


| Basic Information | |
|---|---|
| Family ID | F010990 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 296 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 296 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.59 % |
| % of genes near scaffold ends (potentially truncated) | 83.78 % |
| % of genes from short scaffolds (< 2000 bps) | 80.74 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.041 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock (31.419 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.419 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 0.00% Coil/Unstructured: 87.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 296 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 9.12 |
| PF13701 | DDE_Tnp_1_4 | 6.76 |
| PF13006 | Nterm_IS4 | 4.39 |
| PF02371 | Transposase_20 | 1.35 |
| PF13565 | HTH_32 | 1.01 |
| PF03050 | DDE_Tnp_IS66 | 1.01 |
| PF13546 | DDE_5 | 1.01 |
| PF13683 | rve_3 | 1.01 |
| PF00872 | Transposase_mut | 1.01 |
| PF00589 | Phage_integrase | 1.01 |
| PF02627 | CMD | 0.68 |
| PF02705 | K_trans | 0.68 |
| PF04796 | RepA_C | 0.68 |
| PF00004 | AAA | 0.68 |
| PF12762 | DDE_Tnp_IS1595 | 0.68 |
| PF12760 | Zn_Tnp_IS1595 | 0.68 |
| PF01548 | DEDD_Tnp_IS110 | 0.68 |
| PF00291 | PALP | 0.68 |
| PF13612 | DDE_Tnp_1_3 | 0.68 |
| PF04255 | DUF433 | 0.68 |
| PF09250 | Prim-Pol | 0.68 |
| PF05016 | ParE_toxin | 0.68 |
| PF05598 | DUF772 | 0.68 |
| PF13356 | Arm-DNA-bind_3 | 0.34 |
| PF01925 | TauE | 0.34 |
| PF13561 | adh_short_C2 | 0.34 |
| PF00873 | ACR_tran | 0.34 |
| PF01979 | Amidohydro_1 | 0.34 |
| PF03308 | MeaB | 0.34 |
| PF02374 | ArsA_ATPase | 0.34 |
| PF12680 | SnoaL_2 | 0.34 |
| PF04343 | DUF488 | 0.34 |
| PF13610 | DDE_Tnp_IS240 | 0.34 |
| PF02771 | Acyl-CoA_dh_N | 0.34 |
| PF13586 | DDE_Tnp_1_2 | 0.34 |
| PF02080 | TrkA_C | 0.34 |
| PF13354 | Beta-lactamase2 | 0.34 |
| PF01494 | FAD_binding_3 | 0.34 |
| PF13518 | HTH_28 | 0.34 |
| PF00067 | p450 | 0.34 |
| PF04234 | CopC | 0.34 |
| PF02310 | B12-binding | 0.34 |
| PF13358 | DDE_3 | 0.34 |
| PF02518 | HATPase_c | 0.34 |
| PF13487 | HD_5 | 0.34 |
| PF04014 | MazE_antitoxin | 0.34 |
| PF00171 | Aldedh | 0.34 |
| PF13378 | MR_MLE_C | 0.34 |
| PF00561 | Abhydrolase_1 | 0.34 |
| PF01037 | AsnC_trans_reg | 0.34 |
| PF02567 | PhzC-PhzF | 0.34 |
| PF11937 | DUF3455 | 0.34 |
| PF00174 | Oxidored_molyb | 0.34 |
| PF02470 | MlaD | 0.34 |
| PF01656 | CbiA | 0.34 |
| PF07015 | VirC1 | 0.34 |
| PF13302 | Acetyltransf_3 | 0.34 |
| PF08388 | GIIM | 0.34 |
| PF06429 | Flg_bbr_C | 0.34 |
| PF03301 | Trp_dioxygenase | 0.34 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.34 |
| PF12679 | ABC2_membrane_2 | 0.34 |
| PF06305 | LapA_dom | 0.34 |
| PF13384 | HTH_23 | 0.34 |
| PF07589 | PEP-CTERM | 0.34 |
| PF04828 | GFA | 0.34 |
| PF09822 | ABC_transp_aux | 0.34 |
| PF01526 | DDE_Tnp_Tn3 | 0.34 |
| PF12840 | HTH_20 | 0.34 |
| PF16841 | CBM60 | 0.34 |
| PF03400 | DDE_Tnp_IS1 | 0.34 |
| PF13737 | DDE_Tnp_1_5 | 0.34 |
| PF00072 | Response_reg | 0.34 |
| PF13592 | HTH_33 | 0.34 |
| PF13276 | HTH_21 | 0.34 |
| PF07992 | Pyr_redox_2 | 0.34 |
| PF13430 | DUF4112 | 0.34 |
| PF02880 | PGM_PMM_III | 0.34 |
| PF04986 | Y2_Tnp | 0.34 |
| PF13280 | WYL | 0.34 |
| PF13333 | rve_2 | 0.34 |
| PF11154 | DUF2934 | 0.34 |
| PF03069 | FmdA_AmdA | 0.34 |
| PF09106 | SelB-wing_2 | 0.34 |
| PF00528 | BPD_transp_1 | 0.34 |
| PF13614 | AAA_31 | 0.34 |
| PF01381 | HTH_3 | 0.34 |
| PF01726 | LexA_DNA_bind | 0.34 |
| PF13649 | Methyltransf_25 | 0.34 |
| PF12850 | Metallophos_2 | 0.34 |
| PF07883 | Cupin_2 | 0.34 |
| PF13340 | DUF4096 | 0.34 |
| PF08240 | ADH_N | 0.34 |
| PF00483 | NTP_transferase | 0.34 |
| PF13495 | Phage_int_SAM_4 | 0.34 |
| PF13408 | Zn_ribbon_recom | 0.34 |
| PF00795 | CN_hydrolase | 0.34 |
| PF00923 | TAL_FSA | 0.34 |
| PF00034 | Cytochrom_C | 0.34 |
| PF06412 | TraD | 0.34 |
| PF00700 | Flagellin_C | 0.34 |
| PF17171 | GST_C_6 | 0.34 |
| PF00665 | rve | 0.34 |
| PF14384 | BrnA_antitoxin | 0.34 |
| PF01300 | Sua5_yciO_yrdC | 0.34 |
| PF00403 | HMA | 0.34 |
| PF02798 | GST_N | 0.34 |
| PF00248 | Aldo_ket_red | 0.34 |
| PF01695 | IstB_IS21 | 0.34 |
| PF02896 | PEP-utilizers_C | 0.34 |
| PF01613 | Flavin_Reduct | 0.34 |
| PF02738 | MoCoBD_1 | 0.34 |
| PF01663 | Phosphodiest | 0.34 |
| PF04545 | Sigma70_r4 | 0.34 |
| PF13538 | UvrD_C_2 | 0.34 |
| PF13365 | Trypsin_2 | 0.34 |
| PF12441 | CopG_antitoxin | 0.34 |
| PF03073 | TspO_MBR | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 296 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 9.12 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 9.12 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 9.12 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 9.12 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 9.12 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 9.12 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.03 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.01 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.01 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.68 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.68 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.68 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.68 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.34 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.34 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.34 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.34 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.34 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.34 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.34 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.34 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.34 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.34 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.34 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.34 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.34 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.34 |
| COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.34 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.34 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.34 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.34 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.34 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.34 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.34 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.34 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.34 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.34 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.34 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.34 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.34 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.34 |
| COG3276 | Selenocysteine-specific translation elongation factor SelB | Translation, ribosomal structure and biogenesis [J] | 0.34 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.34 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 0.34 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 0.34 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.34 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.34 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.34 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.34 |
| COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.34 |
| COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.38 % |
| Unclassified | root | N/A | 21.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2119805009|FNTS007_GKN1E7E02IN3Y4 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → unclassified Jiella → Jiella sp. CBK1P-4 | 500 | Open in IMG/M |
| 2209111000|2209891859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 514 | Open in IMG/M |
| 3300000956|JGI10216J12902_101125520 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300002244|JGI24742J22300_10127439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300004081|Ga0063454_100250997 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300005162|Ga0066814_10009082 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005186|Ga0066676_10591591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300005329|Ga0070683_102093383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 544 | Open in IMG/M |
