


| Basic Information | |
|---|---|
| Family ID | F019691 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 228 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTGLLHEKEFSRKSFVKGGGALIVGFSTVGGLAGKASAAT |
| Number of Associated Samples | 207 |
| Number of Associated Scaffolds | 228 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.11 % |
| % of genes near scaffold ends (potentially truncated) | 94.30 % |
| % of genes from short scaffolds (< 2000 bps) | 97.81 % |
| Associated GOLD sequencing projects | 202 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.193 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.614 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.561 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.684 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 228 Family Scaffolds |
|---|---|---|
| PF01799 | Fer2_2 | 95.18 |
| PF02738 | MoCoBD_1 | 0.88 |
| PF00582 | Usp | 0.44 |
| PF01551 | Peptidase_M23 | 0.44 |
| PF00326 | Peptidase_S9 | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.19 % |
| Unclassified | root | N/A | 22.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT02GNAJW | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105033673 | Not Available | 786 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10180312 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300000955|JGI1027J12803_107385814 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300001333|A21PFW6_1100352 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300004803|Ga0058862_10024819 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300004803|Ga0058862_12774835 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005176|Ga0066679_10526703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 770 | Open in IMG/M |
| 3300005176|Ga0066679_10954447 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005327|Ga0070658_10604507 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005332|Ga0066388_106322966 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005338|Ga0068868_101793522 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005363|Ga0008090_15774163 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005434|Ga0070709_11233519 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005455|Ga0070663_101333999 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005538|Ga0070731_11030204 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005558|Ga0066698_10213950 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300005563|Ga0068855_100165502 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300005586|Ga0066691_10543722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 693 | Open in IMG/M |
| 3300005614|Ga0068856_102586895 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005614|Ga0068856_102663851 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005616|Ga0068852_101724876 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005764|Ga0066903_108021713 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005888|Ga0075289_1054124 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005900|Ga0075272_1068693 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006028|Ga0070717_11936411 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006047|Ga0075024_100497176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 639 | Open in IMG/M |
| 3300006052|Ga0075029_100304811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300006162|Ga0075030_100364439 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300006175|Ga0070712_101850610 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006791|Ga0066653_10186228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300006797|Ga0066659_11184146 | Not Available | 638 | Open in IMG/M |
| 3300006854|Ga0075425_102086338 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006954|Ga0079219_10888921 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009089|Ga0099828_11239920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300009090|Ga0099827_11363438 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009137|Ga0066709_103062715 | Not Available | 612 | Open in IMG/M |
| 3300009143|Ga0099792_10649728 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009143|Ga0099792_10740853 | Not Available | 639 | Open in IMG/M |
| 3300009233|Ga0103856_10079460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300009235|Ga0103857_10084764 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009520|Ga0116214_1206611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 740 | Open in IMG/M |
| 3300009523|Ga0116221_1293838 | Not Available | 703 | Open in IMG/M |
| 3300009551|Ga0105238_11429463 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009662|Ga0105856_1135763 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010046|Ga0126384_11150691 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010073|Ga0127429_113605 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010074|Ga0127439_149094 | Not Available | 702 | Open in IMG/M |
| 3300010075|Ga0127434_143320 | Not Available | 661 | Open in IMG/M |
| 3300010079|Ga0127436_179159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 710 | Open in IMG/M |
