEISVEDMQKIVNANEKLVKELKDGTNTISK |
| Ga0180434_107891241 | 3300017991 | Hypersaline Lake Sediment | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGDK |
| Ga0180430_106169872 | 3300018065 | Hypersaline Lake Sediment | FFEPLEKEISVEDMQKIVDANEKLVKEFKDGNKHT |
| Ga0180433_102244121 | 3300018080 | Hypersaline Lake Sediment | KEYFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKNE |
| Ga0180433_104844801 | 3300018080 | Hypersaline Lake Sediment | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEELKDEYSKF |
| Ga0180433_108508042 | 3300018080 | Hypersaline Lake Sediment | YFFEPFEKEISVEDMQKIVNANEKLVKELKDGTNTISK |
| Ga0180433_109268661 | 3300018080 | Hypersaline Lake Sediment | YFQTEDEKIYFFEPLEKEISVEDMQKIVDANEKLVKELK |
| Ga0180433_113588081 | 3300018080 | Hypersaline Lake Sediment | EKVYFFEPLEKEISVEDMQKIVDANEKLVKEMRRWE |
| Ga0179956_12003811 | 3300019227 | Anaerobic Digestor Sludge | EVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0179935_12381112 | 3300019231 | Anaerobic Digestor Sludge | VYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK |
| Ga0222682_10273723 | 3300023246 | Saline Water | EDEKVYFFNPLEKEISVEDMQKIVDASEKLIKELLDEYS |
| Ga0222684_10343121 | 3300023295 | Saline Water | ETEDEKVYFFKPLGKEILVEDMQKIVDASEKLIKELLDEYS |
| Ga0222640_10245093 | 3300023297 | Saline Water | TKEYYETEDEKVYFFNPLEKEISVEDMQKIVDASEKLIKELLDEYS |
| Ga0210003_11054813 | 3300024262 | Deep Subsurface | YFFEPLEKEISVEDMQKIVDANENLVRELKNGKSIRK |
| Ga0210003_11329363 | 3300024262 | Deep Subsurface | FFEPLEKEISIEDMQKIVDANEKLVKELKDGKDNSSN |
| Ga0210003_13673211 | 3300024262 | Deep Subsurface | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKCQQGEK |
| (restricted) Ga0255048_106034752 | 3300024518 | Seawater | LLEDEKVYFFEPLGKEITVEDMQKIVDANEKLVKEVKDGKD |
| Ga0210121_10226471 | 3300025555 | Natural And Restored Wetlands | MEVSNEKVYFFEPLEKEITVEDMQKIVDANEKLVKELKDGKSINSL |
| Ga0208461_10505694 | 3300025613 | Anaerobic Digestor Sludge | VYFFEPLEKEISVEDMQKIVDANEKLVKELEDGTNTISE |
| Ga0208461_10635803 | 3300025613 | Anaerobic Digestor Sludge | KEYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK |
| Ga0209719_10930361 | 3300025677 | Anaerobic Digestor Sludge | FFEPLEKEISVEDMQKIVDANEKLVKELEDGTNTISE |
| Ga0208826_11033882 | 3300025691 | Anaerobic Digestor Sludge | IKEYFQTEDEKVYFFEPLEKEISVADMQKIVDANEKLVKELKDAKD |
| Ga0209201_10842341 | 3300025708 | Anaerobic Digestor Sludge | FFEPLEKEISVEDMQKIVDANEKLVKELKDEDKRT |
| Ga0209201_10968421 | 3300025708 | Anaerobic Digestor Sludge | KVYFFGPLKKEISVDDMQKIVDANEKLVKELKDGTNTVSE |
| Ga0209201_11058092 | 3300025708 | Anaerobic Digestor Sludge | LASKDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0209201_11282161 | 3300025708 | Anaerobic Digestor Sludge | KVYFFEPLEKEILVDDLQKIVDANEKLVKGAKDDER |
| Ga0209310_12209471 | 3300025715 | Anaerobic Digestor Sludge | KVYFFEPLEKEISVEDMQKVVDANEKLVKELKYAKD |
| Ga0208197_10754023 | 3300025720 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK |
| Ga0208196_11352572 | 3300025724 | Anaerobic Digestor Sludge | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0209606_10985272 | 3300025730 | Anaerobic Digestor Sludge | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0208459_11459852 | 3300025748 | Anaerobic Digestor Sludge | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKKMKDGSK |
| Ga0208040_11408161 | 3300025762 | Anaerobic Digestor Sludge | FFEPLEKEISVEDMQKIVDANEKLVKELKDGKSSNRL |