| 3300005335|Ga0070666_10254978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1243 | Open in IMG/M |
| 3300005340|Ga0070689_101231234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300005459|Ga0068867_102296617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300005505|Ga0068898_10924928 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005535|Ga0070684_100714273 | Not Available | 935 | Open in IMG/M |
| 3300005535|Ga0070684_100876089 | Not Available | 841 | Open in IMG/M |
| 3300005562|Ga0058697_10628704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300005614|Ga0068856_101933668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005615|Ga0070702_100074057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2019 | Open in IMG/M |
| 3300005618|Ga0068864_101842201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300005718|Ga0068866_11186181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300005719|Ga0068861_101696955 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005840|Ga0068870_10129601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300005843|Ga0068860_102331195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300006031|Ga0066651_10752818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 526 | Open in IMG/M |
| 3300006034|Ga0066656_11135142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 503 | Open in IMG/M |
| 3300006755|Ga0079222_10410862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
| 3300006755|Ga0079222_10583552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300006794|Ga0066658_10943269 | Not Available | 500 | Open in IMG/M |
| 3300006844|Ga0075428_101440215 | Not Available | 722 | Open in IMG/M |
| 3300006845|Ga0075421_101028604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 930 | Open in IMG/M |
| 3300006845|Ga0075421_101656182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300006846|Ga0075430_100813886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300006853|Ga0075420_101923298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 505 | Open in IMG/M |
| 3300006876|Ga0079217_11512499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300006894|Ga0079215_10060657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300006918|Ga0079216_10223272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300006918|Ga0079216_10364283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
| 3300006953|Ga0074063_11897928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
| 3300006954|Ga0079219_11513732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300006954|Ga0079219_12305052 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300007790|Ga0105679_10703240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. | 1224 | Open in IMG/M |
| 3300007790|Ga0105679_10736800 | Not Available | 1080 | Open in IMG/M |
| 3300009100|Ga0075418_10582435 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300009101|Ga0105247_10297770 | Not Available | 1118 | Open in IMG/M |
| 3300009148|Ga0105243_12224094 | Not Available | 585 | Open in IMG/M |
| 3300009177|Ga0105248_10729784 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300009177|Ga0105248_12832246 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009553|Ga0105249_10448350 | Not Available | 1329 | Open in IMG/M |
| 3300009686|Ga0123338_10062046 | Not Available | 2110 | Open in IMG/M |
| 3300009695|Ga0123337_10288385 | Not Available | 829 | Open in IMG/M |
| 3300009840|Ga0126313_10901012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 722 | Open in IMG/M |
| 3300009840|Ga0126313_11098807 | Not Available | 653 | Open in IMG/M |
| 3300009840|Ga0126313_11788397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 514 | Open in IMG/M |
| 3300010037|Ga0126304_10558075 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300010038|Ga0126315_11210710 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010039|Ga0126309_10094499 | Not Available | 1528 | Open in IMG/M |
| 3300010039|Ga0126309_10604398 | Not Available | 691 | Open in IMG/M |
| 3300010039|Ga0126309_10770007 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010039|Ga0126309_11097659 | Not Available | 540 | Open in IMG/M |
| 3300010040|Ga0126308_10242255 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300010041|Ga0126312_10413055 | Not Available | 960 | Open in IMG/M |
| 3300010041|Ga0126312_10729886 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010041|Ga0126312_10936359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300010042|Ga0126314_10553711 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010044|Ga0126310_10139996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1526 | Open in IMG/M |
| 3300010044|Ga0126310_11701817 | Not Available | 524 | Open in IMG/M |
| 3300010045|Ga0126311_10097963 | Not Available | 2006 | Open in IMG/M |
| 3300010045|Ga0126311_10874448 | Not Available | 728 | Open in IMG/M |
| 3300010045|Ga0126311_11508030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300010045|Ga0126311_11527662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium laguerreae | 560 | Open in IMG/M |
| 3300010045|Ga0126311_11919295 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010166|Ga0126306_10163634 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300010166|Ga0126306_10435364 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300010166|Ga0126306_11061811 | Not Available | 662 | Open in IMG/M |
| 3300010166|Ga0126306_11540078 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010166|Ga0126306_11790093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300010364|Ga0134066_10300217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300010373|Ga0134128_11746628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 685 | Open in IMG/M |
| 3300010396|Ga0134126_13009390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300010399|Ga0134127_10124364 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300010403|Ga0134123_12716504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300011332|Ga0126317_11097022 | Not Available | 627 | Open in IMG/M |
| 3300011404|Ga0153951_1017884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300012212|Ga0150985_104921420 | Not Available | 545 | Open in IMG/M |
| 3300012212|Ga0150985_108264005 | Not Available | 765 | Open in IMG/M |
| 3300012212|Ga0150985_111879346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300012469|Ga0150984_102453284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 538 | Open in IMG/M |
| 3300012469|Ga0150984_103081694 | Not Available | 672 | Open in IMG/M |
| 3300012469|Ga0150984_109485992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300012469|Ga0150984_109739596 | Not Available | 502 | Open in IMG/M |
| 3300012469|Ga0150984_122111707 | Not Available | 920 | Open in IMG/M |
| 3300012884|Ga0157300_1026622 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300012909|Ga0157290_10363232 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012951|Ga0164300_10340046 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012951|Ga0164300_10601317 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012958|Ga0164299_10591452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300012985|Ga0164308_10540915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300012985|Ga0164308_12260971 | Not Available | 506 | Open in IMG/M |
| 3300012989|Ga0164305_12246329 | Not Available | 502 | Open in IMG/M |
| 3300013306|Ga0163162_13289579 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300014326|Ga0157380_10207783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
| 3300014488|Ga0182001_10401674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicola → Lichenicola cladoniae | 596 | Open in IMG/M |
| 3300014497|Ga0182008_10112617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium | 1349 | Open in IMG/M |
| 3300014497|Ga0182008_10523377 | Not Available | 655 | Open in IMG/M |
| 3300014497|Ga0182008_10852728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300014497|Ga0182008_10863248 | Not Available | 530 | Open in IMG/M |
| 3300014497|Ga0182008_10864212 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300015265|Ga0182005_1089926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300015265|Ga0182005_1212581 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300015357|Ga0134072_10304021 | Not Available | 596 | Open in IMG/M |