| 3300010084|Ga0127461_1003223 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010095|Ga0127475_1035106 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010114|Ga0127460_1026826 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010117|Ga0127449_1123795 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010122|Ga0127488_1131750 | Not Available | 718 | Open in IMG/M |
| 3300010124|Ga0127498_1075777 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010136|Ga0127447_1183205 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010139|Ga0127464_1195472 | Not Available | 677 | Open in IMG/M |
| 3300010145|Ga0126321_1310996 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010325|Ga0134064_10226169 | Not Available | 682 | Open in IMG/M |
| 3300010366|Ga0126379_13067573 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010371|Ga0134125_11530101 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010376|Ga0126381_104045479 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010396|Ga0134126_11105056 | Not Available | 884 | Open in IMG/M |
| 3300010862|Ga0126348_1015824 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300011080|Ga0138568_1047459 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300011996|Ga0120156_1055975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
| 3300012074|Ga0154001_1048999 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012199|Ga0137383_11284887 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012200|Ga0137382_11012329 | Not Available | 596 | Open in IMG/M |
| 3300012203|Ga0137399_10841185 | Not Available | 773 | Open in IMG/M |
| 3300012211|Ga0137377_11435340 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012212|Ga0150985_120586699 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012361|Ga0137360_10946418 | Not Available | 743 | Open in IMG/M |
| 3300012362|Ga0137361_11888229 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012377|Ga0134029_1061910 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012382|Ga0134038_1117182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 678 | Open in IMG/M |
| 3300012395|Ga0134044_1186555 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012683|Ga0137398_10737539 | Not Available | 686 | Open in IMG/M |
| 3300012924|Ga0137413_11358086 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012927|Ga0137416_11010029 | Not Available | 743 | Open in IMG/M |
| 3300012944|Ga0137410_10782425 | Not Available | 800 | Open in IMG/M |
| 3300012961|Ga0164302_10269219 | Not Available | 1094 | Open in IMG/M |
| 3300012961|Ga0164302_11373688 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012972|Ga0134077_10302985 | Not Available | 671 | Open in IMG/M |
| 3300012976|Ga0134076_10260175 | Not Available | 742 | Open in IMG/M |
| 3300012989|Ga0164305_12161317 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300013102|Ga0157371_10892067 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300013296|Ga0157374_10844208 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300013308|Ga0157375_10785569 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300013308|Ga0157375_13221565 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300014259|Ga0075311_1112811 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300014487|Ga0182000_10363237 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300014829|Ga0120104_1047061 | Not Available | 808 | Open in IMG/M |
| 3300014968|Ga0157379_10875675 | Not Available | 851 | Open in IMG/M |
| 3300015200|Ga0173480_10711936 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300015359|Ga0134085_10629525 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300015372|Ga0132256_102419938 | Not Available | 627 | Open in IMG/M |
| 3300015373|Ga0132257_102768542 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300015374|Ga0132255_104748187 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300015374|Ga0132255_104909555 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017924|Ga0187820_1156176 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300017939|Ga0187775_10332093 | Not Available | 609 | Open in IMG/M |
| 3300017943|Ga0187819_10434911 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300017961|Ga0187778_10688850 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300018032|Ga0187788_10266374 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300018058|Ga0187766_10356212 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300018076|Ga0184609_10545396 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300018433|Ga0066667_11557032 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300019192|Ga0184603_133090 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300019233|Ga0184645_1097641 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300019255|Ga0184643_1104152 | Not Available | 738 | Open in IMG/M |
| 3300019255|Ga0184643_1157983 | Not Available | 699 | Open in IMG/M |
| 3300019255|Ga0184643_1477443 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300019881|Ga0193707_1172343 | Not Available | 582 | Open in IMG/M |
| 3300020002|Ga0193730_1137120 | Not Available | 659 | Open in IMG/M |