| Ga0209200_10388955 | 3300025784 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK |
| Ga0209200_11191833 | 3300025784 | Anaerobic Digestor Sludge | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGNK |
| Ga0208325_10609571 | 3300025824 | Freshwater | EKVYFFEPLEKEISVEDMQKIVDANEKLVKGLKYGQSIRK |
| Ga0209607_11517822 | 3300025847 | Anaerobic Digestor Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGSK |
| Ga0209604_11726941 | 3300025856 | Anaerobic Digestor Sludge | YFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKDLKNGKN |
| Ga0209604_12286372 | 3300025856 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKDLKNDKN |
| Ga0209604_12508281 | 3300025856 | Anaerobic Digestor Sludge | YFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTISK |
| Ga0208822_11233621 | 3300025866 | Anaerobic Digestor Sludge | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKD |
| Ga0209593_102790181 | 3300027743 | Freshwater Sediment | VYFFVPLEKEVSVEDIQKIVDANEKLVKELKDGKNPNCL |
| Ga0209636_104946601 | 3300027893 | Marine Sediment | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKN |
| (restricted) Ga0255342_10256868 | 3300028567 | Wastewater | VYFFEPLEKEISVEDMQKIVNANEKLVKELKDEDKRT |
| (restricted) Ga0255342_11456111 | 3300028567 | Wastewater | EKVYFFEPLEKEISVEDMQKIVDANEKLVKELIDGNK |
| (restricted) Ga0255342_11659951 | 3300028567 | Wastewater | DEKVYFFEPLEKEILVDDLQKIVDANEKLVKELKDDNRSN |
| (restricted) Ga0255341_12027513 | 3300028570 | Wastewater | CEPLEKEISVEDMQKIVDANEKLVKELEDGTNTISE |
| (restricted) Ga0255340_11691532 | 3300028576 | Wastewater | FFEPLEKEISVEDMQKIVDANEKLVKELEDVNERT |
| (restricted) Ga0255340_11748921 | 3300028576 | Wastewater | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDAKD |
| (restricted) Ga0255340_11930892 | 3300028576 | Wastewater | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKKMKDGSK |
| (restricted) Ga0255347_12158151 | 3300028593 | Wastewater | KEYFETGDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0265294_103188253 | 3300028602 | Groundwater | KVYFFEPLEKEISVEDMQKIVDANEKLVRELKDGTNTISK |
| Ga0302246_10568202 | 3300028624 | Activated Sludge | TKDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELQQ |
| Ga0302244_10247501 | 3300028626 | Activated Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEVKDEHSKF |
| Ga0302244_10453572 | 3300028626 | Activated Sludge | KEYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDAKD |
| Ga0302244_10516861 | 3300028626 | Activated Sludge | EKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDDGSK |
| Ga0302248_10815251 | 3300028629 | Activated Sludge | EKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDAKD |
| Ga0302241_10513101 | 3300028631 | Activated Sludge | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDAKD |
| Ga0302237_10616021 | 3300028640 | Activated Sludge | EKVYFFEPLEKEILVDDLQKIVDANEKLVKEMKDGSK |
| Ga0168097_10568671 | 3300029255 | Biosolids | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKNGKSIRK |
| Ga0168097_10654661 | 3300029255 | Biosolids | FEPLEKEISVEDMQKIVDANEKLVNGLKDGTNTISK |
| Ga0167329_10573461 | 3300029440 | Biosolids | FFEPLEKEISVEDMQKIVDANEKLVRELKDGTNTISE |
| Ga0167330_10410653 | 3300029781 | Biosolids | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKNGKSIRK |
| Ga0272442_105371352 | 3300030616 | Marine Sediment | YFETEDEKVYFFEPLEKEISVEDMQKIANANEKLVKDLKNAKD |
