


| Basic Information | |
|---|---|
| Family ID | F013841 |
| Family Type | Metagenome |
| Number of Sequences | 268 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKLLLATMFKKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKTH |
| Number of Associated Samples | 213 |
| Number of Associated Scaffolds | 268 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.94 % |
| % of genes near scaffold ends (potentially truncated) | 26.87 % |
| % of genes from short scaffolds (< 2000 bps) | 64.18 % |
| Associated GOLD sequencing projects | 196 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.418 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.955 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.851 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (23.881 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.38% β-sheet: 15.58% Coil/Unstructured: 61.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 268 Family Scaffolds |
|---|---|---|
| PF02900 | LigB | 21.64 |
| PF07746 | LigA | 3.36 |
| PF13561 | adh_short_C2 | 2.99 |
| PF00106 | adh_short | 2.24 |
| PF00730 | HhH-GPD | 1.87 |
| PF01476 | LysM | 1.49 |
| PF08309 | LVIVD | 1.12 |
| PF00507 | Oxidored_q4 | 0.75 |
| PF02955 | GSH-S_ATP | 0.75 |
| PF13271 | DUF4062 | 0.75 |
| PF00685 | Sulfotransfer_1 | 0.75 |
| PF03401 | TctC | 0.37 |
| PF00072 | Response_reg | 0.37 |
| PF01557 | FAA_hydrolase | 0.37 |
| PF00092 | VWA | 0.37 |
| PF06325 | PrmA | 0.37 |
| PF07044 | DUF1329 | 0.37 |
| PF02384 | N6_Mtase | 0.37 |
| PF04608 | PgpA | 0.37 |
| PF11871 | DUF3391 | 0.37 |
| PF05706 | CDKN3 | 0.37 |
| PF00383 | dCMP_cyt_deam_1 | 0.37 |
| PF02754 | CCG | 0.37 |
| PF09364 | XFP_N | 0.37 |
| PF00041 | fn3 | 0.37 |
| PF13090 | PP_kinase_C | 0.37 |
| PF00872 | Transposase_mut | 0.37 |
| PF06271 | RDD | 0.37 |
| PF08085 | Entericidin | 0.37 |
| PF07973 | tRNA_SAD | 0.37 |
| PF06745 | ATPase | 0.37 |
| PF08402 | TOBE_2 | 0.37 |
| PF04679 | DNA_ligase_A_C | 0.37 |
| PF00753 | Lactamase_B | 0.37 |
| PF00032 | Cytochrom_B_C | 0.37 |
| PF13544 | Obsolete Pfam Family | 0.37 |
| PF13537 | GATase_7 | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 268 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.87 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.87 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.87 |
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.12 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.75 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.37 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 0.37 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.37 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.37 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.37 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.37 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.37 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.37 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG5510 | Predicted small secreted protein | Function unknown [S] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.42 % |
| Unclassified | root | N/A | 33.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886006|SwRhRL3b_contig_1992689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1393 | Open in IMG/M |
| 2189573000|GPBTN7E01ALN92 | Not Available | 504 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0764819 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101686008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3168 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101773800 | All Organisms → cellular organisms → Bacteria | 3161 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104453586 | Not Available | 608 | Open in IMG/M |
| 3300000574|JGI1357J11328_10173600 | Not Available | 595 | Open in IMG/M |
| 3300000787|JGI11643J11755_11334006 | Not Available | 757 | Open in IMG/M |
| 3300000789|JGI1027J11758_12836816 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1006530 | Not Available | 1653 | Open in IMG/M |
| 3300001372|YBBDRAFT_1169577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300002120|C687J26616_10110757 | Not Available | 878 | Open in IMG/M |
| 3300002121|C687J26615_10097507 | Not Available | 736 | Open in IMG/M |
| 3300002124|C687J26631_10093771 | Not Available | 1022 | Open in IMG/M |
| 3300002503|C687J35164_10030239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1775 | Open in IMG/M |
| 3300002530|C687J35503_10057014 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300002912|JGI25386J43895_10139786 | Not Available | 601 | Open in IMG/M |
| 3300003319|soilL2_10213701 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300003324|soilH2_10034912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3624 | Open in IMG/M |
| 3300003890|Ga0063162_1120581 | Not Available | 684 | Open in IMG/M |
| 3300003991|Ga0055461_10034651 | Not Available | 1124 | Open in IMG/M |
| 3300003993|Ga0055468_10198658 | Not Available | 616 | Open in IMG/M |
| 3300003996|Ga0055467_10007063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2096 | Open in IMG/M |
| 3300003996|Ga0055467_10067599 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300003997|Ga0055466_10021500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1401 | Open in IMG/M |
| 3300003997|Ga0055466_10072018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 897 | Open in IMG/M |
| 3300003997|Ga0055466_10126342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300003998|Ga0055472_10239829 | Not Available | 569 | Open in IMG/M |
| 3300004027|Ga0055459_10032018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300004114|Ga0062593_101184604 | Not Available | 800 | Open in IMG/M |
| 3300004463|Ga0063356_100306578 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300004463|Ga0063356_100895217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300004463|Ga0063356_100981637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300004463|Ga0063356_102125481 | Not Available | 853 | Open in IMG/M |
| 3300004463|Ga0063356_103776600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300004778|Ga0062383_10576519 | Not Available | 569 | Open in IMG/M |
| 3300004808|Ga0062381_10041743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1271 | Open in IMG/M |
| 3300004808|Ga0062381_10170824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300005093|Ga0062594_101167708 | Not Available | 760 | Open in IMG/M |
| 3300005167|Ga0066672_10012906 | All Organisms → cellular organisms → Bacteria | 4112 | Open in IMG/M |
| 3300005172|Ga0066683_10001245 | All Organisms → cellular organisms → Bacteria | 9945 | Open in IMG/M |
| 3300005205|Ga0068999_10041759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300005289|Ga0065704_10860308 | Not Available | 506 | Open in IMG/M |
| 3300005290|Ga0065712_10115495 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300005294|Ga0065705_10741354 | Not Available | 634 | Open in IMG/M |
| 3300005335|Ga0070666_10077903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2262 | Open in IMG/M |
| 3300005339|Ga0070660_100305613 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300005347|Ga0070668_100232967 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300005445|Ga0070708_100276214 | Not Available | 1581 | Open in IMG/M |