| 3300017659|Ga0134083_10559072 | Not Available | 519 | Open in IMG/M |
| 3300018432|Ga0190275_10019112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5277 | Open in IMG/M |
| 3300018432|Ga0190275_10388871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1401 | Open in IMG/M |
| 3300018432|Ga0190275_10519055 | Not Available | 1227 | Open in IMG/M |
| 3300018432|Ga0190275_10538490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1207 | Open in IMG/M |
| 3300018432|Ga0190275_10543573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300018432|Ga0190275_11317117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 798 | Open in IMG/M |
| 3300018432|Ga0190275_12545759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus | 589 | Open in IMG/M |
| 3300018432|Ga0190275_12973842 | Not Available | 548 | Open in IMG/M |
| 3300018465|Ga0190269_11687459 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018468|Ga0066662_10105941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Boseongicola | 2007 | Open in IMG/M |
| 3300018468|Ga0066662_12993280 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018469|Ga0190270_13367494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300018481|Ga0190271_10203846 | Not Available | 1972 | Open in IMG/M |
| 3300018757|Ga0193612_1070935 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018890|Ga0193595_1136211 | Not Available | 681 | Open in IMG/M |
| 3300018906|Ga0193609_1030341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B510 | 1751 | Open in IMG/M |
| 3300018906|Ga0193609_1037871 | Not Available | 1533 | Open in IMG/M |
| 3300018920|Ga0190273_11344711 | Not Available | 620 | Open in IMG/M |
| 3300018931|Ga0193601_1039147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1488 | Open in IMG/M |
| 3300018933|Ga0193614_1151760 | Not Available | 635 | Open in IMG/M |
| 3300018933|Ga0193614_1186600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300018984|Ga0193605_1121849 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300019767|Ga0190267_10019059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300019767|Ga0190267_10680704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300021362|Ga0213882_10136915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1001 | Open in IMG/M |
| 3300021374|Ga0213881_10088476 | Not Available | 1334 | Open in IMG/M |
| 3300021374|Ga0213881_10435151 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021377|Ga0213874_10302750 | Not Available | 602 | Open in IMG/M |
| 3300021384|Ga0213876_10742912 | Not Available | 522 | Open in IMG/M |
| 3300021388|Ga0213875_10608171 | Not Available | 528 | Open in IMG/M |
| 3300022561|Ga0212090_10018327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 9013 | Open in IMG/M |
| 3300022561|Ga0212090_10278257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1321 | Open in IMG/M |
| 3300022561|Ga0212090_10302669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1238 | Open in IMG/M |
| 3300022891|Ga0247770_1057585 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300025123|Ga0209082_1086988 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025321|Ga0207656_10211986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300025321|Ga0207656_10290251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 808 | Open in IMG/M |
| 3300025728|Ga0207655_1243087 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025901|Ga0207688_10236749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300025906|Ga0207699_10156042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra | 1515 | Open in IMG/M |
| 3300025907|Ga0207645_10124750 | Not Available | 1673 | Open in IMG/M |
| 3300025907|Ga0207645_10133308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1617 | Open in IMG/M |
| 3300025910|Ga0207684_11097109 | Not Available | 662 | Open in IMG/M |
| 3300025913|Ga0207695_10849017 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300025920|Ga0207649_11568686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300025923|Ga0207681_10506937 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300025927|Ga0207687_10137968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1847 | Open in IMG/M |
| 3300025927|Ga0207687_10665221 | Not Available | 882 | Open in IMG/M |
| 3300025928|Ga0207700_11508678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300025928|Ga0207700_11587265 | Not Available | 579 | Open in IMG/M |
| 3300025945|Ga0207679_10146819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
| 3300026023|Ga0207677_11917960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus acidophilus | 550 | Open in IMG/M |
| 3300026078|Ga0207702_12402153 | Not Available | 514 | Open in IMG/M |
| 3300026116|Ga0207674_10443789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1254 | Open in IMG/M |
| 3300026116|Ga0207674_10889676 | Not Available | 858 | Open in IMG/M |
| 3300026325|Ga0209152_10485939 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026325|Ga0209152_10502802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300027691|Ga0209485_1241709 | Not Available | 578 | Open in IMG/M |
| 3300027718|Ga0209795_10197357 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027750|Ga0209461_10146078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300027880|Ga0209481_10502639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 626 | Open in IMG/M |
| 3300028379|Ga0268266_11245965 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300028381|Ga0268264_10520996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis | 1162 | Open in IMG/M |
| 3300028589|Ga0247818_10387637 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300028810|Ga0307294_10220060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300030499|Ga0268259_10018183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum moscoviense | 1279 | Open in IMG/M |
| 3300030514|Ga0268253_10098402 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300030523|Ga0272436_1007837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10807 | Open in IMG/M |
| 3300030523|Ga0272436_1009120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9584 | Open in IMG/M |
| 3300030523|Ga0272436_1031806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3154 | Open in IMG/M |
| 3300030523|Ga0272436_1046034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2196 | Open in IMG/M |
| 3300030523|Ga0272436_1058072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B510 | 1746 | Open in IMG/M |
| 3300030523|Ga0272436_1073059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
| 3300030523|Ga0272436_1073199 | Not Available | 1397 | Open in IMG/M |
| 3300030523|Ga0272436_1099178 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300030523|Ga0272436_1101926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
| 3300030523|Ga0272436_1159214 | Not Available | 654 | Open in IMG/M |
| 3300031229|Ga0299913_11829590 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031447|Ga0272435_1001683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 23880 | Open in IMG/M |
| 3300031447|Ga0272435_1008535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 6550 | Open in IMG/M |
| 3300031447|Ga0272435_1024423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2928 | Open in IMG/M |
| 3300031447|Ga0272435_1025046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2872 | Open in IMG/M |
| 3300031447|Ga0272435_1025361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 70-18 | 2841 | Open in IMG/M |
| 3300031447|Ga0272435_1037318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2092 | Open in IMG/M |
| 3300031447|Ga0272435_1039249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2007 | Open in IMG/M |
| 3300031448|Ga0272438_1028357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 4240 | Open in IMG/M |
| 3300031448|Ga0272438_1057630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2519 | Open in IMG/M |
| 3300031448|Ga0272438_1082713 | Not Available | 1897 | Open in IMG/M |
| 3300031448|Ga0272438_1114016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B510 | 1455 | Open in IMG/M |