| 3300020065|Ga0180113_1175689 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300020070|Ga0206356_10365709 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020076|Ga0206355_1598525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300020077|Ga0206351_10734018 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300020581|Ga0210399_11035416 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021070|Ga0194056_10168597 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021071|Ga0194058_10092074 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300021079|Ga0194055_10188718 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300021168|Ga0210406_11232493 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021180|Ga0210396_11493248 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021404|Ga0210389_11184066 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021420|Ga0210394_10969782 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300022504|Ga0242642_1046545 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300022507|Ga0222729_1026755 | Not Available | 712 | Open in IMG/M |
| 3300022508|Ga0222728_1067652 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300022508|Ga0222728_1096430 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300022510|Ga0242652_1052743 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300022511|Ga0242651_1017161 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300022513|Ga0242667_1021482 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300022513|Ga0242667_1057707 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300022525|Ga0242656_1046995 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300022529|Ga0242668_1084997 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300022530|Ga0242658_1111319 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300022530|Ga0242658_1219581 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300022532|Ga0242655_10137530 | Not Available | 705 | Open in IMG/M |
| 3300022532|Ga0242655_10145056 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300022532|Ga0242655_10315391 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300022709|Ga0222756_1036027 | Not Available | 698 | Open in IMG/M |
| 3300022711|Ga0242674_1023454 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300022717|Ga0242661_1059941 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300022718|Ga0242675_1020552 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300022718|Ga0242675_1067825 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300022720|Ga0242672_1125393 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300022721|Ga0242666_1096789 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300023547|Ga0247554_103642 | Not Available | 609 | Open in IMG/M |
| 3300023551|Ga0247546_106325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300023552|Ga0247551_105242 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300024288|Ga0179589_10127543 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300025544|Ga0208078_1069842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
| 3300025924|Ga0207694_11744198 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025929|Ga0207664_10498231 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300025929|Ga0207664_11183994 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025929|Ga0207664_11730019 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026021|Ga0208140_1031236 | Not Available | 724 | Open in IMG/M |
| 3300026326|Ga0209801_1320357 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027560|Ga0207981_1086065 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027681|Ga0208991_1156354 | Not Available | 672 | Open in IMG/M |
| 3300027857|Ga0209166_10370703 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300027862|Ga0209701_10621753 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027879|Ga0209169_10643717 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027884|Ga0209275_10564729 | Not Available | 652 | Open in IMG/M |
| 3300027894|Ga0209068_10795985 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027895|Ga0209624_10762578 | Not Available | 636 | Open in IMG/M |
| 3300027905|Ga0209415_10968278 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027908|Ga0209006_11185437 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027915|Ga0209069_10386653 | Not Available | 763 | Open in IMG/M |
| 3300028807|Ga0307305_10404165 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300028906|Ga0308309_11238862 | Not Available | 643 | Open in IMG/M |
| 3300029701|Ga0222748_1045916 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300029701|Ga0222748_1135551 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030529|Ga0210284_1926186 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300030583|Ga0210262_1215106 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300030603|Ga0210253_11178169 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300030605|Ga0210265_1085365 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030626|Ga0210291_11488727 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300030743|Ga0265461_11749219 | Not Available | 692 | Open in IMG/M |
| 3300030763|Ga0265763_1057882 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300030805|Ga0265756_106060 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300030811|Ga0265735_106614 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300030836|Ga0265767_107230 | Not Available | 703 | Open in IMG/M |