| 3300005451|Ga0066681_10000438 | All Organisms → cellular organisms → Bacteria | 13601 | Open in IMG/M |
| 3300005458|Ga0070681_10075676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3326 | Open in IMG/M |
| 3300005529|Ga0070741_10001062 | All Organisms → cellular organisms → Bacteria | 88383 | Open in IMG/M |
| 3300005536|Ga0070697_101454001 | Not Available | 612 | Open in IMG/M |
| 3300005539|Ga0068853_100115942 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300005545|Ga0070695_100811211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300005546|Ga0070696_100032122 | All Organisms → cellular organisms → Bacteria | 3601 | Open in IMG/M |
| 3300005557|Ga0066704_10728318 | Not Available | 622 | Open in IMG/M |
| 3300005561|Ga0066699_10239159 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300005564|Ga0070664_101737925 | Not Available | 591 | Open in IMG/M |
| 3300005564|Ga0070664_102341556 | Not Available | 506 | Open in IMG/M |
| 3300005764|Ga0066903_106655639 | Not Available | 601 | Open in IMG/M |
| 3300005833|Ga0074472_11402791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae | 1037 | Open in IMG/M |
| 3300005836|Ga0074470_10200098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7800 | Open in IMG/M |
| 3300005836|Ga0074470_10420545 | All Organisms → cellular organisms → Bacteria | 5277 | Open in IMG/M |
| 3300005836|Ga0074470_11737944 | All Organisms → cellular organisms → Bacteria | 4427 | Open in IMG/M |
| 3300005843|Ga0068860_102770428 | Not Available | 508 | Open in IMG/M |
| 3300006049|Ga0075417_10222828 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006755|Ga0079222_10590315 | Not Available | 845 | Open in IMG/M |
| 3300006796|Ga0066665_11702266 | Not Available | 500 | Open in IMG/M |
| 3300006845|Ga0075421_100080094 | All Organisms → cellular organisms → Bacteria | 4121 | Open in IMG/M |
| 3300006845|Ga0075421_101855406 | Not Available | 647 | Open in IMG/M |
| 3300006852|Ga0075433_10015660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6228 | Open in IMG/M |
| 3300006854|Ga0075425_101539831 | Not Available | 750 | Open in IMG/M |
| 3300006865|Ga0073934_10001301 | All Organisms → cellular organisms → Bacteria | 61010 | Open in IMG/M |
| 3300006865|Ga0073934_10024217 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 6133 | Open in IMG/M |
| 3300006865|Ga0073934_10325113 | Not Available | 973 | Open in IMG/M |
| 3300006865|Ga0073934_10424656 | Not Available | 811 | Open in IMG/M |
| 3300006880|Ga0075429_100943936 | Not Available | 754 | Open in IMG/M |
| 3300006903|Ga0075426_10192416 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300006904|Ga0075424_100002461 | All Organisms → cellular organisms → Bacteria | 16955 | Open in IMG/M |
| 3300006954|Ga0079219_10825304 | Not Available | 734 | Open in IMG/M |
| 3300006969|Ga0075419_10074659 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300007004|Ga0079218_10223284 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300007004|Ga0079218_12498357 | Not Available | 610 | Open in IMG/M |
| 3300009012|Ga0066710_100003886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12957 | Open in IMG/M |
| 3300009053|Ga0105095_10685771 | Not Available | 572 | Open in IMG/M |
| 3300009078|Ga0105106_10252261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300009093|Ga0105240_12204821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300009094|Ga0111539_11057937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300009100|Ga0075418_11168689 | Not Available | 834 | Open in IMG/M |
| 3300009147|Ga0114129_10138209 | All Organisms → cellular organisms → Bacteria | 3342 | Open in IMG/M |
| 3300009157|Ga0105092_10021203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3418 | Open in IMG/M |
| 3300009157|Ga0105092_10072819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1863 | Open in IMG/M |
| 3300009444|Ga0114945_10160387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300009506|Ga0118657_10128623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3656 | Open in IMG/M |
| 3300009545|Ga0105237_10221023 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300009597|Ga0105259_1123295 | Not Available | 623 | Open in IMG/M |
| 3300009609|Ga0105347_1015406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2610 | Open in IMG/M |
| 3300009609|Ga0105347_1019558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2317 | Open in IMG/M |
| 3300009678|Ga0105252_10000539 | All Organisms → cellular organisms → Bacteria | 23444 | Open in IMG/M |
| 3300009678|Ga0105252_10074612 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300009789|Ga0126307_10327622 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300010046|Ga0126384_10008612 | All Organisms → cellular organisms → Bacteria | 6289 | Open in IMG/M |
| 3300010046|Ga0126384_10121285 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300010358|Ga0126370_10030091 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
| 3300010360|Ga0126372_10358160 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300010360|Ga0126372_11003772 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 846 | Open in IMG/M |
| 3300010376|Ga0126381_100137390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3190 | Open in IMG/M |
| 3300010391|Ga0136847_12223786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2362 | Open in IMG/M |
| 3300010400|Ga0134122_10164043 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300010400|Ga0134122_10994959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300010403|Ga0134123_10498883 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300011403|Ga0137313_1077697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300011414|Ga0137442_1052483 | Not Available | 825 | Open in IMG/M |
| 3300011419|Ga0137446_1181722 | Not Available | 509 | Open in IMG/M |
| 3300011435|Ga0137426_1002616 | All Organisms → cellular organisms → Bacteria | 4010 | Open in IMG/M |
| 3300012034|Ga0137453_1004003 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300012096|Ga0137389_10470720 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300012179|Ga0137334_1027507 | Not Available | 1142 | Open in IMG/M |
| 3300012204|Ga0137374_10006058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 14382 | Open in IMG/M |
| 3300012355|Ga0137369_10090782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2533 | Open in IMG/M |
| 3300012362|Ga0137361_11337524 | Not Available | 640 | Open in IMG/M |
| 3300012897|Ga0157285_10117297 | Not Available | 754 | Open in IMG/M |
| 3300012922|Ga0137394_10014222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6290 | Open in IMG/M |
| 3300012931|Ga0153915_13321028 | Not Available | 522 | Open in IMG/M |
| 3300012931|Ga0153915_13480595 | Not Available | 510 | Open in IMG/M |
| 3300012948|Ga0126375_11662295 | Not Available | 552 | Open in IMG/M |
| 3300012964|Ga0153916_11078186 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012971|Ga0126369_10034255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4207 | Open in IMG/M |
| 3300013297|Ga0157378_11304219 | Not Available | 767 | Open in IMG/M |