| 3300031448|Ga0272438_1290565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300031449|Ga0272429_1204730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031450|Ga0272433_10038911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3784 | Open in IMG/M |
| 3300031450|Ga0272433_10046708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3307 | Open in IMG/M |
| 3300031450|Ga0272433_10184154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1177 | Open in IMG/M |
| 3300031450|Ga0272433_10184664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1174 | Open in IMG/M |
| 3300031450|Ga0272433_10187697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300031450|Ga0272433_10217826 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Pseudococcidae → Paracoccus | 1027 | Open in IMG/M |
| 3300031450|Ga0272433_10306011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 769 | Open in IMG/M |
| 3300031450|Ga0272433_10391127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B510 | 619 | Open in IMG/M |
| 3300031451|Ga0272426_1145070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300031451|Ga0272426_1153279 | Not Available | 799 | Open in IMG/M |
| 3300031451|Ga0272426_1218599 | Not Available | 558 | Open in IMG/M |
| 3300031451|Ga0272426_1225237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300031452|Ga0272422_1020747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 4640 | Open in IMG/M |
| 3300031452|Ga0272422_1031944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3222 | Open in IMG/M |
| 3300031452|Ga0272422_1049495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2194 | Open in IMG/M |
| 3300031452|Ga0272422_1063122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300031452|Ga0272422_1114006 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031452|Ga0272422_1189415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300031453|Ga0272425_1017093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5533 | Open in IMG/M |
| 3300031453|Ga0272425_1027623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3739 | Open in IMG/M |
| 3300031453|Ga0272425_1037503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2928 | Open in IMG/M |
| 3300031454|Ga0272427_1025433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3837 | Open in IMG/M |
| 3300031460|Ga0272430_1050650 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300031460|Ga0272430_1196760 | Not Available | 531 | Open in IMG/M |
| 3300031470|Ga0272432_1036888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3217 | Open in IMG/M |
| 3300031470|Ga0272432_1068064 | Not Available | 1950 | Open in IMG/M |
| 3300031470|Ga0272432_1100996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1416 | Open in IMG/M |
| 3300031470|Ga0272432_1160795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300031470|Ga0272432_1257389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 628 | Open in IMG/M |
| 3300031471|Ga0272439_1051926 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300031471|Ga0272439_1059519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2866 | Open in IMG/M |
| 3300031471|Ga0272439_1087729 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300031471|Ga0272439_1165489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 1094 | Open in IMG/M |
| 3300031472|Ga0272437_1001190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 40312 | Open in IMG/M |
| 3300031472|Ga0272437_1008325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11957 | Open in IMG/M |
| 3300031472|Ga0272437_1032969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4837 | Open in IMG/M |
| 3300031472|Ga0272437_1048727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3591 | Open in IMG/M |
| 3300031472|Ga0272437_1061051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2985 | Open in IMG/M |
| 3300031472|Ga0272437_1078976 | Not Available | 2410 | Open in IMG/M |
| 3300031472|Ga0272437_1083500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2297 | Open in IMG/M |
| 3300031472|Ga0272437_1197646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1075 | Open in IMG/M |
| 3300031472|Ga0272437_1213485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1003 | Open in IMG/M |
| 3300031473|Ga0272434_1032898 | All Organisms → cellular organisms → Bacteria | 4510 | Open in IMG/M |
| 3300031473|Ga0272434_1062841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2907 | Open in IMG/M |
| 3300031520|Ga0272428_1013043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10131 | Open in IMG/M |
| 3300031520|Ga0272428_1036556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 4317 | Open in IMG/M |
| 3300031520|Ga0272428_1039073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 4088 | Open in IMG/M |
| 3300031520|Ga0272428_1058340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2915 | Open in IMG/M |
| 3300031520|Ga0272428_1068803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 2529 | Open in IMG/M |
| 3300031520|Ga0272428_1096348 | Not Available | 1881 | Open in IMG/M |
| 3300031520|Ga0272428_1119643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300031520|Ga0272428_1142121 | Not Available | 1337 | Open in IMG/M |
| 3300031520|Ga0272428_1151628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1262 | Open in IMG/M |
| 3300031520|Ga0272428_1152057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1259 | Open in IMG/M |
| 3300031520|Ga0272428_1172499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1125 | Open in IMG/M |
| 3300031520|Ga0272428_1174671 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300031520|Ga0272428_1365979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300031852|Ga0307410_10209547 | Not Available | 1492 | Open in IMG/M |
| 3300031852|Ga0307410_11830088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300031903|Ga0307407_11617244 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031913|Ga0310891_10078281 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300031938|Ga0308175_100709221 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300031938|Ga0308175_101266801 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031939|Ga0308174_11072249 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031995|Ga0307409_100236338 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300031995|Ga0307409_100726790 | Not Available | 995 | Open in IMG/M |
| 3300031995|Ga0307409_102404736 | Not Available | 556 | Open in IMG/M |
| 3300032002|Ga0307416_103515682 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. SB0661_bin_20 | 524 | Open in IMG/M |
| 3300032002|Ga0307416_103607663 | Not Available | 518 | Open in IMG/M |
| 3300032013|Ga0310906_10303305 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300032013|Ga0310906_10322497 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300032162|Ga0272424_1011605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 11391 | Open in IMG/M |
| 3300032162|Ga0272424_1049309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3346 | Open in IMG/M |
| 3300032162|Ga0272424_1175073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 911 | Open in IMG/M |
| 3300033168|Ga0272423_1000705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 39910 | Open in IMG/M |
| 3300033168|Ga0272423_1018461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5537 | Open in IMG/M |
| 3300033168|Ga0272423_1031307 | Not Available | 3966 | Open in IMG/M |
| 3300033168|Ga0272423_1038756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3434 | Open in IMG/M |
| 3300033168|Ga0272423_1049919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2877 | Open in IMG/M |
| 3300033168|Ga0272423_1073635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2132 | Open in IMG/M |
| 3300033168|Ga0272423_1088023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica → Salmonella enterica subsp. enterica | 1840 | Open in IMG/M |
| 3300033168|Ga0272423_1096317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1704 | Open in IMG/M |
| 3300033168|Ga0272423_1114263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Komagataeibacter → Komagataeibacter europaeus | 1465 | Open in IMG/M |
| 3300033168|Ga0272423_1115607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa | 1449 | Open in IMG/M |
| 3300034005|Ga0334930_065674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 627 | Open in IMG/M |