| 3300030863|Ga0265766_1010226 | Not Available | 667 | Open in IMG/M |
| 3300030880|Ga0265776_111810 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030888|Ga0265769_106743 | Not Available | 728 | Open in IMG/M |
| 3300030888|Ga0265769_108079 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030903|Ga0308206_1085258 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300030939|Ga0138303_1117810 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030963|Ga0265768_104641 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300030969|Ga0075394_12063778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 654 | Open in IMG/M |
| 3300030979|Ga0068589_11617960 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031011|Ga0265774_102152 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031093|Ga0308197_10243551 | Not Available | 635 | Open in IMG/M |
| 3300031094|Ga0308199_1181660 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031097|Ga0308188_1015359 | Not Available | 698 | Open in IMG/M |
| 3300031421|Ga0308194_10293994 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031469|Ga0170819_10551863 | Not Available | 593 | Open in IMG/M |
| 3300031474|Ga0170818_102540852 | Not Available | 610 | Open in IMG/M |
| 3300031680|Ga0318574_10807529 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031771|Ga0318546_11032194 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031829|Ga0316050_103605 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031832|Ga0318499_10295835 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031859|Ga0318527_10291218 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031897|Ga0318520_10767111 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031945|Ga0310913_11101398 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032001|Ga0306922_11203049 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300032035|Ga0310911_10553067 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300032044|Ga0318558_10554183 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032076|Ga0306924_11857518 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032174|Ga0307470_11536938 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032515|Ga0348332_10746842 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032515|Ga0348332_11262192 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300032515|Ga0348332_11951149 | Not Available | 729 | Open in IMG/M |
| 3300032783|Ga0335079_11558380 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032896|Ga0335075_10955983 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032954|Ga0335083_11523943 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300033134|Ga0335073_11896748 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300034644|Ga0370548_063087 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300034681|Ga0370546_048925 | Not Available | 649 | Open in IMG/M |
| 3300034817|Ga0373948_0117600 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.88% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.44% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.44% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010073 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010079 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300012074 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ085 MetaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021071 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-17m | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030583 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030605 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030811 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031829 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_02304470 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MTGLLHEKEFSRRSFLKGGGALIVGFSVFGAGVAAKTAEGADS |
| INPhiseqgaiiFebDRAFT_1050336732 | 3300000364 | Soil | MIGLVHEKEFSRKALFKGGGALVVGVSVLGAGFGGRAQAALSPY |
| AF_2010_repII_A1DRAFT_101803121 | 3300000597 | Forest Soil | MTGLLHEKEFSRRSFLRSGGALIVGFSVLGAGLAGKAA |
| JGI1027J12803_1073858142 | 3300000955 | Soil | MTGLLHEKECSRKAFVKGGGAMIVAFSLAGARLAGRAQAAD |
| A21PFW6_11003522 | 3300001333 | Permafrost | MTGLLHEKEFSRKSFVKGGGALIAGFSVLGAGVAGK |
| Ga0058862_100248191 | 3300004803 | Host-Associated | MTGFLHEKELSRRSFLKGGGALIVGFSVFGAGIGGKAAAAESPFAS |
| Ga0058862_127748351 | 3300004803 | Host-Associated | MTGFMHEFGRKTFVKKGGALIVGFSALGAAAGKAEAASGNTP |
| Ga0066679_105267031 | 3300005176 | Soil | MSELSRKAFLKGGGALIVGFSVAGVAGKARAADSPFASNA |
| Ga0066679_109544472 | 3300005176 | Soil | MTGFLHEKEFSRKNFLKGSGAVVVGASVVGGGLAGKASAAARPTLA |
| Ga0070658_106045072 | 3300005327 | Corn Rhizosphere | MTGLLHEKEFSRKTLIKGGALVVGFSALGAGLTGKAQAAFDPFGSP* |
| Ga0066388_1063229661 | 3300005332 | Tropical Forest Soil | MTGFLHEKEFSRASFLKGGGAMLVGFSVLGAGVGAKAAKAA |
| Ga0068868_1017935222 | 3300005338 | Miscanthus Rhizosphere | MTGLIPEKELSRRTFLKGSGALVVGFSFAGSLLAGKASAAVG |
| Ga0008090_157741631 | 3300005363 | Tropical Rainforest Soil | MTGLLHERDFSRRSFLKGGGALVVGFSVLGSSLAGKASAAAPTSAGYLPD |
| Ga0070709_112335192 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGLIPEKDFSRKSFLKGGGALIVGISLAGSVGSAKAATGVDPFA |