| 3300013308|Ga0157375_13218945 | Not Available | 544 | Open in IMG/M |
| 3300014255|Ga0075320_1041459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300014263|Ga0075324_1001937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2912 | Open in IMG/M |
| 3300014873|Ga0180066_1087719 | Not Available | 640 | Open in IMG/M |
| 3300014969|Ga0157376_12990586 | Not Available | 512 | Open in IMG/M |
| 3300015371|Ga0132258_13978229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300015373|Ga0132257_100002309 | All Organisms → cellular organisms → Bacteria | 17141 | Open in IMG/M |
| 3300015373|Ga0132257_100697818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1261 | Open in IMG/M |
| 3300017927|Ga0187824_10024047 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300017966|Ga0187776_10593213 | Not Available | 771 | Open in IMG/M |
| 3300018031|Ga0184634_10021385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2461 | Open in IMG/M |
| 3300018031|Ga0184634_10528613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300018032|Ga0187788_10012122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2675 | Open in IMG/M |
| 3300018052|Ga0184638_1008580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3412 | Open in IMG/M |
| 3300018053|Ga0184626_10038924 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300018054|Ga0184621_10026011 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300018056|Ga0184623_10105055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300018056|Ga0184623_10264792 | Not Available | 783 | Open in IMG/M |
| 3300018063|Ga0184637_10069628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2155 | Open in IMG/M |
| 3300018063|Ga0184637_10072395 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300018063|Ga0184637_10367534 | Not Available | 862 | Open in IMG/M |
| 3300018071|Ga0184618_10001190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6328 | Open in IMG/M |
| 3300018072|Ga0184635_10071577 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300018074|Ga0184640_10000844 | All Organisms → cellular organisms → Bacteria | 8731 | Open in IMG/M |
| 3300018075|Ga0184632_10014788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3280 | Open in IMG/M |
| 3300018076|Ga0184609_10004594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4770 | Open in IMG/M |
| 3300018076|Ga0184609_10108876 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300018079|Ga0184627_10000984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 11289 | Open in IMG/M |
| 3300018082|Ga0184639_10346115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300018083|Ga0184628_10004697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6508 | Open in IMG/M |
| 3300018084|Ga0184629_10021273 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
| 3300018084|Ga0184629_10292849 | Not Available | 856 | Open in IMG/M |
| 3300018084|Ga0184629_10419974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300018422|Ga0190265_10164596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2188 | Open in IMG/M |
| 3300018422|Ga0190265_10558950 | Not Available | 1261 | Open in IMG/M |
| 3300018422|Ga0190265_10976995 | Not Available | 969 | Open in IMG/M |
| 3300018422|Ga0190265_12113801 | Not Available | 667 | Open in IMG/M |
| 3300018431|Ga0066655_10983437 | Not Available | 582 | Open in IMG/M |
| 3300018468|Ga0066662_10030816 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
| 3300018482|Ga0066669_10002246 | All Organisms → cellular organisms → Bacteria | 7857 | Open in IMG/M |
| 3300019361|Ga0173482_10009698 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300019377|Ga0190264_10399077 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300019377|Ga0190264_11454369 | Not Available | 592 | Open in IMG/M |
| 3300019878|Ga0193715_1005483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2719 | Open in IMG/M |
| 3300019880|Ga0193712_1049555 | Not Available | 916 | Open in IMG/M |
| 3300020020|Ga0193738_1193766 | Not Available | 508 | Open in IMG/M |
| 3300020084|Ga0194110_10123772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2084 | Open in IMG/M |
| 3300020197|Ga0194128_10031887 | All Organisms → cellular organisms → Bacteria | 4412 | Open in IMG/M |
| 3300021080|Ga0210382_10035716 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300021081|Ga0210379_10055277 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300022563|Ga0212128_10013482 | All Organisms → cellular organisms → Bacteria | 5249 | Open in IMG/M |
| 3300025001|Ga0209618_1080078 | Not Available | 500 | Open in IMG/M |
| 3300025146|Ga0209322_10030253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2681 | Open in IMG/M |
| 3300025146|Ga0209322_10253861 | Not Available | 733 | Open in IMG/M |
| 3300025155|Ga0209320_10007862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5224 | Open in IMG/M |
| 3300025155|Ga0209320_10288498 | Not Available | 687 | Open in IMG/M |
| 3300025159|Ga0209619_10221406 | Not Available | 1047 | Open in IMG/M |
| 3300025159|Ga0209619_10483472 | Not Available | 618 | Open in IMG/M |
| 3300025160|Ga0209109_10175499 | Not Available | 1067 | Open in IMG/M |
| 3300025164|Ga0209521_10296661 | Not Available | 921 | Open in IMG/M |
| 3300025167|Ga0209642_10138835 | Not Available | 1407 | Open in IMG/M |
| 3300025174|Ga0209324_10530615 | Not Available | 707 | Open in IMG/M |
| 3300025289|Ga0209002_10121100 | Not Available | 1698 | Open in IMG/M |
| 3300025310|Ga0209172_10000664 | All Organisms → cellular organisms → Bacteria | 90272 | Open in IMG/M |
| 3300025310|Ga0209172_10361440 | Not Available | 702 | Open in IMG/M |
| 3300025313|Ga0209431_10189219 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300025315|Ga0207697_10004508 | All Organisms → cellular organisms → Bacteria | 6645 | Open in IMG/M |
| 3300025324|Ga0209640_10021676 | All Organisms → cellular organisms → Bacteria | 5608 | Open in IMG/M |
| 3300025537|Ga0210061_1004144 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300025537|Ga0210061_1084368 | Not Available | 556 | Open in IMG/M |
| 3300025912|Ga0207707_10022828 | All Organisms → cellular organisms → Bacteria | 5471 | Open in IMG/M |
| 3300025912|Ga0207707_10702040 | Not Available | 849 | Open in IMG/M |
| 3300025919|Ga0207657_10028090 | All Organisms → cellular organisms → Bacteria | 5140 | Open in IMG/M |
| 3300025921|Ga0207652_10512768 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300025923|Ga0207681_11490945 | Not Available | 567 | Open in IMG/M |
| 3300025932|Ga0207690_11581135 | Not Available | 548 | Open in IMG/M |
| 3300025933|Ga0207706_10127042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2242 | Open in IMG/M |
| 3300025973|Ga0210145_1017604 | Not Available | 792 | Open in IMG/M |
| 3300025988|Ga0208141_1004590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300026121|Ga0207683_10019978 | All Organisms → cellular organisms → Bacteria | 5722 | Open in IMG/M |
| 3300026306|Ga0209468_1004010 | All Organisms → cellular organisms → Bacteria | 5860 | Open in IMG/M |
| 3300026320|Ga0209131_1092379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1610 | Open in IMG/M |