| 3300034005|Ga0334930_078808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300034027|Ga0334949_088271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 829 | Open in IMG/M |
| 3300034139|Ga0334956_049738 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300034221|Ga0334937_033871 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300034236|Ga0334938_014531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1533 | Open in IMG/M |
| 3300034236|Ga0334938_083774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300034268|Ga0372943_0062854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 2104 | Open in IMG/M |
| 3300034268|Ga0372943_0093137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300034391|Ga0334917_032355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300034779|Ga0334945_016719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga ossetica | 1154 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 31.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.04% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.03% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 1.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.01% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.01% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.01% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.01% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.01% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.01% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.34% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.34% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.34% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.34% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2119805009 | Soil microbial communities from sample at FACE Site NTS_007 Nevada Test Site | Environmental | Open in IMG/M |
| 2209111000 | Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green Butte | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005505 | Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300009695 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018757 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 42 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018906 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300018931 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018933 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 | Environmental | Open in IMG/M |
| 3300018984 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022891 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6 | Environmental | Open in IMG/M |
| 3300025123 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031447 | Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nord | Environmental | Open in IMG/M |
| 3300031448 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nord | Environmental | Open in IMG/M |
| 3300031449 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031451 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nord | Environmental | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031453 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031460 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord | Environmental | Open in IMG/M |
| 3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
| 3300031471 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sud | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032162 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord | Environmental | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034027 | Biocrust microbial communities from Mojave Desert, California, United States - 45SNC | Environmental | Open in IMG/M |
| 3300034139 | Biocrust microbial communities from Mojave Desert, California, United States - 52SNC | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| 3300034236 | Biocrust microbial communities from Mojave Desert, California, United States - 34SMC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034391 | Biocrust microbial communities from Mojave Desert, California, United States - 13HMC | Environmental | Open in IMG/M |
| 3300034779 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 41SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FNTS007_08030650 | 2119805009 | Soil | ILEERVASSRGRQVPRGVKRKMSGYKLRPRAPQPTTWIDFAAAIRTVK |
| 2210028482 | 2209111000 | Soil | SGRGRQVPRGVKRKMSSYPLRPRAPQPTTRVDFTTAIRLAK |
| JGI10216J12902_1011255202 | 3300000956 | Soil | VASSRGRQVPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRILK* |
| JGI24742J22300_101274391 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAELLEERVASSRGRWVPRGVKRKMSGYKLRPRTPQPTVRIDFAAAIR |
| Ga0063454_1002509971 | 3300004081 | Soil | RGRRVPRGVKRKMSGYKLRPRSSRPTVRIDFAAAIRIVG* |
| Ga0066814_100090821 | 3300005162 | Soil | VLAEILEERVASSRGRRVPRGGKRKMSGYQLRPRTPQPTTRIDFAAAVRIVK* |
| Ga0066676_105915911 | 3300005186 | Soil | MVSSRGRRVPRGVKRKMSNYPLRPRASQPIIRIDFTAAIVLVK* |
| Ga0070683_1020933832 | 3300005329 | Corn Rhizosphere | EERAVSGRGRQVPRGVKRKMSNYPLRPRAPQPITRIDYVAAIRISK* |
| Ga0070666_102549783 | 3300005335 | Switchgrass Rhizosphere | ERAVSGRGRQVPRGVKRKMSNYPLRPRAPQPITRTDFAPAIRIVK* |
| Ga0070689_1012312342 | 3300005340 | Switchgrass Rhizosphere | VVSSRGRRVPRGVKRKMSNYPLRPRASQPIIRIDFTTAIQIVK* |
| Ga0068867_1022966172 | 3300005459 | Miscanthus Rhizosphere | VVSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTAAIVLVK |
| Ga0068898_109249282 | 3300005505 | Soil | VPRGVKRKMSGYTLRPRGPQPTIRIDFTAAIRIIK* |
| Ga0070684_1007142732 | 3300005535 | Corn Rhizosphere | SSRGRRVPRGVKRKMSSYPLRPRTPQPTVRIDFATAIQIVM* |
| Ga0070684_1008760891 | 3300005535 | Corn Rhizosphere | VLDEILEECVVSSRERQVPRGAKRKMSSYRLRTRSPQPTLWIDFDAAVKK* |
| Ga0058697_106287042 | 3300005562 | Agave | VVSGRGRQVPRGVKRKMSSYPLRPRAPQPITRIDFATAIRIVK* |
| Ga0068856_1019336682 | 3300005614 | Corn Rhizosphere | SRGRRVPRGVKRKMSGYQLRPRAPQPTVRIDFAAAIRIVK* |
| Ga0070702_1000740573 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ILEERAVSGRGRQVPRGLKRKVSSYPLRLRAPQPITRTDFATAIQIIH* |
| Ga0068864_1018422013 | 3300005618 | Switchgrass Rhizosphere | QVPRGVKRKMSNYPLRPRAPQPITRTDFATAIRIVK* |
| Ga0068866_111861811 | 3300005718 | Miscanthus Rhizosphere | VVSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTAA |
| Ga0068861_1016969552 | 3300005719 | Switchgrass Rhizosphere | VPRGVKRKMSNYPLRPRASQPIIRIDFTTAIQIVK* |
| Ga0068870_101296012 | 3300005840 | Miscanthus Rhizosphere | VPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRILK* |
| Ga0068860_1023311952 | 3300005843 | Switchgrass Rhizosphere | PRGVKRKMSSYHLRPRSPHPVIRIDYAAAVRVLK* |
| Ga0066651_107528181 | 3300006031 | Soil | VPRGVKRKMSGYRLRPRTPQPTTRIDFAAAIRIVK* |
| Ga0066656_111351421 | 3300006034 | Soil | SRGRRVPRGVKRKMSSYPLRPRAAQPIIRIDFTAAVTIVK* |
| Ga0079222_104108623 | 3300006755 | Agricultural Soil | NEILEERVVSSRGRRVPRWVKRKISNYPLRPRASQPIIRIDFTAAIVLVK* |
| Ga0079222_105835521 | 3300006755 | Agricultural Soil | RQVPRGVKRKMSGYPLRPRTPLPIVRIDFTAAIKISK* |
| Ga0066658_109432691 | 3300006794 | Soil | RVPRGVKRKMSGYKLRSRSPQPIVWIDFAAAIRIIK* |
| Ga0075428_1014402151 | 3300006844 | Populus Rhizosphere | PRGVKRKMSGYPLRPRAPQPTVRIDFTAAIRIIK* |
| Ga0075421_1010286041 | 3300006845 | Populus Rhizosphere | RVPRGVKRKMSGYPLRPRAPQPTVRIDFTAAIRIIK* |
| Ga0075421_1016561821 | 3300006845 | Populus Rhizosphere | EILEERVASSRGRQVPRGIKRKMSGYRLRPRTPQPITRIDFAGAIRIVK* |
| Ga0075430_1008138862 | 3300006846 | Populus Rhizosphere | LEERVASSRGRQVPRGVKRKMTGYKIRPRAPQPTARINFAAAIRIVK* |
| Ga0075420_1019232982 | 3300006853 | Populus Rhizosphere | PRGVKRKMSNYPLRPRAPQPITRIDYEAAIRVLK* |
| Ga0079217_115124992 | 3300006876 | Agricultural Soil | PRGVKRKMSGYPLRPRAPQPATRIDFAAAVRILK* |
| Ga0079215_100606571 | 3300006894 | Agricultural Soil | VASGRGRRVARGVKRKMSNYSLRPRTPQPTTRIDFTAAIRIA |
| Ga0079216_102232721 | 3300006918 | Agricultural Soil | ERVTSSRGRQVPRGVKRKMSGYPLRPRAPQPAARIDFVAAIRILK* |
| Ga0079216_103642831 | 3300006918 | Agricultural Soil | GVKRKMSNYPLRPREPQPITRIDLTAAVRILNEQHWG* |
| Ga0074063_118979282 | 3300006953 | Soil | MVSSRGRQVPRGVKRKMSGYKLRPRTPQPTVKIDFTAAIRIVK |
| Ga0079219_115137321 | 3300006954 | Agricultural Soil | VLAELLKERVEGRRGRRVSRGVKREMSGYKLRPRGPQPAVRVDFAAAIRIVR* |
| Ga0079219_123050521 | 3300006954 | Agricultural Soil | RVPRGVKRKMSGHKLRPRAPQPTAWIDYAAAIRIVK* |
| Ga0105679_107032403 | 3300007790 | Soil | LEERAVSGRGRQVPRGVKRKMSGYPLRPRAPQPPTRLDFNAAVQLAK* |