| Ga0070663_1013339991 | 3300005455 | Corn Rhizosphere | MTGFLHEKEFSRKSFLKGGGVMIVALSAGAGLAGKAQAAD |
| Ga0070697_1003088003 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGFLHEQEFSRKSFLKGGGALIVGFSLAGAGLAGKAAAATAQPQPTGYLPDP |
| Ga0070731_110302042 | 3300005538 | Surface Soil | MTGLLHENEFSRKSFVKAGGALVIGFSALGALGAGKAKGATGNTPFSQRG |
| Ga0066698_102139503 | 3300005558 | Soil | MTGLLHEKEFSRKNFLKGGGAMLVGFSVLGAGIGAKAAK |
| Ga0068855_1001655025 | 3300005563 | Corn Rhizosphere | MTGFMHEKEFSRKTFLKGGGALIVGVSALGAVAGKAQGATGNTP |
| Ga0066691_105437222 | 3300005586 | Soil | MTGLLQEKEFSRRAFVKGGGALLVGFSVLGAALAGKAQAGDVVSVAGDSP |
| Ga0068856_1025868952 | 3300005614 | Corn Rhizosphere | MTGFMHEKEFSRKNFLKGSGAVVVGASVVGAGLAGKASAAARPALAGYNAD |
| Ga0068856_1026638511 | 3300005614 | Corn Rhizosphere | MTELLQENAFSRKAFLKGGGALVVGFSMIGAGAGRKASAAG |
| Ga0068852_1017248761 | 3300005616 | Corn Rhizosphere | MTGLMHEKEFSRKTFVKGGGALVIGFSLAGSALAGKASAAAPTSAGYL |
| Ga0066903_1080217132 | 3300005764 | Tropical Forest Soil | MTGPIPEREFSRLSFLKGGGALVVGFSLAGSFIGKASAAGLPDFA |
| Ga0075289_10541241 | 3300005888 | Rice Paddy Soil | MTGFLHEKEFSRKAFVKGGGALIVGFSIAGATVGAKAAKAADSPY |
| Ga0075272_10686932 | 3300005900 | Rice Paddy Soil | MTGFLHEKEFSRKSFIKGSGAVVAGLSVAGIAGTASAAAPTSAGYLPDP |
| Ga0070717_119364112 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGFMHEKEFSRKSFLKGSGAVVVGGSVIGAGLAGKASAAARPALAGY |
| Ga0075024_1004971761 | 3300006047 | Watersheds | MTGFLHEKEFSRKTFLKGGGALIIGFSVAGIAGKAQAADSPFASNA |
| Ga0075029_1003048111 | 3300006052 | Watersheds | MTGLLHEKEFSRKTFVKGGGALVVGFSLAGAGLAGQASAAPSPAGYLPDLSQ |
| Ga0075030_1003644393 | 3300006162 | Watersheds | MTGLLHEKEFSRTTFIKGGGALVVGFSALGVMGAGTADAATGNTPFA |
| Ga0070712_1018506102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGLLHEKEFSRKSFVKGGALVFGSVAIGASLAGKA |
| Ga0066653_101862283 | 3300006791 | Soil | MTGFLHERELSRKSFLKGGGALVVGFSVAGAALAGRAAGAA |
| Ga0066659_111841461 | 3300006797 | Soil | MTGLLHEKEFSRKQFIKGGGALIVGFSVVGSALAGKA |
| Ga0075425_1020863382 | 3300006854 | Populus Rhizosphere | MTGLIPERELSRKSFLKGGGALIVGFGLAGVGAAGRASAAAP |
| Ga0079219_108889211 | 3300006954 | Agricultural Soil | MTGLIPEREFSRKSFLKGGGALIVGFGLAGVGAAGRAAAAAPG |
| Ga0099828_112399201 | 3300009089 | Vadose Zone Soil | MTGFLHEREFSRKTFIKGGGALIVGLSFAGATGKA |
| Ga0099827_113634382 | 3300009090 | Vadose Zone Soil | MTGLLNEKEFSRRSFIKGGGALIVGFSALGAGLAGRAQA |
| Ga0066709_1030627152 | 3300009137 | Grasslands Soil | MTGLLNERELTRKTFLRGGGALIVGFSLAGGLVGGKAA |
| Ga0099792_106497282 | 3300009143 | Vadose Zone Soil | MTGFLHEKEFSRKTFLKGGGALVVSYGTLAGAASAATG |
| Ga0099792_107408531 | 3300009143 | Vadose Zone Soil | MTGFLHEKEFSRKTFVKGGGALIVGFSTLASTAGKAQA |
| Ga0103856_100794602 | 3300009233 | River Water | TGFLHEKEFSRKSFLKGGGALVVGFSMVGAGVGARFGRNAR* |
| Ga0103857_100847641 | 3300009235 | River Water | VTGFLHEKEFSRKSFLKGGGALVVGFSMVGAGVGARV |
| Ga0116214_12066111 | 3300009520 | Peatlands Soil | MTGLLHEKEFSRKNFVKGGGALIVGFSAAGVIAGN |
| Ga0116221_12938381 | 3300009523 | Peatlands Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSTVGGLAGKASAAT |
| Ga0105238_114294631 | 3300009551 | Corn Rhizosphere | MTGFLHEKEVSRKTFLGGGGALVVGFSMLGAGNALA |
| Ga0105856_11357632 | 3300009662 | Permafrost Soil | MTGLMHEKEFSRKTFVRGGGALIVGFSALGALGSAK |
| Ga0126384_111506912 | 3300010046 | Tropical Forest Soil | MTGFLHEKEFSRRSIIKGGGALIVGFSLAGSALAGKASAIDGDIATGYNP |
| Ga0127429_1136051 | 3300010073 | Grasslands Soil | MTGFLHEREFSRKSFVKGGGALIVGLSIAGSAVAGKAQAAAPDPF |
| Ga0127439_1490942 | 3300010074 | Grasslands Soil | MTGFLHEREFSRKTFVKGGGALIVGFSLAGISVKAAEGAD |
| Ga0127434_1433202 | 3300010075 | Grasslands Soil | MTGLLHEQELSRKSFLKGGGAMLVGFSVLGAGFGAKA |
| Ga0127436_1791592 | 3300010079 | Grasslands Soil | MTGLLHEQELSRKSFLKGGGAMLVGFSVLGAGFGAKAAKSAGDDPY |
| Ga0127461_10032232 | 3300010084 | Grasslands Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSVLGSALAGKASAADSLNPYGSNPI |
| Ga0127475_10351062 | 3300010095 | Grasslands Soil | MTGLMHEKTVSRKNFLGGGGALIVGFSAAGSALAGKASAVAP |
| Ga0127460_10268261 | 3300010114 | Grasslands Soil | MTGFMHEKEFSRKNFLRGSGAVVVGASVAGAGLAGKAS |
| Ga0127449_11237952 | 3300010117 | Grasslands Soil | MTGLLHEKEFSRKSFIKGGGALIVGFSLAGSALAGKASAAPAPTGYNPDIN |
| Ga0127488_11317501 | 3300010122 | Grasslands Soil | MTGLLHEKEFSRKNFLKGGGAMLVGFSVLGAGLGAKAAKAAGDDPY |
| Ga0127498_10757771 | 3300010124 | Grasslands Soil | MTGLLHEKEFSRRSLIKGGGALVVGFSLAGSGLAGKASAVNPPLTGYNP |
| Ga0127447_11832051 | 3300010136 | Grasslands Soil | MTGFLHEKEFSRKTFVKGGGALIVGFSLAGFATRAAKAA |
| Ga0127464_11954721 | 3300010139 | Grasslands Soil | MTGFLHEREFSRKSFLKGTGAVVVGASTVGAGLAGT |
| Ga0126321_13109961 | 3300010145 | Soil | VTMTGLLHEKEFSRKTFLKGGGALIVGFSALAGSA |
| Ga0134064_102261691 | 3300010325 | Grasslands Soil | MTGLLHEKEFSRKNFLKGGGAMLVGFSVLGAGLGAK |
| Ga0126379_130675732 | 3300010366 | Tropical Forest Soil | MTGLLHEKEFSRTSFLKGGGALVVGFSLAGGAVAGKAVAASAPTMDGYN |
| Ga0134125_115301011 | 3300010371 | Terrestrial Soil | MTGLLHERELSRKTFLKGGGALIVGFSIAGAGLAGKASAASAPLTGY |
| Ga0126381_1040454792 | 3300010376 | Tropical Forest Soil | MTGFLHEKELSRKTFLKGGGAMLVGFSVLGAGIGAKAA |
| Ga0134126_111050563 | 3300010396 | Terrestrial Soil | MTGFMHEKEFSRKSFVKGGGALIVGFSTIGAVAGKAQAANG |