| 3300026535|Ga0256867_10022596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2678 | Open in IMG/M |
| 3300027513|Ga0208685_1006218 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300027527|Ga0209684_1002784 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
| 3300027573|Ga0208454_1000459 | All Organisms → cellular organisms → Bacteria | 23515 | Open in IMG/M |
| 3300027637|Ga0209818_1008754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2009 | Open in IMG/M |
| 3300027654|Ga0209799_1002189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3866 | Open in IMG/M |
| 3300027695|Ga0209966_1016975 | Not Available | 1382 | Open in IMG/M |
| 3300027778|Ga0209464_10275470 | Not Available | 610 | Open in IMG/M |
| 3300027815|Ga0209726_10010338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 9463 | Open in IMG/M |
| 3300027815|Ga0209726_10019600 | All Organisms → cellular organisms → Bacteria | 5845 | Open in IMG/M |
| 3300027815|Ga0209726_10149699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300027840|Ga0209683_10019058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2834 | Open in IMG/M |
| 3300027843|Ga0209798_10075930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1729 | Open in IMG/M |
| 3300027873|Ga0209814_10017540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2878 | Open in IMG/M |
| 3300027907|Ga0207428_10626119 | Not Available | 774 | Open in IMG/M |
| 3300027917|Ga0209536_100038057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6441 | Open in IMG/M |
| 3300028814|Ga0307302_10238300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300028828|Ga0307312_10396627 | Not Available | 906 | Open in IMG/M |
| 3300030006|Ga0299907_10179280 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300030006|Ga0299907_10192553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1684 | Open in IMG/M |
| 3300030006|Ga0299907_10731824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300030606|Ga0299906_10636115 | Not Available | 806 | Open in IMG/M |
| 3300030619|Ga0268386_10678351 | Not Available | 676 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10059540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300031229|Ga0299913_10141600 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300031229|Ga0299913_10265664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1700 | Open in IMG/M |
| 3300031229|Ga0299913_10403394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1355 | Open in IMG/M |
| 3300031720|Ga0307469_10006546 | All Organisms → cellular organisms → Bacteria | 5312 | Open in IMG/M |
| 3300031731|Ga0307405_10014874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4198 | Open in IMG/M |
| 3300031820|Ga0307473_10088217 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300031912|Ga0306921_10063597 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
| 3300031949|Ga0214473_10035577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5848 | Open in IMG/M |
| 3300031965|Ga0326597_10001823 | All Organisms → cellular organisms → Bacteria | 33014 | Open in IMG/M |
| 3300031965|Ga0326597_10027481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 7266 | Open in IMG/M |
| 3300031965|Ga0326597_10087517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3814 | Open in IMG/M |
| 3300032144|Ga0315910_11526230 | Not Available | 521 | Open in IMG/M |
| 3300032157|Ga0315912_10862521 | Not Available | 720 | Open in IMG/M |
| 3300032180|Ga0307471_102974995 | Not Available | 601 | Open in IMG/M |
| 3300032770|Ga0335085_10071077 | All Organisms → cellular organisms → Bacteria | 4607 | Open in IMG/M |
| 3300032782|Ga0335082_10002614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 19443 | Open in IMG/M |
| 3300032782|Ga0335082_10059277 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300032782|Ga0335082_10302350 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300032829|Ga0335070_10302437 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300033004|Ga0335084_10142530 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300033417|Ga0214471_10235495 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300033419|Ga0316601_101628145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300033481|Ga0316600_11195113 | Not Available | 540 | Open in IMG/M |
| 3300033487|Ga0316630_10011934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4393 | Open in IMG/M |
| 3300033513|Ga0316628_100013027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7319 | Open in IMG/M |
| 3300033513|Ga0316628_102469517 | Not Available | 686 | Open in IMG/M |
| 3300033813|Ga0364928_0058477 | Not Available | 859 | Open in IMG/M |
| 3300034148|Ga0364927_0026118 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300034151|Ga0364935_0023667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1679 | Open in IMG/M |
| 3300034164|Ga0364940_0031242 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300034164|Ga0364940_0246105 | Not Available | 527 | Open in IMG/M |
| 3300034690|Ga0364923_0019258 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.21% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.22% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.99% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.24% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.24% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.24% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.49% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.49% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.49% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.37% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.37% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.37% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.37% |
| Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.37% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.37% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300002530 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL3b_0798.00000490 | 2162886006 | Switchgrass Rhizosphere | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKNH |
| N55_10218430 | 2189573000 | Grass Soil | MKLLLATMFRKLPVRTTKQRATICKRCGTRIYSLSYLKAH |
| ICChiseqgaiiDRAFT_07648193 | 3300000033 | Soil | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHNKNNH* |
| INPhiseqgaiiFebDRAFT_1016860084 | 3300000364 | Soil | MKVLIATMFKKIPVRTTQQRASICKRCGVRIYSLSYLKAHLEAHNKKSANA* |
| INPhiseqgaiiFebDRAFT_1017738004 | 3300000364 | Soil | MKLLLATMFKKLPVRTTKQRATICKRXGXRIYSLSYLKAHLEAHDRKTH* |
| INPhiseqgaiiFebDRAFT_1044535863 | 3300000364 | Soil | MKLLLATMFRKVPVRKTLQRATLCKRCGTRIYSLSFL |
| JGI1357J11328_101736002 | 3300000574 | Groundwater | MKLLIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDRKAH* |
| JGI11643J11755_113340061 | 3300000787 | Soil | MKLLLATMFRKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHGRKNH* |
| JGI1027J11758_128368161 | 3300000789 | Soil | MRMLIATMFKKVPVRTTQQRACICKRCGTRIYSLAFLKAHLEAHHKKGH* |
| AP72_2010_repI_A100DRAFT_10065302 | 3300000837 | Forest Soil | MKVLIATMFKKIPVRATQQRASICKRCGVRIYSLSFLKAHLEAHNKKSTHAYKA* |
| YBBDRAFT_11695771 | 3300001372 | Marine Estuarine | KEHPMKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNRKSH* |