| Ga0105679_107368003 | 3300007790 | Soil | SSRGRQVPRGVKRKMSNYPLRPRTPLPTIRIDFTAAIQIAK* |
| Ga0075418_105824351 | 3300009100 | Populus Rhizosphere | RRVPRGVKRKMSGYPLRPRAPQPTVRIDFTAAIRIIK* |
| Ga0105247_102977701 | 3300009101 | Switchgrass Rhizosphere | RQVPRGVKRKVSNYPLRPRTPLPTTRIDFTAAIQIAK* |
| Ga0105243_122240942 | 3300009148 | Miscanthus Rhizosphere | PRGVKRKMSNYPLRPRASQPIIRIDFTTAIQIVK* |
| Ga0105248_107297842 | 3300009177 | Switchgrass Rhizosphere | VPRGVKRKMSSYPLRPRASQPIIRIDFAAAIVLVK* |
| Ga0105248_128322462 | 3300009177 | Switchgrass Rhizosphere | VPRGVKRKMSGYKLRPRAPQPTTRIDFAAAIRIVK* |
| Ga0105249_104483501 | 3300009553 | Switchgrass Rhizosphere | EERVVSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTAAIVIVK* |
| Ga0123338_100620461 | 3300009686 | Glacier Valley | RQVPRGVKRKMSGYPLRPRAPQPTTRIDVAAAIRIAK* |
| Ga0123337_102883853 | 3300009695 | Glacier Valley | QVPRGVKRKMSGYPLRPRAPQPTTRIDVAAAIRIAK* |
| Ga0126313_109010122 | 3300009840 | Serpentine Soil | VLDEILEERVASSRGRQVLRGVKRKMSNYQLRPRLPQPTIRIDFAAAIRIIK* |
| Ga0126313_110988072 | 3300009840 | Serpentine Soil | QVPRGVKRKMSNYQLRPRVSQPTIRIDFAAAIRTLK* |
| Ga0126313_117883971 | 3300009840 | Serpentine Soil | AVSGRGRQVPRGVKRKMSNYPLRPRAPQPITHVDYIAAIRIAE* |
| Ga0126304_105580752 | 3300010037 | Serpentine Soil | VPRGVKRKMSGYKLRRRVPQPTTWIDFAAAIRILK* |
| Ga0126315_112107102 | 3300010038 | Serpentine Soil | RVASSRGRRVPRGVKRKMSGYKLRPRAPQPTVRIDFAAAIRIVK* |
| Ga0126309_100944991 | 3300010039 | Serpentine Soil | RGRQVPRGVKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK* |
| Ga0126309_106043982 | 3300010039 | Serpentine Soil | VPRGVKRKMSNYALRPREPQPITRIDFTAAVRILNEQHWG* |
| Ga0126309_107700072 | 3300010039 | Serpentine Soil | VLDSGQGRQVPRRVKRKMSSYKLRLRAPQPTTRINFITAIQIVK* |
| Ga0126309_110976591 | 3300010039 | Serpentine Soil | SRGRRVPRGVKRKMSNYPLRPRIPQPTTRVDFTAAIRIAEPE* |
| Ga0126308_102422553 | 3300010040 | Serpentine Soil | RVPRRVKRKRSGYRLRPRAPQPTLRIDFAAAIRIVK* |
| Ga0126312_104130551 | 3300010041 | Serpentine Soil | ILEERAESGRGRQVPRGVNRKMSNYPLRPRTPQPTTRIDFTATIQIAK* |
| Ga0126312_107298862 | 3300010041 | Serpentine Soil | VSGRGRQVPRGVKRKMSSYPLRPRAPQPIIRIDFTAAIRIVK* |
| Ga0126312_109363592 | 3300010041 | Serpentine Soil | RVPRGVKRKMSGYKLRPRAPQPTTYIDFAAAIRIVK* |
| Ga0126314_105537112 | 3300010042 | Serpentine Soil | VASSQSRQVPRGVKRKMSGYPLRPRTPQPITRIDFIAAIRVIK* |
| Ga0126310_101399961 | 3300010044 | Serpentine Soil | RGRRVPRGLKRKMSGYHLRPRSSQPTVRIDFTAAIRIIK* |
| Ga0126310_117018172 | 3300010044 | Serpentine Soil | PRGVKRKMSGYKLRTRTPQPTVRIDFTAAVRIVK* |
| Ga0126311_100979632 | 3300010045 | Serpentine Soil | RVVSGRGRQVPRGVKRKMSRYPLRPRAPQPTTRVDFNAAIRITK* |
| Ga0126311_108744483 | 3300010045 | Serpentine Soil | ASSRGRQVPRGVKRKMSNYQLRPRVSQPTIRIDFAAAIRIIK* |
| Ga0126311_115080302 | 3300010045 | Serpentine Soil | EERAESGRGRQVPRGVKRKMSNYPLRPRTPPPTTRIDFTATIQIAK* |
| Ga0126311_115276622 | 3300010045 | Serpentine Soil | PRGVKRKMSNYPLRPRAPQPTTRIDFAAAVQILK* |
| Ga0126311_119192951 | 3300010045 | Serpentine Soil | GRQVPRGVKRKMSNYQLRPRVPQPTTRIDFTAAIRIVK* |
| Ga0126306_101636341 | 3300010166 | Serpentine Soil | GVKRKMSNYALRPREPQPITRIDFTAAVRILNEQHCH* |
| Ga0126306_104353641 | 3300010166 | Serpentine Soil | VVSSRGRRVPRGVKRKMSGYKLRRRVPQPTTWIDF |
| Ga0126306_110618113 | 3300010166 | Serpentine Soil | RQVPRGVKRKMSNYPLRPRAPQPTTRIDFAAAVQILK* |
| Ga0126306_115400782 | 3300010166 | Serpentine Soil | VLNEILAERVASSRGRQVPRGVKRKMGRYPLLPRTPLPIVRIDFNAAIKISK* |
| Ga0126306_117900932 | 3300010166 | Serpentine Soil | SRGRRVPRGVKRKMSNYQLRPRFSQPTIRIDFAAAIRIIK* |
| Ga0134066_103002171 | 3300010364 | Grasslands Soil | RQVPRGIKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK* |
| Ga0134128_117466281 | 3300010373 | Terrestrial Soil | RVPRGVKRKMSNYPLRPRAPQPTTRIDFTTAIRIVK* |
| Ga0134126_130093901 | 3300010396 | Terrestrial Soil | SRGRQVPRGVKRKMSNYPLRPRAPQQTIRIDFTAAVQIVM* |
| Ga0134127_101243641 | 3300010399 | Terrestrial Soil | SRGRRVPRGVKRKMSYYPLRLRASQPIIRIDFPTALQIVK* |
| Ga0134123_127165042 | 3300010403 | Terrestrial Soil | VPRGVKRKMSSYPLRPRASQPIIRIDFTAAIVLVK* |
| Ga0126317_110970221 | 3300011332 | Soil | RTRRALHRAVLDSGRGRQVPRRGKRKMSSYKLRPRAPQPTTRINFITAIQIVK* |
| Ga0153951_10178841 | 3300011404 | Attine Ant Fungus Gardens | RQVPRGVKRKMSSYPLRPFTPQPTTRIDFATAIRVLK* |
| Ga0150985_1049214201 | 3300012212 | Avena Fatua Rhizosphere | RAVSGRGRQVPRGVKRKMSNYPLRPRAPLPITRIDFAAAISISK* |
| Ga0150985_1082640052 | 3300012212 | Avena Fatua Rhizosphere | RAVSGRGRQVPRGVKRKMSNYPLRPRAPLPITRIDFAAAIRVSK* |
| Ga0150985_1118793461 | 3300012212 | Avena Fatua Rhizosphere | RGRQVPRGVKRKMSNYPLRPRTPRPTTRIDFTAAIQIAK* |
| Ga0150984_1024532842 | 3300012469 | Avena Fatua Rhizosphere | AGNRGRRVPRGVKRKMSGYKLRPRAPHPTVRIDFAAAIRIIK* |
| Ga0150984_1030816941 | 3300012469 | Avena Fatua Rhizosphere | MRCKRLARAPRGVKRKMSNYPLRPRASQPIIRIDFTAAI |
| Ga0150984_1094859921 | 3300012469 | Avena Fatua Rhizosphere | QVPRGVKRKMSSYPLRPRAPQPTTWVDFIAAIRIAK* |
| Ga0150984_1097395961 | 3300012469 | Avena Fatua Rhizosphere | RKMSNYPLRPRQPQPITRIDFTAAVRILTEQHCS* |
| Ga0150984_1221117072 | 3300012469 | Avena Fatua Rhizosphere | QVPRGVKRKMSGYRLRPRTPQPATRVDFAAAIRILK* |
| Ga0157300_10266222 | 3300012884 | Soil | VVSSRGRRVPRGVKRKMSNYPLRPRASQPIIRIDFTAAIVLVK* |
| Ga0157290_103632322 | 3300012909 | Soil | VVSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTVAIVLVK* |
| Ga0164300_103400462 | 3300012951 | Soil | DELLEERVASSRGRRVPRGFKRKMSGYQLRPRALQPTVRIEFTAAVRIVT* |
| Ga0164300_106013171 | 3300012951 | Soil | VLAEILEERVASSRGRRVPRGGKRKMSGYQLRPRAPQPTTRIDFAAAVRIVK* |
| Ga0164299_105914522 | 3300012958 | Soil | RGRRVSSGAKRKMSIYPPRPRASQPIIRIDFTAAIVLVK* |
| Ga0164308_105409152 | 3300012985 | Soil | RVVSSRGRRVPRGVKRKMSSYPLRPRALQPITRIDFTTAIQIVK* |
| Ga0164308_122609711 | 3300012985 | Soil | RQVPRGVKRKMSGYPLRPRTPLPTVRIDFTAAIKISK* |
| Ga0164305_122463291 | 3300012989 | Soil | ERVASSRGRRVPRGVKRKMSGYQLRPRAPQPTIRIDFAAAIRIVK* |
| Ga0163162_132895792 | 3300013306 | Switchgrass Rhizosphere | MVSSRGRQVPRGVKRKMSGYKLRPRTPQPTVKIDFTAAIRIVK* |
| Ga0157380_102077832 | 3300014326 | Switchgrass Rhizosphere | PRGVKRKMSNYPLRPRTPQPTTRIDFTAAIQIAK* |
| Ga0182001_104016742 | 3300014488 | Soil | VARSRGRRVPRGVKREMSGYRPRPRAPQPTHWIDFVTAVRIVK* |
| Ga0182008_101126172 | 3300014497 | Rhizosphere | EILEERAECGRGRQVPRGIKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK* |
| Ga0182008_105233772 | 3300014497 | Rhizosphere | RGRRVPRGVKRKMSGYRLRPRTPRPTVRIDFTAAIRIVK* |
| Ga0182008_108527282 | 3300014497 | Rhizosphere | EILEERAECGRGRQVPRGIKRKMSNYPLRPRTPLPTTRIDFTAAIQIAK* |
| Ga0182008_108632482 | 3300014497 | Rhizosphere | ERVASSRGRRVPRGVKRKMSGYRLRPRAPQPTVRIDFAAAIRIVK* |
| Ga0182008_108642122 | 3300014497 | Rhizosphere | VESRRGRRVPRGVKRKMSGYKLRPRAPQPTVWIDFAAAIRIVK* |
| Ga0182005_10899262 | 3300015265 | Rhizosphere | VLVEILEERVEGRRGRRVPRAVKREMSGYRLWSRSPQPTLRIDVAAAIRIVK* |
| Ga0182005_12125811 | 3300015265 | Rhizosphere | VPRGVKRKMSGYKLRSRAPQPTVRIDFAAAIRIAK* |
| Ga0134072_103040212 | 3300015357 | Grasslands Soil | SRGRQVPRGVKRKMSGYPLRPRTPLPIVRIDFTAAIKISK* |
| Ga0134083_105590722 | 3300017659 | Grasslands Soil | LHEAVLAEILEERVAGSQGRRVPRGIKRKMSGYKLRPRAPQPTVRIDFAAAIRIVK |
| Ga0190275_100191126 | 3300018432 | Soil | MTRCWDEILEERAVSGRGRQVPRGVKRKIRAPQPATRLDFNAAIQLAK |
| Ga0190275_103888711 | 3300018432 | Soil | SGRGRQVPRGVKRKMSSYPLRPRAPQPTTRIDFTAAIQIAK |
| Ga0190275_105190551 | 3300018432 | Soil | RQVPRGVKRKMSNYPLRPRASQPITRIDYEAAIRVLK |
| Ga0190275_105384901 | 3300018432 | Soil | QVPRGVKRKMSNYPLRPRAPQPTTRLDFAAAIQLIK |
| Ga0190275_105435734 | 3300018432 | Soil | QVPRGVKRKMSNYPLRPRAPQPTTRLDFAAAIQVIK |
| Ga0190275_113171174 | 3300018432 | Soil | RQVPRGVKRKMSNYPLRPRAPQPTTRLDFAAAIQVIK |
| Ga0190275_125457592 | 3300018432 | Soil | QVPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRILK |
| Ga0190275_129738421 | 3300018432 | Soil | ERVASSRGRQVPRGVKRKMSGYKLRPRGPQPTTWIDFAAAIRILK |
| Ga0190269_116874592 | 3300018465 | Soil | MLEERAVSGRGRQVPRGVKRKMSGYRLRPRTPQPTVRIDFAAAIRIVK |
| Ga0066662_101059413 | 3300018468 | Grasslands Soil | LEERVASSRGRQVPRGVKRKMSGYKLRPRAPQPTVRIDFAAAIRIVK |
| Ga0066662_129932801 | 3300018468 | Grasslands Soil | VPRGVKRKMSNYPLRPRASQPIIRIDFTATIVLVK |
| Ga0190270_133674942 | 3300018469 | Soil | EEILEERAVSGRGRQVPRGVKRKMSNYALRPREPQPITRIDFTAAVRILNEQHWG |
| Ga0190271_102038463 | 3300018481 | Soil | GRQAPRGVKRKMSNYPLRLRAPQPTTRIDFTTAIRILK |