| Ga0126348_10158241 | 3300010862 | Boreal Forest Soil | MTGLLHEKEFSRKSFVKGAGALVVSFSFAGAGLAGKAQAAGDSP |
| Ga0126350_114878702 | 3300010880 | Boreal Forest Soil | MTGLIHENGASLHEKDFSRRSFLKGGGALIVGFSLAGAGLAGKAAAAPSPAGYNPDIN |
| Ga0138568_10474591 | 3300011080 | Peatlands Soil | MTGFLHEKEFSRKSFVKGGGALIISFSTLGATLGAKAAKASTGGEFDSN |
| Ga0120156_10559753 | 3300011996 | Permafrost | MTGLLHEKEFSRKSFVKGGGALIAGFSVLGAGVAGKAAADALPAFSS |
| Ga0154001_10489992 | 3300012074 | Attine Ant Fungus Gardens | MTGLLHEKEFSRKSFLKGSGALVVGFSLAGSALAGKA |
| Ga0137383_112848872 | 3300012199 | Vadose Zone Soil | MTGFMHEKAVSRKNFLGGGGALIVGFSMFGAGNALAA |
| Ga0137382_110123291 | 3300012200 | Vadose Zone Soil | MTGFLHEKEFSRQSFVKGGGALIVGFSLAGLVSKAAKAA |
| Ga0137399_108411852 | 3300012203 | Vadose Zone Soil | MTGFMHEKEFSRKNFIKGSSAVVAGLSVAGVAGKAAAATGNTPF |
| Ga0137377_114353401 | 3300012211 | Vadose Zone Soil | MAQVMTGLMHEREFSRKTFLKGGGALIVGFSLAGVGLPGKATPAN |
| Ga0150985_1205866992 | 3300012212 | Avena Fatua Rhizosphere | MTGFLHEKEFSRKNFLKGGGALVVGFSLGGSLLAG |
| Ga0137360_109464181 | 3300012361 | Vadose Zone Soil | MTGLLHEKEFSRKSFLKGGGALVVSFSMFGIAGVAGSAKAATGTFPPI |
| Ga0137361_118882291 | 3300012362 | Vadose Zone Soil | MTGLLHEKEFSRKQFIKGGGALIVGFSVVGSALAGK |
| Ga0134029_10619101 | 3300012377 | Grasslands Soil | MTGFLHEREFSRKSFIKGGGALIVGLSIAGTAGKAQAATGL |
| Ga0134038_11171821 | 3300012382 | Grasslands Soil | MTGFMHEKHISRKTFVKGGGALIVGFSLAGTAGKAQAAN |
| Ga0134044_11865551 | 3300012395 | Grasslands Soil | MTGFLHEKEFSRKTFVKGGGALIVGWSLGGAGVAAKAAKAADSP |
| Ga0137398_107375391 | 3300012683 | Vadose Zone Soil | MMTGLMHEKEFSRKSFAKGGGALIVGFSIVGSALA |
| Ga0137413_113580862 | 3300012924 | Vadose Zone Soil | MHEKEFSRKSFVKGGGALIVGFSMFGALSGKAQAANGLTPFAS |
| Ga0137416_110100291 | 3300012927 | Vadose Zone Soil | VTMTGFLHEKEFSRKSFVKGGGALVIGFSTLASTA |
| Ga0137410_107824252 | 3300012944 | Vadose Zone Soil | MTGFMHEKEFSRKNFLKGGGSLVVGFSALGAVAGKAQAAT |
| Ga0164302_102692191 | 3300012961 | Soil | MTGLLHEKEFSRKSFIKGGGALVVGVSAVGAGLAGKASAASPAGYLPDL |
| Ga0164302_113736882 | 3300012961 | Soil | MMTGFLHEKQFSRKSFVKGGGVLFVGLSIAGTAGKAQAASGFDPFAS |
| Ga0134077_103029851 | 3300012972 | Grasslands Soil | MTGLLYEKEFSRKNFLKGGGAMVVGFSLAGAGLAGKAQAAESPFA |
| Ga0134076_102601752 | 3300012976 | Grasslands Soil | MTGFLHERELSRKSFLKGGGALVVGFSVAGAALAGRAAGA |
| Ga0164305_121613171 | 3300012989 | Soil | MTGFLHEREFSRKSFVKGGGALIVGLSAAGLAAGVTKAADSPFASNG |
| Ga0157371_108920671 | 3300013102 | Corn Rhizosphere | MTGFMHEREFSRKSFVKGGGAMVVGFSVAAAAGRAQAA |
| Ga0157374_108442081 | 3300013296 | Miscanthus Rhizosphere | MTGFLHEKQFSRKTFVKGGGALVVGFSAFGSALAGKASAASPTAAG |
| Ga0157375_107855693 | 3300013308 | Miscanthus Rhizosphere | MTGLLHEKEFSRRSLIKGGGALVVGFSLAGSALAGKASAIDGLVPTGY |
| Ga0157375_132215652 | 3300013308 | Miscanthus Rhizosphere | MTGFMHEKEFSRKSFIKGSGAMIVGFSMLGAGAAAKAN |
| Ga0075311_11128111 | 3300014259 | Natural And Restored Wetlands | MTGILSKEFSRTTFLKGGGAMVVGFSLAGAGLAGKAGAATAPPSP |
| Ga0182000_103632371 | 3300014487 | Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSIGGAGLAGKAQAAESPYASN |
| Ga0120104_10470611 | 3300014829 | Permafrost | MTGFMHEKEFSRKTFVKGGGSLVIGFSALGAVAGK |
| Ga0157379_108756752 | 3300014968 | Switchgrass Rhizosphere | MTGFLHEREFSRKSFLKGGGAMIVGFSALGAASGAKASKAA |
| Ga0173480_107119362 | 3300015200 | Soil | MTGFLHEKELSRKSFLKGGGALVVGFSALGTAGNALAATGNT |
| Ga0134085_106295252 | 3300015359 | Grasslands Soil | MTGFLHEKEFSRKNFLKGTGAVVAGASVVGAGLAGKASAVAR |
| Ga0132256_1024199381 | 3300015372 | Arabidopsis Rhizosphere | MTGFMHEKEFSRKSFLKGTGAVVAGASVIGAGVAGKASAASRPALAGYNADP |
| Ga0132257_1027685422 | 3300015373 | Arabidopsis Rhizosphere | MTGFLHEKEFSRKSFLKGTGAVVVGTSVVGAGLAGKASAA |
| Ga0132255_1047481871 | 3300015374 | Arabidopsis Rhizosphere | MTGFLHEREFSRKSFIKGGGALIVGVSLAGTAGKA |
| Ga0132255_1049095552 | 3300015374 | Arabidopsis Rhizosphere | MTGLIPEQEFSRRTLLKGGALIVGFSLAGGLAGKAVAAFQQPLGDY |
| Ga0187820_11561762 | 3300017924 | Freshwater Sediment | MTGLLHEKEFSRKSFVKGGGALIVGFSLAGSALAG |
| Ga0187775_103320932 | 3300017939 | Tropical Peatland | MTGLMHERELSRKTLLKGGGALIVGFSALGVAQTAS |
| Ga0187819_104349112 | 3300017943 | Freshwater Sediment | MTGFLHEKEFSRKSFVKGGGALIIGFSALGAAGAGKAVAATGNTPFASR |
| Ga0187778_106888502 | 3300017961 | Tropical Peatland | MMTGLLHEKEFSRKSFVKGGGALVVGFSLFGSALAGKAAAAPSPAGYNPDINQV |
| Ga0187788_102663741 | 3300018032 | Tropical Peatland | MTGFMHEKEFSRKTFVKGTGAVVAGLSAASALAGNAVA |
| Ga0187766_103562122 | 3300018058 | Tropical Peatland | MTGFMHEKEFSRKSFIKGGGALIAGISLAGTAGKA |
| Ga0184609_105453961 | 3300018076 | Groundwater Sediment | MTGFLHEKEFSRKSFLKGGGAMVVGVSLAGTALAGKAQAAESPFASNGSPDL |
| Ga0066667_115570321 | 3300018433 | Grasslands Soil | MTGLLHEKEFSRKQFIKGGGALIVGFSVVGSALAGKASAAGVDPFASNGL |
| Ga0184603_1330902 | 3300019192 | Soil | MTGLLHEKEFSRKTFVRGGGSLIVGFSLLGTGFAGAASAAP |
| Ga0184645_10976411 | 3300019233 | Groundwater Sediment | MTGFMHEREFSRKSFLKGGGALVVGFSVGGSLLAPGKAAAGSVRLSPVDPYATVIRDFSQ |
| Ga0184643_11041523 | 3300019255 | Groundwater Sediment | MTGLLHEKEFSRKSFLKGGGAMIVGFSILGSGLASTASAATPTSAGYLPD |
| Ga0184643_11579831 | 3300019255 | Groundwater Sediment | MTGLMHEREFSRQAFLKGGGAMLVGFSVVGAAGFGAKAAKAA |
| Ga0184643_14774431 | 3300019255 | Groundwater Sediment | MTGFLHDKEFSRKSFLKGGGALVVGFSVAGLAPGKTA |
| Ga0193707_11723431 | 3300019881 | Soil | MTGFMHEKEFSRKSFLKGGGALIVGFSMAGSGLAGK |