| C687J26616_101107573 | 3300002120 | Soil | MKMIIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKA |
| C687J26615_100975072 | 3300002121 | Soil | MKMIIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKYH* |
| C687J26631_100937712 | 3300002124 | Soil | MKILIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDKKAR* |
| C687J35164_100302393 | 3300002503 | Soil | MKILIATMFKKVPVRRTQQRASVCKRCGARIYSLSFLKAHLEAHVKKGH* |
| C687J35503_100570141 | 3300002530 | Soil | MKILIATMFKKVPVRRTQQRASVCKRCGARIYSLSFLKAH |
| JGI25386J43895_101397862 | 3300002912 | Grasslands Soil | LGTANYLKEQLMKLMIATMFKKVPVRKTQQRACICKRCGARIYSLSYLKAHLEAHDRKTH |
| soilL2_102137012 | 3300003319 | Sugarcane Root And Bulk Soil | MKLLLATMFKKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKTH* |
| soilH2_100349127 | 3300003324 | Sugarcane Root And Bulk Soil | MKLLLATMFKKLPVRTTQQRATICKRCGTRIYSLSYLKAHLEAHDRKTH* |
| Ga0063162_11205811 | 3300003890 | Hot Spring Sediments | MKLLLATMFRKVPVRNTKQRATLCKRCGTRIYSLSFLKAHLEAHNKRSQ* |
| Ga0055461_100346512 | 3300003991 | Natural And Restored Wetlands | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNHKAH* |
| Ga0055468_101986582 | 3300003993 | Natural And Restored Wetlands | MRLLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKNHLEAHERSTH* |
| Ga0055467_100070634 | 3300003996 | Natural And Restored Wetlands | MKLLLATMFKKVPVRSTKQRATLCKRCGARIYSLSYLKAHLEAHNKNNH* |
| Ga0055467_100675992 | 3300003996 | Natural And Restored Wetlands | MRLLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHE |
| Ga0055466_100215004 | 3300003997 | Natural And Restored Wetlands | MKVLLATMFRKVPVRATKQRATLCKRCGTRIYSLSYLKAHLEAHNKKTQ* |
| Ga0055466_100720182 | 3300003997 | Natural And Restored Wetlands | MKLLLATMFKKVPVRATKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNQ* |
| Ga0055466_101263423 | 3300003997 | Natural And Restored Wetlands | MKLLLATLFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNH* |
| Ga0055472_102398291 | 3300003998 | Natural And Restored Wetlands | MKMLIATMFKKVPVRKTKQRACICKRCGARIYSLNFLKHHLEAHERATH* |
| Ga0055459_100320184 | 3300004027 | Natural And Restored Wetlands | PMKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNHKAH* |
| Ga0062593_1011846041 | 3300004114 | Soil | MKLLLATMFKKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRK |
| Ga0063356_1003065783 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLLLATMFKKVPVRTTRQRATLCKRCGARIYSLSYLKAHLEAHDRKNH* |
| Ga0063356_1008952172 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKNH* |
| Ga0063356_1009816372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLLLTTMFKRVPVRKTQQRATICKRCGTRIYSLGFLKAHLEAHNRKIH* |
| Ga0063356_1021254812 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLLLATMFKKIPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKNH* |
| Ga0063356_1037766001 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHSRNSH* |
| Ga0062383_105765192 | 3300004778 | Wetland Sediment | MKLLLATMFKKVPVRKTKQRATLCKQCGTRIYSLSFLKAHLESHQRKSH* |
| Ga0062381_100417431 | 3300004808 | Wetland Sediment | ATMFKKVPVRKTKQRATLCKQCGTRIYSLSFLKAHLESHQRKSH* |
| Ga0062381_101708243 | 3300004808 | Wetland Sediment | MKLLLATMFKKVPVRKTKQRATFCKQCGTRIYSLSFLKAHLESHQRKSH* |
| Ga0062594_1011677081 | 3300005093 | Soil | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLESHDRKTH* |
| Ga0066672_100129064 | 3300005167 | Soil | MKLMIATMFKKVPVRKTQQRACICKRCGARIYSLSYLKAHLEAHDRKTH* |
| Ga0066683_100012457 | 3300005172 | Soil | MKLMIATMFKKVPVRKTQQRACICKRCGVRIYSLSYLKAHLEAHDRKTH* |
| Ga0068999_100417593 | 3300005205 | Natural And Restored Wetlands | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHSRKSH* |
| Ga0065704_108603081 | 3300005289 | Switchgrass Rhizosphere | MKLLLATMFKKVPVRKTRQRATICKQCGTRIYSLSFLKAHLESHNRKSH* |
| Ga0065712_101154953 | 3300005290 | Miscanthus Rhizosphere | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKDH* |
| Ga0065705_107413542 | 3300005294 | Switchgrass Rhizosphere | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLESHD |
| Ga0070666_100779036 | 3300005335 | Switchgrass Rhizosphere | MRLLVSTMFRKLPVRTTQQRATICKRCGARIYSLSYLKAHLESHDRKGH* |
| Ga0070660_1003056131 | 3300005339 | Corn Rhizosphere | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLE |
| Ga0070668_1002329673 | 3300005347 | Switchgrass Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGMRIYSLSYLKAHLEAHDRKTH* |
| Ga0070708_1002762142 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLIATMFKKIPVRTTQQRASICKRCGVRIYSLSFLKAHLEAHNKKSANI* |
| Ga0066681_100004387 | 3300005451 | Soil | MKLMIATMFKKVPVRRTQQRACICKRCGARIYSLSYLKAHLEAHDRKTH* |
| Ga0070681_100756761 | 3300005458 | Corn Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLEAHD |
| Ga0070741_1000106270 | 3300005529 | Surface Soil | MKLLLATMFKKLPVRTTRQRATICKRCGTRIYSLSYLKAHLEAHERKAH* |
| Ga0070697_1014540011 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLIATMFKKIPVRKTQQRASICKRCGVRVYSLSFLKAHLEAHDRKPIRS* |
| Ga0068853_1001159422 | 3300005539 | Corn Rhizosphere | MRLLVSTMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKDH* |
| Ga0070695_1008112111 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRSTH* |
| Ga0070696_1000321223 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLEAHDRKTH* |
| Ga0066704_107283182 | 3300005557 | Soil | MKLLLATMFKKIPVRETQQRATICKRCGTRIYSLSFLKKHLEAHDKKPH* |
| Ga0066699_102391593 | 3300005561 | Soil | MRLLLATMFKKLPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDKKTH* |
| Ga0070664_1017379251 | 3300005564 | Corn Rhizosphere | MKMLISAMFKKVPVRKTQQRACICKRCGARIYSLSFLKAHLEAHSKKTH* |
| Ga0070664_1023415561 | 3300005564 | Corn Rhizosphere | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDR |
| Ga0066903_1066556391 | 3300005764 | Tropical Forest Soil | MKVLIATMFRKIPVRTTQQRASICKKCGVRIYSLSFLKAHL |
| Ga0074472_114027913 | 3300005833 | Sediment (Intertidal) | MKLLIATMFKKVPVRKTQKRASICKRCGTRIYSLSFLKAHLEAHERKTH* |
| Ga0074470_102000985 | 3300005836 | Sediment (Intertidal) | MKLLLATMFKKVPVRKTQQRVTICKQCGTRIYSMSFLKAHLESHNRKSH* |
| Ga0074470_104205457 | 3300005836 | Sediment (Intertidal) | MKLLFATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHARNAH* |
| Ga0074470_117379447 | 3300005836 | Sediment (Intertidal) | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNRKSH* |
| Ga0068860_1027704282 | 3300005843 | Switchgrass Rhizosphere | MKMLIATMFKKMPVRRTQQRACICKRCGTRIYSLAFLKAHLEAHDRKNH* |
| Ga0075417_102228284 | 3300006049 | Populus Rhizosphere | MKLLLATMFRKMPVRKTQQRATICKRCGARIYSLSFLKAHLEAHDKKTH* |
| Ga0079222_105903151 | 3300006755 | Agricultural Soil | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSY |
| Ga0066665_117022662 | 3300006796 | Soil | MKLLLATMFKKIPVRETQQRATICKRCGTRIYSLSFLKKHLEAHDKKAH* |
| Ga0075421_1000800941 | 3300006845 | Populus Rhizosphere | MKLLLATMFRKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKTH* |
| Ga0075421_1018554062 | 3300006845 | Populus Rhizosphere | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRGTH* |
| Ga0075433_100156604 | 3300006852 | Populus Rhizosphere | MKLLLATMFRKVPVRKTLQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH* |
| Ga0075425_1015398311 | 3300006854 | Populus Rhizosphere | MRMLIATMFKKIPVRKTQQRASICKRCGVRVYSLSFLKAHLEAHDRKPMRS* |