| Ga0193612_10709352 | 3300018757 | Soil | VPRGVKRKMSGYTLRPRGPQPTIRIDFTAAIRIIK |
| Ga0193595_11362112 | 3300018890 | Soil | RVPRGVKRKMSGYTLRPRGPQPTIRIDFTAAIRIIK |
| Ga0193609_10303411 | 3300018906 | Soil | VPRGVIRKMSSYPLRSRVPQPTTRIDLTAAVRLVK |
| Ga0193609_10378711 | 3300018906 | Soil | VPRGVKRKMSGYTLRPRGPQPTIRIDFTAAIQIIK |
| Ga0190273_113447113 | 3300018920 | Soil | VPRGVKREMSGYKLRPRAPQPTVWVDFVAAIRIVK |
| Ga0193601_10391472 | 3300018931 | Soil | VASSRGRQVPRGVKRKMSNYQLRPRTSQPTIRIDFTAAITILK |
| Ga0193614_11517602 | 3300018933 | Soil | RVASRPGRQVPRGVKRKMSGYKLRPRAPQPTTRIDFTAAIRIVK |
| Ga0193614_11866002 | 3300018933 | Soil | GRQVPRGVKRKMSRYKLRPRAPQPTTWIDFAAAIRILK |
| Ga0193605_11218491 | 3300018984 | Soil | VSCRGRRVPRGVKRKMSGYKLRPRTPQPTVRIDFAAA |
| Ga0190267_100190592 | 3300019767 | Soil | VPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRIVK |
| Ga0190267_106807042 | 3300019767 | Soil | VPDEILEERVSSSRCRQVPRGVKRKMSGYKLRPRAAQPSIRVDFAAAIRIVK |
| Ga0213882_101369151 | 3300021362 | Exposed Rock | RQVPRGVKRKMSGYPLRPRAPQPITRVDFTAAIRIVK |
| Ga0213881_100884762 | 3300021374 | Exposed Rock | GRQVPRGVKRKMSGYPLRPRTPQPITRVDFSAAIRIVK |
| Ga0213881_104351511 | 3300021374 | Exposed Rock | ERAVSGRGRQVPRGVKRKMSGYPLRPRAPQPITRVDFTAAIRIAK |
| Ga0213874_103027502 | 3300021377 | Plant Roots | RGRQVPRGVKRKMSGCPLRPRAPQPTIRVDFTAAIQIAK |
| Ga0213876_107429121 | 3300021384 | Plant Roots | RQVPRGVKRKMSSYPLRPFTPQPTTRIDFATAIRVLK |
| Ga0213875_106081711 | 3300021388 | Plant Roots | GRQVPRGIKRKMSGYNLRPRTPQPTILIDVVAAIRILK |
| Ga0212090_100183271 | 3300022561 | Glacier Valley | QVPRGVKRKMSGYPLRPRAPQPTTRIDVAAAIRIAK |
| Ga0212090_102782573 | 3300022561 | Glacier Valley | GRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIKIAK |
| Ga0212090_103026694 | 3300022561 | Glacier Valley | GRQVPRGVKRKMSGYPLRPRAPQPTTRIDVAAAIRIAK |
| Ga0247770_10575852 | 3300022891 | Plant Litter | VPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRILK |
| Ga0209082_10869881 | 3300025123 | Groundwater | SSRGRQVPRGVKRKMSNYPLRPRAPPPTTRLDFAAAIQLIK |
| Ga0207656_102119862 | 3300025321 | Corn Rhizosphere | GRRVPRGVKRKMSNYPLRPRAPQPTTRIDFTTAIRIVK |
| Ga0207656_102902512 | 3300025321 | Corn Rhizosphere | RGRQVPRGVKRKMSGYPLRPRTPLPTVRIDFTAAIKISK |
| Ga0207655_12430871 | 3300025728 | Miscanthus Rhizosphere | VVSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTAAIV |
| Ga0207688_102367492 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RQVPRGVKRKMSNYPLRPRAPQPITRIDYEAAIRVLK |
| Ga0207699_101560422 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SRGRRVPRGVKRKMSSYKLRPRVPQPTTRIDFAAAIRIVK |
| Ga0207645_101247502 | 3300025907 | Miscanthus Rhizosphere | RGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTVAIVIVK |
| Ga0207645_101333081 | 3300025907 | Miscanthus Rhizosphere | RGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTAAIVLVK |
| Ga0207684_110971092 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GRQVPRGIKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK |
| Ga0207695_108490172 | 3300025913 | Corn Rhizosphere | VPRGVKRKMSGYQLRPRTPQPTTRIDFAAAVRIIK |
| Ga0207649_115686862 | 3300025920 | Corn Rhizosphere | RRVPRGVKRKMSNYPLRPRASQPIIRIDFTAAIVLVK |
| Ga0207681_105069372 | 3300025923 | Switchgrass Rhizosphere | RGRQVPRGVKRKMSGYKLRPRVPQPTTWIDFAAAIRILK |
| Ga0207687_101379682 | 3300025927 | Miscanthus Rhizosphere | VSSRGRRVPRGVKRKMSSYPLRPRASQPIIRIDFTVAIVIVM |
| Ga0207687_106652212 | 3300025927 | Miscanthus Rhizosphere | RQVPRGVKRKMSNYPLRPRTPQPTTRIDFTAAIQIAK |
| Ga0207700_115086781 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GRRVPRGVKRKMSGYKLRPRCPQPTLRIDFAAAIRIVK |
| Ga0207700_115872652 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVPRGVKRKMSGYQLRPRTPQPTTRIDFAAAVRIVK |
| Ga0207679_101468193 | 3300025945 | Corn Rhizosphere | GRRVPRGVKRKMSNYPLRPRAPQPTTRIDFTTAIQIVK |
| Ga0207677_119179602 | 3300026023 | Miscanthus Rhizosphere | VSGRGRQVPRGVKRKMSSYPLRPRAPQPITRTDFATAIQIIK |
| Ga0207702_124021533 | 3300026078 | Corn Rhizosphere | GRRVPRAVKRKMSGYKLRSRSPQPTLRIDFAAAIRIVK |
| Ga0207674_104437891 | 3300026116 | Corn Rhizosphere | VSSRGRRVPRGVKRKMSNYPLRPRASQPIIRIDFTTAIQIVK |
| Ga0207674_108896763 | 3300026116 | Corn Rhizosphere | VSSRGRRVPRGVKRKMSNYPLRPRASQPIIRIDFTAAIVLVK |
| Ga0209152_104859392 | 3300026325 | Soil | VLAEILEERVASSRGRRVPRGVKRKMSGYQPRPRAPQPTTRIDFAAVSIVK |
| Ga0209152_105028022 | 3300026325 | Soil | EERAECGRGRQVPGGIKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK |
| Ga0209485_12417091 | 3300027691 | Agricultural Soil | ERVTSSRGRQVPRGVKRKMSGYPLRPRAPQPAARIDFVAAIRILK |
| Ga0209795_101973572 | 3300027718 | Agave | VVSGRGRQVPRGVKRKMSSYPLRPRAPQPTTRVDFNAAIRLA |
| Ga0209461_101460782 | 3300027750 | Agave | RVPRGVKRKMSSYPLRPRASQPIVRIDFATAVILVK |
| Ga0209481_105026393 | 3300027880 | Populus Rhizosphere | RRVPRGVKRKMSGYPLRPRAPQPTVRIDFTAAIRIIK |
| Ga0268266_112459651 | 3300028379 | Switchgrass Rhizosphere | GRQVPRGVKRKMSNYPLRPRTPPPTIRIDFTAAIQIAK |
| Ga0268264_105209961 | 3300028381 | Switchgrass Rhizosphere | RQVPRGIKRKMSNYPLRPRIPQPTTRIDFTAAIQIAK |
| Ga0247818_103876372 | 3300028589 | Soil | VPRGVKRKMSGYKLRPRVPQPTTWIDFAAVIRILK |
| Ga0307294_102200601 | 3300028810 | Soil | VPRGVKRKMSGYPLRPRTPLPTVRIDFTAAIKISK |
| Ga0268259_100181831 | 3300030499 | Agave | AVSGRGRRVPRGVKRKMSGYPLRPRAPQPTTRLEFNAAIRIAK |
| Ga0268253_100984021 | 3300030514 | Agave | VESRRGRRVPRGVKRKMSGYQLRPRTPQPIVRIDFAAAVRIVK |
| Ga0272436_100783714 | 3300030523 | Rock | GRQVPRGVKRKMSGYPLRPRAPQPITRIDFRAAIQIAK |
| Ga0272436_100912012 | 3300030523 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272436_10318063 | 3300030523 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272436_10460344 | 3300030523 | Rock | VPRGVKRKMSGYPLRPRTPQPTTWIDAAAAIRIAK |
| Ga0272436_10580721 | 3300030523 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRVDFRAAVRIAK |
| Ga0272436_10730594 | 3300030523 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272436_10731992 | 3300030523 | Rock | VPRGVKRKMSGYPLRPRTPQPTTRVDFRAAVRIAK |
| Ga0272436_10991782 | 3300030523 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRVDFRAAVRIAK |
| Ga0272436_11019261 | 3300030523 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRVDFRAAVRIEK |
| Ga0272436_11592141 | 3300030523 | Rock | ERAASSRGRQVPRGVKRKMSGYPLRLRTPQPTTRTDVAAAIRIAK |
| Ga0299913_118295902 | 3300031229 | Soil | VLAEILEERVASSSRGRRVPRGVKRKMSGYRLRPRTPQPTVRIDFTAAIRIVK |
| Ga0272435_10016831 | 3300031447 | Rock | VPRGVKRKMSGYPLRPRTPQPTTWIDVANAIRIVK |
| Ga0272435_10085359 | 3300031447 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272435_10244231 | 3300031447 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTWIDVANAIRIVK |
| Ga0272435_10250464 | 3300031447 | Rock | VPRGVKRKMSGYPLRPRAPQPTTWIDVAAAIRLAK |
| Ga0272435_10253613 | 3300031447 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTWIDVANAIRIVK |
| Ga0272435_10373181 | 3300031447 | Rock | QVPRGVKRKMSGYPLRPRAPQPTTWIDVAAAIRLAK |
| Ga0272435_10392491 | 3300031447 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRVDFNAAIRIAK |
| Ga0272438_10283574 | 3300031448 | Rock | SRGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVVAAIRIAK |
| Ga0272438_10576304 | 3300031448 | Rock | VLDEILEERVATSRGRQVPRGVKRKMSGSLLRPRTPQPTTWIDVAAIRIAK |
| Ga0272438_10827134 | 3300031448 | Rock | ASSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272438_11140162 | 3300031448 | Rock | MVARGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272438_12905651 | 3300031448 | Rock | VPRGVKRKMSGYPLRPRTPQPTKRIDLIATIQIAK |
| Ga0272429_12047301 | 3300031449 | Rock | RQVPRGVKRKMSGYPLRPRAPQPITRIDFRAAIQIAK |
| Ga0272433_100389111 | 3300031450 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTWIDVVAAIRIAK |
| Ga0272433_100467081 | 3300031450 | Rock | LDEILEERVASSRGRQVSRGDKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272433_101841541 | 3300031450 | Rock | SSRGRQVSRGVKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272433_101846642 | 3300031450 | Rock | QVPRGVKRKMSGYPLRPRTPQPTKRIDFIAAIQIAK |
| Ga0272433_101876971 | 3300031450 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTKRIDFIAAIQIAK |
| Ga0272433_102178262 | 3300031450 | Rock | RQVSRGVKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272433_103060112 | 3300031450 | Rock | RVASSRGRQVARGVKRKMSGYPLRPRTPQPTTWSDVTNAIRIVK |