| Ga0193730_11371202 | 3300020002 | Soil | MTGFMHEKEFSRKSFLKGGGALIVGISVAGSAGKASAVTGF |
| Ga0180113_11756891 | 3300020065 | Groundwater Sediment | MTALTHEKEFSRKSFVKGGGALIVGFSLAGTGLGGKAHAADNPYYGSNP |
| Ga0206356_103657091 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGFMHEREFSRKSFLKGGGAMVVGFSVAAAAGRAQAAGIDPFASPGP |
| Ga0206355_15985251 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MHEKDFSRKSFLKGGGALVVGFSLAGAATAGKASALTPSSP |
| Ga0206351_107340182 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGLLHEKEFSRRSLIKGGGALVVGFSLAGSALAGKASAIDGLVPTGYNP |
| Ga0210399_110354162 | 3300020581 | Soil | MTGLMHEKEFSRKSFLKGGGALIVGFSTVGALGAGKAAAATGNTPFAA |
| Ga0194056_101685971 | 3300021070 | Anoxic Zone Freshwater | MTGFMHEKEFSRKSFLKGGGALVVGFSAVGAGTAGKAAAAIDPYASS |
| Ga0194058_100920743 | 3300021071 | Anoxic Zone Freshwater | MTGFMHEKEFSRKSFLKGGGALVVGFSAVGAGTAGKAAAAASPAGYL |
| Ga0194055_101887181 | 3300021079 | Anoxic Zone Freshwater | MTGFMHEKEFSRKSFLKGGGALVVGFSAVGAGTAGK |
| Ga0210406_112324931 | 3300021168 | Soil | MTGFMHEKEFSRKSFVKGGGALIVGFSALGAVAGNAQAAN |
| Ga0210396_114932481 | 3300021180 | Soil | MTGLLHEREFSRKSFVKGGGALVVGFSTLGALAGKA |
| Ga0210389_111840662 | 3300021404 | Soil | MTGLLHEKELSRLSFVKGGGALVVGFSIAGAATAGSATADTATAAGYLPDVTQVDS |
| Ga0210394_109697823 | 3300021420 | Soil | MTGLMHEKEFSRKSFLKGGGALVVGFSVAGGVFAGKASAVF |
| Ga0242642_10465451 | 3300022504 | Soil | MTGLMHEKEFSRKSFVKGGGALIVGFSLAGSAFAGKAAAAASPAGYLPDLNQVDS |
| Ga0222729_10267551 | 3300022507 | Soil | MTGLLHEREFSRKTFLKDGGAIIVGFSMAGAGMSAKAEAAGVPL |
| Ga0222728_10676521 | 3300022508 | Soil | MTGLMHEKEFSRKTFLKGGGALVVGFSTVGALGAGKAAAAT |
| Ga0222728_10964301 | 3300022508 | Soil | MTGFMHEKEFSRKKFLKGSGAVVGGLSVAGAGLAGKKFRS |
| Ga0242652_10527431 | 3300022510 | Soil | MTGFMHEKEFSRKSFIKGGGSLVVGFSALGAVAGKAQAATGNT |
| Ga0242651_10171612 | 3300022511 | Soil | MMTGLLHEKEFSRKSFVKGGGALVIGFSLAGSALAGKAGAAAPTSAG |
| Ga0242667_10214822 | 3300022513 | Soil | MTGFMHEKEFSRKSFVKGSGALIVAFSTVGVGAKM |
| Ga0242667_10577071 | 3300022513 | Soil | MTGLMHEKDFSRRSFLKGGGALVIGFSLAGAGLAGKAAAAPSAAGYNP |
| Ga0242656_10469951 | 3300022525 | Soil | MTGFMHEKEFSRKSFVKGGGALVIGFSILGAGTAGKAAGATGNTPFA |
| Ga0242668_10849971 | 3300022529 | Soil | MTGFMHEKEFSRKSFVKGGGLIIGFSALGALGAGK |
| Ga0242658_11113191 | 3300022530 | Soil | MTGLMHEKEFSRKSFVKGGGALVIGFSLFGAATAGKASAA |
| Ga0242658_12195811 | 3300022530 | Soil | MTGFMHEKEFSRKSFVKGGGALVIGFSILGAGTAGKAAAATGNTPFA |
| Ga0242655_101375301 | 3300022532 | Soil | MTGLLHEKSFSRKSFVKGGGALVIGFSAAGALVGNAKA |
| Ga0242655_101450561 | 3300022532 | Soil | MTGLMHEKDFSRKTFVKGGGALVIGIGALGALAGKAQADQITLP |
| Ga0242655_103153911 | 3300022532 | Soil | VTGLMHEKEFSRKTFLKGGGALIVGFSLGGSALAGTARADTP |
| Ga0222756_10360272 | 3300022709 | Soil | MTGLLHEKSFSRKSFVKGGGALVIGFSAAGALVGN |
| Ga0242674_10234542 | 3300022711 | Soil | MTGLLHEKEFSRKSFIKGGGALIVGFSLAGSLAGTASAAAPSPAGYLPDT |
| Ga0242661_10599412 | 3300022717 | Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSLAGSALAGKAAAAAPAP |
| Ga0242675_10205522 | 3300022718 | Soil | MTGLLHEKEFSRKSFLRGGGALIVGFSTLGSLAGKAAAVMAKAGA |
| Ga0242675_10678252 | 3300022718 | Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSIAGSALAGKASAAFPVAPATP |
| Ga0242672_11253931 | 3300022720 | Soil | MTGFMHEDKLKKDFSRKTFVKGGGALIVGFSALGALSGKAQAANGNTPFS |
| Ga0242666_10967891 | 3300022721 | Soil | MTGFMHEKEFSRKSFVKGTGALIVAFSTVGVGAKMARVATSTSGEF |
| Ga0247554_1036422 | 3300023547 | Soil | MTGLLHEKEFSRKTFVRGGGSLVVGFSLLGTGFAGAASAAESPAGYLPSTG |
| Ga0247546_1063252 | 3300023551 | Soil | MTGLLHEKEFSRKTLIRGGGSLVVGFSLLGTGFAGAASAAESPAGYNPST |
| Ga0247551_1052421 | 3300023552 | Soil | MTGLLHEKEFSRKTFVRGGGSLIVGFSLLGTGFAGAASAAPS |
| Ga0179589_101275431 | 3300024288 | Vadose Zone Soil | MTGFMHEKEFSRKAFVKGGGALIIGFSVAGIAGKAQAADSPFAS |
| Ga0208078_10698422 | 3300025544 | Arctic Peat Soil | MTGFMHEKEFSRKTFVKGGGALIVGFSTLASTAGKAR |
| Ga0207694_117441981 | 3300025924 | Corn Rhizosphere | MMTGLLHETELLEKQFSRKSFLKGGGALIVGFSVAGSALAGKASAIDGDIPTGYNP |
| Ga0207664_104982311 | 3300025929 | Agricultural Soil | MTGFLHEREFSRKSFVKSGGALIVGFSALAARASA |
| Ga0207664_111839941 | 3300025929 | Agricultural Soil | MTGFMHEREFSRRSFVKGGGALIVGFSALAATANATVDP |
| Ga0207664_117300191 | 3300025929 | Agricultural Soil | MTGFLHEKEFSRKSFVKGGGALVIGFSLGGAGLAGKASAAAAPASTGYLP |
| Ga0208140_10312362 | 3300026021 | Rice Paddy Soil | MTGFLHEKEFSRKSFIKGSGAVVAGLSVAGIAGTASAAAPTSAG |
| Ga0209801_13203572 | 3300026326 | Soil | MTGFLHEKEFSRKTFVKGGGALIVGFSLAGLAGRAQA |
| Ga0207981_10860651 | 3300027560 | Soil | MTGFMHEKEFSRKTFLKGGGAMVVGLSIAGTAAGKVRAAG |
| Ga0208991_11563542 | 3300027681 | Forest Soil | MTGFLHEKEFSRKSFLKGGGALVVGFSMLGSGLAGKASAATSTGYLPDA |
| Ga0209274_102458711 | 3300027853 | Soil | MTGLLHEKEFSRRSFVKAGGALIVGFSMAGAALSGKAEGAVDPFASPGP |
| Ga0209166_103707031 | 3300027857 | Surface Soil | MTGLLHEKEFSRKSFVKGGGALVIGFSLLGAGTAGKAAAATGNT |
| Ga0209701_106217531 | 3300027862 | Vadose Zone Soil | MTGFLHEKEFSRKSFVKGGGALIIGFSLVGTGASKAQAADSPF |
| Ga0209169_106437171 | 3300027879 | Soil | MTGLLHEKEFSRRSFVKGGALIISLGAAGGALAGK |
| Ga0209275_105647291 | 3300027884 | Soil | MTGLLHEKEFSRRSFVKAGGALIVGFSTAGSLLAGRASAAPSAAGYLPDITQVDSWISI |
| Ga0209068_107959852 | 3300027894 | Watersheds | MTGLLHEKEFSRTSFLKGGGALIVGFSIAGSAFAGKAG |