| Ga0307980_10347623 | 3300031216 | Saline Water | VYFFETLEKEISVEDMQKIVNANKKLIKESKDGNKCTKSI |
| Ga0307928_102049491 | 3300031227 | Saline Water | EKVYFFKPLGKEILVEDMQKIVDASEKLIKELLDEYS |
| Ga0307379_105363443 | 3300031565 | Soil | DEKVYFFEPLEKEISVEDMQKILDANEKLVKELKDAKD |
| Ga0307379_105579053 | 3300031565 | Soil | FQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKCQQGEK |
| Ga0307379_105606993 | 3300031565 | Soil | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVKD |
| Ga0307378_110961102 | 3300031566 | Soil | KEYFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMTDGKD |
| Ga0307376_100984164 | 3300031578 | Soil | FQTEDEKVYFFEPLEKEISVKDMQKIVDANQKLIKELKNVELLRE |
| Ga0307376_102770013 | 3300031578 | Soil | YFLTDDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDECTELI |
| Ga0307376_104139482 | 3300031578 | Soil | DEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDNAKD |
| Ga0307376_106078782 | 3300031578 | Soil | FFEPLEKEISVVDMQKIVDANEKLVKELKDGTNTISK |
| Ga0307376_109433741 | 3300031578 | Soil | KEYFETEDEKVYFFEPLEKEISVEDMQKIVDTNEKLVKEMKDGSK |
| Ga0307375_103408971 | 3300031669 | Soil | YFFEPLEKEISVEDMQKIVNTNEKLVKALKDGTNTVSR |
| Ga0307375_105097363 | 3300031669 | Soil | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELMHVDG |
| Ga0307377_103790433 | 3300031673 | Soil | VYFFEPLEKEISVEDMQKIVDANEKVVKELKDGKD |
| Ga0307377_110389532 | 3300031673 | Soil | LINPEDRVTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKDRF |
| Ga0315291_106550193 | 3300031707 | Sediment | VYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTISK |
| Ga0315293_100774756 | 3300031746 | Sediment | FQTEEEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315293_102189621 | 3300031746 | Sediment | LKKHNVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGTNTISK |
| Ga0315293_103130841 | 3300031746 | Sediment | EKVYFFEPLEKEISVEDMQKIVDANEKLVKVLKDAKD |
| Ga0315293_106963571 | 3300031746 | Sediment | VYFFDPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315288_104984131 | 3300031772 | Sediment | VEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDGKF |
| Ga0315288_109686912 | 3300031772 | Sediment | EYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315288_111558932 | 3300031772 | Sediment | MKLSIVEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315290_109212381 | 3300031834 | Sediment | QTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKCQQEEK |
| Ga0315290_109594431 | 3300031834 | Sediment | KVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315274_110071762 | 3300031999 | Sediment | TEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDVELLRQ |
| Ga0315274_110832231 | 3300031999 | Sediment | EYFQTEDEKVYFFEPLEKEISVEDMQKIVNANEKLAKELKDGDK |
| Ga0315274_112741271 | 3300031999 | Sediment | TEDDKVFFFEPLDKSISVEDMQKIVDANEKIIQELKNGKSSDCL |
| Ga0315286_111776591 | 3300032342 | Sediment | QTEDEKVYFFEPLEKEISVEDMQKNVDANEKLVKGLKDGTNTISK |
| Ga0315287_110279791 | 3300032397 | Sediment | YFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDK |
| Ga0315273_106427593 | 3300032516 | Sediment | QTEDEKVYFFEPLEKEISVEDMQKIMDANEKLVKELKDK |
| Ga0315273_106757163 | 3300032516 | Sediment | HNVYFFEPLEKEISVEDMQKIVDANEKLVKELKDAKD |
| Ga0315273_129746011 | 3300032516 | Sediment | EDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDK |
| Ga0335066_0234308_955_1068 | 3300034112 | Freshwater | EKVYFFEPLEKEISVEDMQKIVGANEKLVKELKDAKY |
| ⦗Top⦘ |