| Ga0272433_103911271 | 3300031450 | Rock | GRQVSRGVKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272426_11450702 | 3300031451 | Rock | VSRGVKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272426_11532793 | 3300031451 | Rock | VPRGVKRKMSGYPLRPRTPQPTKRIDFIAAIQIAK |
| Ga0272426_12185991 | 3300031451 | Rock | ASSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIEK |
| Ga0272426_12252372 | 3300031451 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTWIDVVAAIRIAK |
| Ga0272422_10207478 | 3300031452 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272422_10319441 | 3300031452 | Rock | VPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272422_10494951 | 3300031452 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTWIDAAAAIRIAK |
| Ga0272422_10631225 | 3300031452 | Rock | EERVASSRGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272422_11140062 | 3300031452 | Rock | VPRGVKRKMSGYPLRPRTPQPTTWIDVAVAIRIAK |
| Ga0272422_11894151 | 3300031452 | Rock | SSRGRQVPRGVKRKMSSYPLRPRTLQPTMRINFTAAIRIAK |
| Ga0272425_10170936 | 3300031453 | Rock | RVASSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIAFSAAIRIAK |
| Ga0272425_10276231 | 3300031453 | Rock | ASSRGRQVPRGVRRKMSGYPLRPRTPQPITRINVAAAIPIAK |
| Ga0272425_10375031 | 3300031453 | Rock | GRQVPRGVKRKMSGYPLRPRTPQLTTWIDVAAAIRIAK |
| Ga0272427_10254337 | 3300031454 | Rock | RQVPRGVKRKMSGYPLRPRTPLPTLRIDFTATIKISK |
| Ga0272430_10506504 | 3300031460 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRITK |
| Ga0272430_11967601 | 3300031460 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272432_10368884 | 3300031470 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTWIDVVAAIRIAK |
| Ga0272432_10680641 | 3300031470 | Rock | PRGVKRKMSRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272432_11009961 | 3300031470 | Rock | ASSRGRQVSRGVKRKMSGYPLRPRTHQPTTRIDFSAAIRIAK |
| Ga0272432_11607952 | 3300031470 | Rock | VPRGVKRKMSGYPLRPRTPQPTTRIDFSTAIRIAK |
| Ga0272432_12573891 | 3300031470 | Rock | GRQVPRGVKRKMSGYPLRPRTPEPTTHIDFNAAIWITK |
| Ga0272439_10519264 | 3300031471 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPIMRIDFSAAIRIAK |
| Ga0272439_10595195 | 3300031471 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRIAFSAAIRIAK |
| Ga0272439_10877294 | 3300031471 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIAK |
| Ga0272439_11654891 | 3300031471 | Rock | QVPRGVKRKMSSYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272437_100119037 | 3300031472 | Rock | VPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIAK |
| Ga0272437_10083251 | 3300031472 | Rock | GRQVPRGVKRKMSGYPLRPRTSLPTTRIDFNAAIRIAK |
| Ga0272437_10329695 | 3300031472 | Rock | RQVPRGVKRKMSGYPLRPRTSLPTTRIDFNAAIRIAK |
| Ga0272437_10487274 | 3300031472 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTSIDFVAAIQIVK |
| Ga0272437_10610515 | 3300031472 | Rock | VPRGVKRKMSGYPLRPRTSLPTTRIDFNAAIRIAK |
| Ga0272437_10789765 | 3300031472 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIAK |
| Ga0272437_10835004 | 3300031472 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTSIDFVAAIQIVK |
| Ga0272437_11976462 | 3300031472 | Rock | ERVASSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272437_12134852 | 3300031472 | Rock | QVPRGVKRKMSGYPLRPRTSLPTTRIDFNAAIRIAK |
| Ga0272434_10328981 | 3300031473 | Rock | RGRQVPRGVKRKMSGYPLRPRTPQPTTRIDVAAAIRIAK |
| Ga0272434_10628414 | 3300031473 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAATIRIAK |
| Ga0272428_10130431 | 3300031520 | Rock | RVASSRGRQVPRGVKRKMSSYPLRPRTPQPTTRIDFSAAIRIVK |
| Ga0272428_10365565 | 3300031520 | Rock | RQVPRGVKRKMSSYPLRPRTPQPTTHIDFSAAIRIAK |
| Ga0272428_10390731 | 3300031520 | Rock | RGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272428_10583406 | 3300031520 | Rock | SSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIAK |
| Ga0272428_10688031 | 3300031520 | Rock | SSRGRQVPRGVKRKMSGYPLRPRIPQPTTRTDFKAAIRITK |
| Ga0272428_10963481 | 3300031520 | Rock | VPRGVKRKMSSYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272428_11196434 | 3300031520 | Rock | RVASSRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNVAIRIAK |
| Ga0272428_11421211 | 3300031520 | Rock | RVASSRGRQVPRGVKRKMSSYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272428_11516283 | 3300031520 | Rock | GGARGEFPGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272428_11520573 | 3300031520 | Rock | ASSRGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272428_11724994 | 3300031520 | Rock | VPRGVKRKMSGYPLRPRTPQPTTWVDVATAIKIAK |
| Ga0272428_11746712 | 3300031520 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAVRIAK |
| Ga0272428_13659792 | 3300031520 | Rock | QVPRGVKRKMSGYPLRPRTPQPTTRIDVSAAIRITK |
| Ga0307410_102095471 | 3300031852 | Rhizosphere | VPRGVKRKMSGYKLRRRVPQPTTWIDFAAAIRILK |
| Ga0307410_118300881 | 3300031852 | Rhizosphere | RRVPRGVKRKMSGYKLRPRTPQPTVRIDFTAAIRIVK |
| Ga0307407_116172441 | 3300031903 | Rhizosphere | VLDEILEERIASSRGRQVPRGVKRKMSNYKLRPRTSQPTIRIDFAAA |
| Ga0310891_100782811 | 3300031913 | Soil | VPRGVKRKMSGYKLRPRVPQTTTWIDFAAAIRILK |
| Ga0308175_1007092211 | 3300031938 | Soil | VPRGLKRKMSSYPLRPRTPQPTTRIDVTAAIQIVK |
| Ga0308175_1012668012 | 3300031938 | Soil | VLAEILEEHVPDSRGRRVPRGVERKMSGYKLRPRTPQPTVRIDLAAAIRIVK |
| Ga0308174_110722491 | 3300031939 | Soil | EERVASSRGRRVPRGVKRKMSGYQLRPRAPQPTVRIDFAAAIRIVK |
| Ga0307409_1002363381 | 3300031995 | Rhizosphere | MLEERAVSGRGRQVPRGVKRKMSTYPLRPRAPQPTTKIGFTTAIWIVK |
| Ga0307409_1007267903 | 3300031995 | Rhizosphere | GRQVPRGVKRKMSGYPLRPRAPQPTTRLDFNAAIQLAK |
| Ga0307409_1024047361 | 3300031995 | Rhizosphere | VPRGVKRKMSGYPLRPRAPQPTTRIDFAAAIRILK |
| Ga0307416_1035156821 | 3300032002 | Rhizosphere | QVPRGVKCKMSGYPLRPRASRPTVRVNFAAAVQIVK |
| Ga0307416_1036076631 | 3300032002 | Rhizosphere | GRQVPRGVKRKMSGYPLRPRAPQPAARIDFVAAIRILK |
| Ga0310906_103033052 | 3300032013 | Soil | VVSSRGRRVPRGVKRKMSNYPLRPRAPQPIIRIDFTAAIVLV |
| Ga0310906_103224971 | 3300032013 | Soil | GRQVPRGVKRKMSNYPLRPRAPQPITRIDYEAAIRVLK |
| Ga0272424_10116051 | 3300032162 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRIAK |
| Ga0272424_10493094 | 3300032162 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTRVDFNAAIRIAK |
| Ga0272424_11750733 | 3300032162 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPITRIDFSAAIRIAK |
| Ga0272423_100070543 | 3300033168 | Rock | RQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRITK |
| Ga0272423_10184611 | 3300033168 | Rock | SRGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272423_10313071 | 3300033168 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTTRIDFNAAIRITK |
| Ga0272423_10387561 | 3300033168 | Rock | RRVPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIKIAK |
| Ga0272423_10499194 | 3300033168 | Rock | VPRGVKRKMSGYPLRPRTPQPTTRIDFSAAIRIAK |
| Ga0272423_10736351 | 3300033168 | Rock | SRGRQVPRGVKRKMSGYPLRPRTPQPTTRIDFSAVIRIAK |
| Ga0272423_10880231 | 3300033168 | Rock | RQVPRRVKRKMSGYPLRPRTPQPTTWIDVAAAIRIAK |
| Ga0272423_10963175 | 3300033168 | Rock | RGRQVPRRVKRKMSGYPLRPRTPQPTTWIDVATAIRIAK |
| Ga0272423_11142633 | 3300033168 | Rock | RVASSRGRQVPRGVKRKMSGYPLRPRTPQPTTWIDVVAAIRIAK |
| Ga0272423_11156074 | 3300033168 | Rock | GRQVPRGVKRKMSGYPLRPRTPQPTKRIDLIATIQIAK |
| Ga0334930_065674_1_108 | 3300034005 | Sub-Biocrust Soil | VPRGVKRKMSGYPLRSRTPLPIVRIDFTAAIKISK |
| Ga0334930_078808_201_332 | 3300034005 | Sub-Biocrust Soil | VESRRGRRVPRGVKRKMSGYQLRSRTPQPTVRIDFTAAVRILT |
| Ga0334949_088271_1_147 | 3300034027 | Biocrust | ILEERAVSGRGRQVPRGVKRKMTSYPLRPRAPQPITRLDYTAAIRISK |
| Ga0334956_049738_1_126 | 3300034139 | Biocrust | MASSRGRQVPRGVKRKMSGYPLRPRTPLPAVRIDFTAAIRVT |
| Ga0334937_033871_1006_1164 | 3300034221 | Biocrust | VLAEILEERVESRRGRRVPRGVEREMSGYQLRPRIPRPTTRIDFTAAIQIVK |
| Ga0334938_014531_2_115 | 3300034236 | Biocrust | RQVPRGVKRKMSSYPLRPRAPQPTIRLDFNAAIQLAK |
| Ga0334938_083774_178_285 | 3300034236 | Biocrust | VPRGVKRKMSGYQLRPRSPQPTTRIDFTAAVRIVK |
| Ga0372943_0062854_1_126 | 3300034268 | Soil | GNRGRRVPRGVKRKMSGYKLRPRTPQPTVRIDFAAAIRIVK |
| Ga0372943_0093137_726_884 | 3300034268 | Soil | VLTELLEERVAGSRGRRVPRGLKRKMSGYKLRPRTPQPTDRVDFATAIRIVK |
| Ga0334917_032355_512_670 | 3300034391 | Hypolithic Biocrust | VLEEMLEERAVSGRGRQVPRGVKRKMSNYLLQPRAPRPITRIDFTAAVQIVK |
| Ga0334945_016719_1035_1154 | 3300034779 | Sub-Biocrust Soil | RGRRVPRGVKRKMSGYPLRPRAPQPTTRIDFTAAVRILK |
| ⦗Top⦘ |