| Ga0209624_107625782 | 3300027895 | Forest Soil | MVLMSGLPYEREFSRKAFLRGGGVLIVGFSVAGSGLARKARAAG |
| Ga0209415_109682782 | 3300027905 | Peatlands Soil | MTGFLHEKEFSRKSFIKGGGTVVAGLSVAGAGLAGKASAATPTSAGYLP |
| Ga0209006_111854372 | 3300027908 | Forest Soil | MTGLLHEKEFSRKSFVKGGGALVVGFSTLGALAGKASAATRAAND |
| Ga0209069_103866531 | 3300027915 | Watersheds | MTGFLHEKEFSRKTFVKGGGALIVGLSTAGSALAANGDTSAARTYERVSRP |
| Ga0307305_104041651 | 3300028807 | Soil | MTGFLHEKEFSRKSFLKGGGALVVGFSLLGSGLAGKAAAATSP |
| Ga0308309_112388621 | 3300028906 | Soil | MTGLMHEKEFSRKSFVKGGGALVIGFSILGAGTAGKAAAATGNTPF |
| Ga0222748_10459161 | 3300029701 | Soil | MTGLLHEKEFSRKTLIRGGGSLVVGFSLLGSGFAGAASAAESPAGYNP |
| Ga0222748_11355512 | 3300029701 | Soil | MTGLLHEKDFSRKTFLKGGGALIVGFSLAGSALAGKAGAAETPAGYNP |
| Ga0210284_19261861 | 3300030529 | Soil | MTMTGLLHEREFSRKNFVKGGGALIVGFSMAGSALAGKAQAAFNPFASPG |
| Ga0210262_12151061 | 3300030583 | Soil | MTGLLHEKEFSRKSFVKGGGALIIGFSMAGSTLAGKAE |
| Ga0210253_111781692 | 3300030603 | Soil | MTGLLHEKEFSRRSFVKAGGALVVGFSTVGSLLAGRASAAPSAAGYLPDIT |
| Ga0210265_10853652 | 3300030605 | Soil | MTGLLHEKEFSRRSFVKAGGALVVGFSTVGSLLAGRASAAPSAAANQDLINKLK |
| Ga0210291_114887272 | 3300030626 | Soil | MTGFMHEKEFSRKSFVKGGGALVIGFSILGTTAGNRK |
| Ga0265461_117492192 | 3300030743 | Soil | MTGLMHEKEFSRKSFVKGGGALIVGFSLAGSALAGKAAAAASPAGYLPDLNQID |
| Ga0265763_10578821 | 3300030763 | Soil | MTGFMHEKEFSRKSFVKGGGALIIGFSLAGSAFAGKAGAAPSPAGFNP |
| Ga0265756_1060602 | 3300030805 | Soil | MTGFMHEKEFSRKSFVKGGGALIIGFSLAGSAFAGKAGA |
| Ga0265735_1066141 | 3300030811 | Soil | MTGFLHERDLSRKTFLKGGGALVVGFSVAGSVFAGKSAAAGG |
| Ga0265767_1072301 | 3300030836 | Soil | MTGLLHEKEFSRKTFVRGGGSLVVGFSLAGAVADA |
| Ga0265766_10102262 | 3300030863 | Soil | MTGLLHEKSFSRKSFIRGGGSLVVGFSLAGAVVGKAS |
| Ga0265776_1118102 | 3300030880 | Soil | MTGLMHEKEFSRKSFVKGGGALIIGFSALGATAGK |
| Ga0265769_1067432 | 3300030888 | Soil | MTGLLHEKEFSRKSFIRGGGALIVGFSTLGTLAGKAEASSYELED |
| Ga0265769_1080791 | 3300030888 | Soil | MTGLMHEKEFSRKNLLKGGGALIVGFSLAGTAIDSA |
| Ga0308206_10852581 | 3300030903 | Soil | MTEMLKKEFSRKAFVKGGGALIVGFSTLGAIAGRAEG |
| Ga0138303_11178101 | 3300030939 | Soil | MTGFMHEKEFSRKSFIKGGGSLVVGFSALGAVAGKAQAAT |
| Ga0265768_1046412 | 3300030963 | Soil | MTGLLHEKEFSRTAFIKGGGALIVGFSLLGTGFAGAASAAESPLGYLPSSTQLDS |
| Ga0075394_120637781 | 3300030969 | Soil | MTGFLHEKEFSRKNFVKGGGALVIGFSVLGAGTAGKAAAATGNTPF |
| Ga0068589_116179602 | 3300030979 | Soil | MTGLLHEKEFSRKSFVKGGGAVVVGFSLIGAGVAGKAAA |
| Ga0265774_1021521 | 3300031011 | Soil | MTGLLHENEFSRKAFVKGGGALIVGFSMLGAGSLAGRAQAAS |
| Ga0308197_102435511 | 3300031093 | Soil | MTGLLHEREFSRKSFIKGSGALIVGFSLAGAGLAGKASAAG |
| Ga0308199_11816602 | 3300031094 | Soil | MTGLLHEKEFSRKSFVKGGGALIVGFSVAGAGLAGQASAAAPTSAGYNPD |
| Ga0308188_10153592 | 3300031097 | Soil | MTGFMHEKEFSRKTFLKGGGALIVGFSMLGAGLAGKASAVD |
| Ga0308194_102939942 | 3300031421 | Soil | MTGFLHEREFSRKTFVKGGGALIVGLSIAGTAGKAVAAGIDPYASP |
| Ga0170819_105518631 | 3300031469 | Forest Soil | MMTGLMHEKEFSRKAFVKGGGALIVGVTAVSAFAGKASAANG |
| Ga0170818_1025408522 | 3300031474 | Forest Soil | MTGFMHEKELSRKKFLKGGGALIVGLSFAGVAGNARAGLIDGFAS |
| Ga0318574_108075291 | 3300031680 | Soil | MMTGFLSEKQFSRKTFVKGGGALIISFSALGAAGTAN |
| Ga0318509_103669602 | 3300031768 | Soil | MMTGLIPEKQFSRRSFVKGGGALVVGFSVFGSALAGKASAAAPTSAGYLPDINQIARGSQSAPTTP |
| Ga0318546_110321942 | 3300031771 | Soil | MTGLLHEKEFSRTSFVKGGGALIVGFSLAGAGLAGRASAAPSPAGFNPDLNQ |
| Ga0316050_1036052 | 3300031829 | Soil | MTGLLHEKSFSRKAFVKGGGALIVGFSALGALAGKAQADPAVTSV |
| Ga0318499_102958352 | 3300031832 | Soil | MTGLLHEKEFSRKAFVKGGGALVVTISAASALAGNASANQTRPPFVD |
| Ga0318527_102912182 | 3300031859 | Soil | MTGLLHEKELSRKSFVKGGGALVVTISAASALAGNASADQT |
| Ga0318520_107671112 | 3300031897 | Soil | MTGFLHERQFSRKTFVKGGGALIVTVAATSATGKAS |
| Ga0310913_111013982 | 3300031945 | Soil | MTGLIPERQFSRGSFVKGGGALVVGFSVFGSALAGKASAIGIPSP |
| Ga0306922_112030491 | 3300032001 | Soil | MTGLLHEKEFSRKAFVKGGGALVVTISAASALAGNASA |
| Ga0310911_105530671 | 3300032035 | Soil | MTGLLHEKEFSRRSLIKGGGALVIGFSLAGSALAGKASALD |
| Ga0318558_105541832 | 3300032044 | Soil | MTGLLHEKEFSRKAFVKGGGALVVTISAASALAGNASANQTK |
| Ga0306924_118575181 | 3300032076 | Soil | MTGLLHEKEFSRTSLIKGGGALIVGFSAVGAATAGKASAAAPTVAGYNPDLTKVDSFLVV |
| Ga0307470_115369382 | 3300032174 | Hardwood Forest Soil | MTGFLHERELSRKSFLKGGGALVVGFSVAGAALAGRASGAAD |
| Ga0348332_107468421 | 3300032515 | Plant Litter | MTGLMHEKEFSRKSFVKGGGALVIGFSVLGATAGKAAAATGNTPFAS |
| Ga0348332_112621921 | 3300032515 | Plant Litter | MTGLLHEKDFSRKSFVKGGALVVGFSTAGALAGRASAASAP |
| Ga0348332_119511491 | 3300032515 | Plant Litter | MTGLLSEKSFSRKSFVKGGGALVIGFSAFAANAKASNFGYSSSM |
| Ga0335079_115583801 | 3300032783 | Soil | MTGFLHEKEFSRKSFLKGGGALIVGFSIAGAGVAGKA |
| Ga0335075_109559832 | 3300032896 | Soil | MTGFLHEKEFSRKSFVQGGGALIVGFGLLGAAAAGRASADSDP |
| Ga0335083_115239432 | 3300032954 | Soil | MMTGFLHEKQFSRKSFVKGGGALIISFSALGAAGAASA |
| Ga0335073_118967482 | 3300033134 | Soil | MTGFMHEKDFSRKSFIKGGGALIIGFSALGAMGAGKAAAATG |
| Ga0370548_063087_561_686 | 3300034644 | Soil | MTGFMHEREFSRKSFVKGGGAMIVSLSLVGTAGKATAATTNP |
| Ga0370546_048925_525_647 | 3300034681 | Soil | MTGFMHEKEFSRKTFVKGGGALIVGFSTIAATASNAMAANA |
| Ga0373948_0117600_521_640 | 3300034817 | Rhizosphere Soil | MTGFMHEKDFSRKSFLKGGGALVVGFSMFGTGNALAATGN |
| ⦗Top⦘ |