| Ga0073934_1000130122 | 3300006865 | Hot Spring Sediment | MKLLLATMFKKMPVRTSKQRATICKRCGTRIYSLSYLKVHLESHARNPH* |
| Ga0073934_100242172 | 3300006865 | Hot Spring Sediment | MKMLLATMFKKIPVRRTKQRATICKRCGARIYSLSCLKAHLEAHDRKAH* |
| Ga0073934_103251133 | 3300006865 | Hot Spring Sediment | MKMLLATMFKKVPVRRTQQRATICKRCGARIYSLGFLKAHLESHDRQKH* |
| Ga0073934_104246562 | 3300006865 | Hot Spring Sediment | MKVLLATMFRKVPVRKTERRATICKRCGTRIYSLSFLKAHLEAHDKKSTHA* |
| Ga0075429_1009439362 | 3300006880 | Populus Rhizosphere | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRGT |
| Ga0075426_101924163 | 3300006903 | Populus Rhizosphere | MKLLLATMFRKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKT |
| Ga0075424_1000024616 | 3300006904 | Populus Rhizosphere | MRLLLSTMFRKLPVRTTKQRATICKRCGARIYSLSYLKAHLESHDRNTPLVH* |
| Ga0079219_108253041 | 3300006954 | Agricultural Soil | MKTLISTMFKKVPVRNTKQRACICKRCGVRIYSLSFLKAHLEAHNKKTH* |
| Ga0075419_100746593 | 3300006969 | Populus Rhizosphere | MKLLLATMFKKVPVRKTLQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH* |
| Ga0079218_102232843 | 3300007004 | Agricultural Soil | MKLLLATMFRKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRSNH* |
| Ga0079218_124983571 | 3300007004 | Agricultural Soil | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSFLKVHLESHDRSTH* |
| Ga0066710_10000388611 | 3300009012 | Grasslands Soil | MKLLLATMFRKVPVRKTLQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH |
| Ga0105095_106857713 | 3300009053 | Freshwater Sediment | EEQQMKLLLATMFRKVPVRTTKQRATLCKRCGARIYTLSFLKAHLEAHDRKTH* |
| Ga0105106_102522611 | 3300009078 | Freshwater Sediment | QQMKLLLATMFRKVPVRATKQRATLCKRCGARIYTLSFLKAHLEAHDRKTH* |
| Ga0105240_122048213 | 3300009093 | Corn Rhizosphere | VMKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLEAHDRKTH* |
| Ga0111539_110579371 | 3300009094 | Populus Rhizosphere | PLKEHPMKILLATMFKKMPVRKTKQRATICKRCGTRIYSMSFLKVHLESHDRSTH* |
| Ga0075418_111686892 | 3300009100 | Populus Rhizosphere | MRLLLATMFRKLPVRTTKQRATICKRCGALIYSLSYLKAHLESHDRNT |
| Ga0114129_101382094 | 3300009147 | Populus Rhizosphere | MRLLLATMFRKLPVRTTKQRATICKRCGARIYSLSYLKAHLESHDRNTH* |
| Ga0105092_100212034 | 3300009157 | Freshwater Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHERSTH* |
| Ga0105092_100728194 | 3300009157 | Freshwater Sediment | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKVHLEAHDRKNH* |
| Ga0114945_101603873 | 3300009444 | Thermal Springs | MKVLVATMFKKIPVRKTKQRATICKRCGVRIYSLSFLKAHLEAHDKKTH* |
| Ga0118657_101286234 | 3300009506 | Mangrove Sediment | MKMLLATMFKKVPVRKTKQRATICKRCGVRIYSISFLKAHLEAHDRKAH* |
| Ga0105237_102210232 | 3300009545 | Corn Rhizosphere | MRLLLATMFRKLPVRTTQQRATICKRCGARIYSLSYLKAHLESHDRKGH* |
| Ga0105259_11232951 | 3300009597 | Soil | MLIVAMFKKVPVCQTKRLATLCKRCGAAIYSLSFLKAHLDAHHKKTN* |
| Ga0105347_10154064 | 3300009609 | Soil | MKLLLVTMFRKVPVRKTKQRATFCKQCGTRIYSLPFLKAHLESHQRN* |
| Ga0105347_10195581 | 3300009609 | Soil | MTGTTQPMKESAMRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHERSTH* |
| Ga0105252_1000053921 | 3300009678 | Soil | MKLLLATMFKKVPVRRTNQRATICKRCGTRIYSLSFLKVHLESHARNSH* |
| Ga0105252_100746123 | 3300009678 | Soil | MLIVAMFKKVPVCQTKRLATLCKRCGAAIYSLSFLK |
| Ga0126307_103276221 | 3300009789 | Serpentine Soil | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLS |
| Ga0126384_100086125 | 3300010046 | Tropical Forest Soil | MKVLIATMFKKIPVRATRQRASICKRCGVRIYSLSFLKAHLEAHNKKSTRA* |
| Ga0126384_101212852 | 3300010046 | Tropical Forest Soil | MKVLIATMFKKIPVRATQQRASICKRCGVRIYSLSFLKAHLEAHNKKSTHA* |
| Ga0126370_100300914 | 3300010358 | Tropical Forest Soil | MKVLIATMFRKIPVRTTQQRASICKKCGVRIYSLSFLKAHLEAHNKKSANA* |
| Ga0126372_103581601 | 3300010360 | Tropical Forest Soil | MRVLIATMFKKIPVRETQQRASICKRCGARIYSLSFLKAQLEAHAKKDH* |
| Ga0126372_110037721 | 3300010360 | Tropical Forest Soil | MRVLIATMFKKIPVRKTQQRASICKRCGARIYSLSFLKAHLEAHARKEQ* |
| Ga0126381_1001373901 | 3300010376 | Tropical Forest Soil | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLETHERKSH* |
| Ga0136847_122237864 | 3300010391 | Freshwater Sediment | MKMLIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKGH* |
| Ga0134122_101640431 | 3300010400 | Terrestrial Soil | MKLLLATMFKKVPVRRTKQRATICKQCGTKIYSLSFLKAHLESHNRKSH* |
| Ga0134122_109949591 | 3300010400 | Terrestrial Soil | SEERSMKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKNH* |
| Ga0134123_104988833 | 3300010403 | Terrestrial Soil | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKGH* |
| Ga0137313_10776973 | 3300011403 | Soil | GGISKPLKEHPMKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSFLKVHLESHDRSTH |
| Ga0137442_10524832 | 3300011414 | Soil | MKLLLATMFKKVPVRKTKQRATICKRCGSRIYSLSYLKVHLESHARDTH* |
| Ga0137446_11817223 | 3300011419 | Soil | HPMKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHERNTH* |
| Ga0137426_10026163 | 3300011435 | Soil | MKLLLATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHARNAH* |
| Ga0137453_10040032 | 3300012034 | Soil | MKILLATMFKKVPVRKTKQRATLCKRCGTRIYSMSYLKVHLESHDRASH* |
| Ga0137389_104707202 | 3300012096 | Vadose Zone Soil | MRMLIATMFKKIPVRKTQQRASICKRCGVRVYSLSFLKAHLEAHDRK |
| Ga0137334_10275071 | 3300012179 | Soil | RMLIVAMFKKVPVCQTKRLATLCKRCGAAIYSLSFLKAHLDAHHKKTN* |
| Ga0137374_1000605810 | 3300012204 | Vadose Zone Soil | MKLLLATMFRKVPVRKTRQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH* |
| Ga0137369_100907822 | 3300012355 | Vadose Zone Soil | MTLKEQQMKLLLATMFRKVPVRKTQQRATICKRCGTRIYSLGFLKAHLEAHDKRSH* |
| Ga0137361_113375241 | 3300012362 | Vadose Zone Soil | MKLMIATMFKKVPVRKTQQRACICKRCGARIYSLSYLKAHLEAHDR |
| Ga0157285_101172971 | 3300012897 | Soil | MRLLVSTMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESH |
| Ga0137394_100142228 | 3300012922 | Vadose Zone Soil | MKLLLATMFKKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDKKTH* |
| Ga0153915_133210281 | 3300012931 | Freshwater Wetlands | MKMLIATMFKKVPVRTTKQRASICKRCGARIYSLSYLKAHLETH |
| Ga0153915_134805951 | 3300012931 | Freshwater Wetlands | MKLLLATMFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNQ* |
| Ga0126375_116622951 | 3300012948 | Tropical Forest Soil | MKLLLATMFKKVPVRNTKQRATLCKRCGTRIYSLSY |
| Ga0153916_110781861 | 3300012964 | Freshwater Wetlands | MKMLIATMFKKVPVRTTKQRASICKRCGARIYSLSYLKAHL |
| Ga0126369_100342558 | 3300012971 | Tropical Forest Soil | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLETHDRKNH* |
| Ga0157378_113042192 | 3300013297 | Miscanthus Rhizosphere | KRSQPMKMLISAMFKKVPVRKTQQRACICKRCGARIYSLSFLKAHLEAHSKKTH* |
| Ga0157375_132189452 | 3300013308 | Miscanthus Rhizosphere | MKMLIATMFKKMPVRRTQQRACICKRCGTRIYSLAFLKAHLEAHD |
| Ga0075320_10414592 | 3300014255 | Natural And Restored Wetlands | PMGEAVMKLLLSTLFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKTH* |
| Ga0075324_10019374 | 3300014263 | Natural And Restored Wetlands | MKLLLSTLFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKTH* |
| Ga0180066_10877192 | 3300014873 | Soil | MKMLIATMFKKVPVRKTQQRASVCKQCGARIYSLSFLKAHLAAHEKKGH* |
| Ga0157376_129905862 | 3300014969 | Miscanthus Rhizosphere | RPPIKFAEEQTMRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKDH |
| Ga0132258_139782291 | 3300015371 | Arabidopsis Rhizosphere | QTKEHPMKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNRKSH* |
| Ga0132257_1000023092 | 3300015373 | Arabidopsis Rhizosphere | MRLLLSTMFRKLPVRTTKQRATICKRCGARIYSLSYLKAHLESHDRNTH* |
| Ga0132257_1006978182 | 3300015373 | Arabidopsis Rhizosphere | MKLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLESHDRKTH* |
| Ga0187824_100240472 | 3300017927 | Freshwater Sediment | MKLLLATMFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNQ |
| Ga0187776_105932131 | 3300017966 | Tropical Peatland | MKVLIATMFKKVPVRKTKQRASLCKRCGARIYSLSYLKAHLEAHERKTH |
| Ga0184634_100213854 | 3300018031 | Groundwater Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHERSTH |
| Ga0184634_105286133 | 3300018031 | Groundwater Sediment | PMKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRNTH |
| Ga0187788_100121224 | 3300018032 | Tropical Peatland | MKLLLATMFRKLPVRNTKQRATICKRCGTRIYSLSFLKVHLESHARNHH |
| Ga0184638_10085805 | 3300018052 | Groundwater Sediment | MKLLLATMFKKVPVRNTKQRATLCKRCGTRIYSLSFLKAHLEAHDKRTH |
| Ga0184626_100389244 | 3300018053 | Groundwater Sediment | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSFLKVHLESHDRNTH |
| Ga0184621_100260113 | 3300018054 | Groundwater Sediment | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRSTH |
| Ga0184623_101050551 | 3300018056 | Groundwater Sediment | MKILLATMFKKVPVRKTTQRATICKRCGTRIYSMSFLKVHLESHDRNTH |
| Ga0184623_102647922 | 3300018056 | Groundwater Sediment | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDKKNH |
| Ga0184637_100696282 | 3300018063 | Groundwater Sediment | MKLLFATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHARNTL |
| Ga0184637_100723953 | 3300018063 | Groundwater Sediment | MKMLIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKGH |
| Ga0184637_103675342 | 3300018063 | Groundwater Sediment | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRNTH |
| Ga0184618_100011904 | 3300018071 | Groundwater Sediment | MKLLLATMFRKVPVRKTQQRATICKRCGTRIYSLGFLKAHLEAHDKKSH |
| Ga0184635_100715772 | 3300018072 | Groundwater Sediment | MKLLLATMFKKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKTH |
| Ga0184640_100008443 | 3300018074 | Groundwater Sediment | MKLLLATMFKKVPVRNTKQRATLCKRCGIRIYSLSFLKAHLEAHDKRTH |
| Ga0184632_100147885 | 3300018075 | Groundwater Sediment | MKLLLATMFKKVPVRNTKQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH |
| Ga0184609_100045948 | 3300018076 | Groundwater Sediment | MKLLLVTMFKKVPVRNTKQRATLCKRCGTRIYSLSFLKAHLEAHDKRTH |
| Ga0184609_101088761 | 3300018076 | Groundwater Sediment | LFGASMTLKEQQMKLLLATMFRKVPVRKTQQRATICKRCGTRIYSLGFLKAHLEAHDKKS |
| Ga0184627_100009845 | 3300018079 | Groundwater Sediment | MKILIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKGH |
| Ga0184639_103461151 | 3300018082 | Groundwater Sediment | MKMLLATMFKKVPVRKTKQRATICKRCGVRIYSLSFLKAHLEAHDKKTH |
| Ga0184628_100046977 | 3300018083 | Groundwater Sediment | MKLLLVTMFRKVPVRKTKQRATFCKQCGTRIYSLPFLKAHLESHQRI |
| Ga0184629_100212734 | 3300018084 | Groundwater Sediment | MKLLLATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHARNAH |
| Ga0184629_102928492 | 3300018084 | Groundwater Sediment | MKMLIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKDH |
| Ga0184629_104199741 | 3300018084 | Groundwater Sediment | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSYLKVHLESHDRASH |
| Ga0190265_101645965 | 3300018422 | Soil | SLLGISNPLEERQMRLLLATMFRKVPVRTTKQRATLCKRCGARIYTLSFLKAHLEAHDRKTH |
| Ga0190265_105589503 | 3300018422 | Soil | MKLLLATMFRKVPVRTTKQRATLCKRCGARIYTLSFLKAHLEAHDRKTH |
| Ga0190265_109769952 | 3300018422 | Soil | MKLLLATMFKKVPVRMTRQRATLCKRCGARIYSLSYLKAHLEAHDRKIIKDYPEKRN |
| Ga0190265_121138012 | 3300018422 | Soil | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKVHLEAHDRNNH |
| Ga0066655_109834371 | 3300018431 | Grasslands Soil | PLKEQQMKLLLATMFRKVPVRKTLQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH |
| Ga0066662_100308162 | 3300018468 | Grasslands Soil | MKLMIATMFKKVPVRKTQQRACICKRCGARIYSLSYLKAHLEAHDRKTH |
| Ga0066669_100022463 | 3300018482 | Grasslands Soil | MKLMIATMFKKVPVRKTQQRACICKRCGVRIYSLSYLKAHLEAHDRKTH |
| Ga0173482_100096983 | 3300019361 | Soil | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKGH |
| Ga0190264_103990771 | 3300019377 | Soil | TMFKKVPVRTTQQRDALQACGARIYSLSYLKAHLEHDRKNH |
| Ga0190264_114543691 | 3300019377 | Soil | MRVLLATMIKRVPVRTTSRRAIICKRCGTRIYSLGFLKKHLEAHDK |
| Ga0193715_10054831 | 3300019878 | Soil | MKLLLATMFKKIPVRETQQRATICKRCGTRIYSLSFLKKHLEAHDKKAH |
| Ga0193712_10495551 | 3300019880 | Soil | MKLLLATMFKKVPVRKTKQRATICKRCGSRIYSLSYLKVHLESHARDTH |
| Ga0193738_11937661 | 3300020020 | Soil | MKILLATMFKKVPVRKTKQRATICKRCGTRIYSMSFLKVHLESHDRSTH |
| Ga0194110_101237722 | 3300020084 | Freshwater Lake | MRLLIATMFKKVPVRKTKQRACICKRCGTRIYSLAFLKAHLEAHDRKNH |
| Ga0194128_100318875 | 3300020197 | Freshwater Lake | MKLLLATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHARNSH |
| Ga0210382_100357163 | 3300021080 | Groundwater Sediment | MKLLLATMFRKVPVRKTHQRATICKRCGTRIYSLGFLKAHLEAHDKKSH |
| Ga0210379_100552772 | 3300021081 | Groundwater Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGARIYSLNFLKHHLEAHERSTH |
| Ga0212128_100134829 | 3300022563 | Thermal Springs | MKMLVATMFKRIPVRKTKQRATICKRCGVRIYSLSFLKAHLEAHDKKTH |
| Ga0209618_10800782 | 3300025001 | Soil | MKILIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKYH |
| Ga0209322_100302533 | 3300025146 | Soil | MKILIATMFKKVPVRRTQQRASVCKRCGARIYSLSFLKAHLEAHVKKGH |
| Ga0209322_102538611 | 3300025146 | Soil | MKLLIATMFKKVPVRKTHKRASICKRCGTRIYSLSFLKAHLEAHDRKAR |
| Ga0209320_100078624 | 3300025155 | Soil | MKLLLSTLFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKTH |
| Ga0209320_102884982 | 3300025155 | Soil | MKMLIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDRKAR |
| Ga0209619_102214062 | 3300025159 | Soil | MKLLIATMFKKVPVRKTHKRASICKRCGTRIYSLSFLKAHLEAHERKTH |
| Ga0209619_104834722 | 3300025159 | Soil | MKLLIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDRKAR |
| Ga0209109_101754993 | 3300025160 | Soil | MKILIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDKKAR |
| Ga0209521_102966611 | 3300025164 | Soil | IEELPMKLLIATMFKKVPVRKTHKRASICKRCGTRIYSLSFLKAHLEAHERKTH |
| Ga0209642_101388351 | 3300025167 | Soil | MKMLIATMFKKVPVRKTHQRVSICKRCGTRIYSLSYLKAHLEAHDKKAH |
| Ga0209324_105306152 | 3300025174 | Soil | MKMLIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKA |
| Ga0209002_101211003 | 3300025289 | Soil | MKMLIATMFKKVPVRKTHQRVSICKRCGTRIYSLSYLKAHLEAHDRKAR |
| Ga0209172_1000066424 | 3300025310 | Hot Spring Sediment | MKLLLATMFKKMPVRTSKQRATICKRCGTRIYSLSYLKVHLESHARNPH |
| Ga0209172_103614402 | 3300025310 | Hot Spring Sediment | MKVLLATMFRKVPVRKTERRATICKRCGTRIYSLSFLKAHLEAHDKKSTHA |
| Ga0209431_101892193 | 3300025313 | Soil | IATMFKKVPVRKTHKRASICKRCGTRIYSLSFLKAHLEAHERKTH |
| Ga0207697_100045083 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLESHDRKTH |
| Ga0209640_100216761 | 3300025324 | Soil | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHERSIH |
| Ga0210061_10041443 | 3300025537 | Natural And Restored Wetlands | MKLLLATMFKKVPVRSTKQRATLCKRCGARIYSLSYLKAHLEAHNKNNH |
| Ga0210061_10843682 | 3300025537 | Natural And Restored Wetlands | MKLLLATMFKKVPVRATKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNQ |
| Ga0207707_100228289 | 3300025912 | Corn Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKA |
| Ga0207707_107020402 | 3300025912 | Corn Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLEAHDRKTH |
| Ga0207657_100280905 | 3300025919 | Corn Rhizosphere | MRLLVSTMFRKLPVRTTQQRATICKRCGVRIYSLSYLKAHLESHDRKDH |
| Ga0207652_105127684 | 3300025921 | Corn Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLE |
| Ga0207681_114909452 | 3300025923 | Switchgrass Rhizosphere | MRLLLATMFRKLPVRTTQQRATICKRCGVRIYSLSYLK |
| Ga0207690_115811352 | 3300025932 | Corn Rhizosphere | SPEERVMKLLLATMFKKLPVRTTKQRATICKRCGSRIYSLSYLKAHLEAHDRKTH |
| Ga0207706_101270422 | 3300025933 | Corn Rhizosphere | MKLLLATMFKKLPVRTTKQRATICKRCGMRIYSLSYLKAHLEAHDRKTH |
| Ga0210145_10176041 | 3300025973 | Natural And Restored Wetlands | MKLLFATMFKKVPVRRTKQRATICKRCGTRIYSLS |
| Ga0208141_10045901 | 3300025988 | Rice Paddy Soil | MKLLLATLFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDKKNH |
| Ga0207683_100199789 | 3300026121 | Miscanthus Rhizosphere | MRLLVSTMFRKLPVRTTQQRATICKRCGARIYSLSYLKAHLESHDRKGH |
| Ga0209468_10040107 | 3300026306 | Soil | MKLMIATMFKKVPVRRTQQRACICKRCGARIYSLSYLKAHLEAHDRKTH |
| Ga0209131_10923794 | 3300026320 | Grasslands Soil | MKLLLATMFKKVPVRKTQQRATICKRCGSRIYSLSYLKVHLESHARDTH |
| Ga0256867_100225964 | 3300026535 | Soil | MKLLLATLFKKVPVRTTQQRATLCKRCGARIYSLSYLKAHLEAHDRKAH |
| Ga0208685_10062185 | 3300027513 | Soil | MLIVAMFKKVPVCQTKRLATLCKRCGAAIYSLSFLKAHLDAHHKKTN |
| Ga0209684_10027841 | 3300027527 | Tropical Forest Soil | MKVLIATMFKKIPVRATRQRASICKRCGVRIYSLSFLKAHLEAHNKKSTHA |
| Ga0208454_10004595 | 3300027573 | Soil | MKLLLATMFKKVPVRRTNQRATICKRCGTRIYSLSFLKVHLESHARNSH |
| Ga0209818_10087542 | 3300027637 | Agricultural Soil | MKLLLATMFRKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRSNH |
| Ga0209799_10021897 | 3300027654 | Tropical Forest Soil | MKVLIATMFKKIPVRATQQRASICKRCGVRIYSLSFLKAHLEAHNKKSTHA |
| Ga0209966_10169751 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MKLLLATMFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHNKNNH |
| Ga0209464_102754701 | 3300027778 | Wetland Sediment | MKLLLATMFKKVPVRKTKQRATLCKQCGTRIYSLSFLKAHLESHDRKAH |
| Ga0209726_100103387 | 3300027815 | Groundwater | MKLLIATMFKKVPVRKTHQRASICKRCGTRIYSLSYLKAHLEAHDRKAH |
| Ga0209726_100196009 | 3300027815 | Groundwater | MKLLLATMFKKVPVRKTSQRATICKRCGTRIYSLSFLKVHLESHARNSH |
| Ga0209726_101496994 | 3300027815 | Groundwater | MKLLLATMFKKVPVRNTKQRATICKQCGTRIYSMSFLKVHLESHDRKSH |
| Ga0209683_100190582 | 3300027840 | Wetland Sediment | MKLLLATMFKKVPVRKTKQRATFCKQCGTRIYSLSFLKAHLESHQRKSH |
| Ga0209798_100759305 | 3300027843 | Wetland Sediment | MKLLLATMFKKVPVRKTKQRATLCKQCGTRIYSLSFLKAHLESHQRKSH |
| Ga0209814_100175403 | 3300027873 | Populus Rhizosphere | MKLLLATMFKKVPVRKTLQRATLCKRCGTRIYSLSFLKAHLEAHDKKTH |
| Ga0207428_106261192 | 3300027907 | Populus Rhizosphere | MKLLLATMFRKLPVRTTKQRATICKRCGTRIYSLSYLKAHLEAHDRKTH |
| Ga0209536_10003805710 | 3300027917 | Marine Sediment | MKMLLATMFKKVPVRKTKQRATICKRCGARIYSMSFLKAHLEAHDKKAHLFIEG |
| Ga0307302_102383001 | 3300028814 | Soil | ATMFRKVPVRKTQQRATICKRCGTRIYSLGFLKAHLEAHDKKISLTIEQ |
| Ga0307312_103966271 | 3300028828 | Soil | MKLLLATMFKKIPVRETQQRATICKRCGTRIYSLSFLKKHLEAHDKKG |
| Ga0299907_101792802 | 3300030006 | Soil | MKESAVRVLIATMFKKVPVRKTKQRACICKRCGARIYSLNFLKHHLEAHERSNH |
| Ga0299907_101925532 | 3300030006 | Soil | MKMLIATMFKKVPVRKTKQRACICKRCGARIYSLNFLKHHLEAHERATH |
| Ga0299907_107318243 | 3300030006 | Soil | KLLLATLFKKVPVRTTQQRATLCKRCGARIYSLGYLKAHLEAHDRKAH |
| Ga0299906_106361152 | 3300030606 | Soil | MKLLLSTLFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAH |
| Ga0268386_106783511 | 3300030619 | Soil | MKLLLATMFRKVPVRKTNQRATICKRCGTRIYSLSFLKKHLEAHGRKLH |
| (restricted) Ga0255310_100595401 | 3300031197 | Sandy Soil | MKLLLATMFRKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDKKNH |
| Ga0299913_101416002 | 3300031229 | Soil | MRLLLATLFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHDRKSH |
| Ga0299913_102656644 | 3300031229 | Soil | MKLLLATLFKKVPVRTTQQRATLCKRCGARIYSLGYLKAHLEAHDRKAH |
| Ga0299913_104033944 | 3300031229 | Soil | LLSTLFKKVPVRTTKQRATLCKRCGARIYSLSYLKAHLEAHDRKTH |
| Ga0307469_100065463 | 3300031720 | Hardwood Forest Soil | MKVLIATMFKKIPVRTTQQRASICKRCGVRIYSLSYLKAHLEAHNKKSANA |
| Ga0307405_100148746 | 3300031731 | Rhizosphere | MKLLLATMFKKVPVRKTRQRATICKQCGTRIYSLSFLKAHLESHSRNSH |
| Ga0307473_100882171 | 3300031820 | Hardwood Forest Soil | MKLLLATMFKKIPVRETQQRATICKRCGTRIYSLSFLKKH |
| Ga0306921_100635972 | 3300031912 | Soil | MRLLLSTMFRKLPVRTTKQRATICKRCGVRIYSLSYLKAHLETHDRKNH |
| Ga0214473_100355773 | 3300031949 | Soil | MKMIIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAHEKKYH |
| Ga0326597_1000182314 | 3300031965 | Soil | MKMIIATMFKKVPVRKTHQRASICKRCGTRVYSLSYLKAHLEAHDRKTH |
| Ga0326597_100274815 | 3300031965 | Soil | MKLIIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKVHLEAHEKKYH |
| Ga0326597_100875174 | 3300031965 | Soil | MKMLIATMFKKVPVRKTQQRVSICKRCGRRIYSLSYLKAHLEAHDRKAR |
| Ga0315910_115262301 | 3300032144 | Soil | MKLLLATMFKKVPVRTTKQRATLCKRCGVRIYSLSYLKAHLE |
| Ga0315912_108625211 | 3300032157 | Soil | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHN |
| Ga0307471_1029749952 | 3300032180 | Hardwood Forest Soil | MKLLLATMFKKVPVRRTKQRATICKRCGTRIYSLSFLKVHLESHA |
| Ga0335085_100710773 | 3300032770 | Soil | MRVLIATMFKKIPVRKTQQRASICKRCGARIYSLSFLKAHLEAHARKEH |
| Ga0335082_1000261419 | 3300032782 | Soil | MRMLIATMFKKIPVRKTQQRASICKRCGARIYSLSFLKAHLESHTKKDHC |
| Ga0335082_100592772 | 3300032782 | Soil | MKILIATMFKKIPVRSTQQRACICKKCGVRIYSLSFLKAHLEAHNRKSAHA |
| Ga0335082_103023503 | 3300032782 | Soil | MRVLIATMFKKIPVRKTQQRASICKRCGARIYSLSFLKAHLEAHAKKEH |
| Ga0335070_103024373 | 3300032829 | Soil | MKLLLATMFKKVPVRRTKQRATLCKRCGARIYTLSFLKAHLEAHDRKNH |
| Ga0335084_101425301 | 3300033004 | Soil | QTKEQSMRVLIATMFKKIPVRKTQQRASICKRCGARIYSLSFLKAHLEAHARKEH |
| Ga0214471_102354951 | 3300033417 | Soil | MRMLIATMFKKVPVRKTKQRACICKRCGIRIYSLNFLKHHL |
| Ga0316601_1016281451 | 3300033419 | Soil | LLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNRKSH |
| Ga0316600_111951131 | 3300033481 | Soil | MKLLLATMFKKVPVRKTKQRATICKQCGTRIYSLSFLKAHLESH |
| Ga0316630_100119348 | 3300033487 | Soil | MKLLLATMFKKMPVRKTKQRATICKQCGTRIYSLSFLKAHLESHNRKSH |
| Ga0316628_1000130276 | 3300033513 | Soil | MKMLIATMFKKVPVRTTSQRASICKRCGARIYSLSYLKAHLEAHHRRTH |
| Ga0316628_1024695171 | 3300033513 | Soil | MKLLLATMFKKVPVRTTKQRATLCKRCGTRIYSLSYLKAHLEAHNKKNQ |
| Ga0364928_0058477_447_590 | 3300033813 | Sediment | MLIATMFKKVPVRKTHQRASICKRCGARIYSLSFLKAHLEAHEKKGH |
| Ga0364927_0026118_560_709 | 3300034148 | Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKYHLEAHERSTH |
| Ga0364935_0023667_1551_1679 | 3300034151 | Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKYHLEA |
| Ga0364940_0031242_2_124 | 3300034164 | Sediment | MKMLIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHL |
| Ga0364940_0246105_395_526 | 3300034164 | Sediment | MKMLIATMFKKVPVRKTQQRASVCKRCGARIYSLSFLKAHLEAH |
| Ga0364923_0019258_1154_1303 | 3300034690 | Sediment | MRMLIATMFKKVPVRKTKQRACICKRCGVRIYSLNFLKHHLEAHERSTN |
| ⦗Top⦘ |