


| Basic Information | |
|---|---|
| Family ID | F007772 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 345 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MCTKSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY |
| Number of Associated Samples | 232 |
| Number of Associated Scaffolds | 345 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 18.55 % |
| % of genes from short scaffolds (< 2000 bps) | 59.42 % |
| Associated GOLD sequencing projects | 203 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.913 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.435 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.797 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.870 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 345 Family Scaffolds |
|---|---|---|
| PF06941 | NT5C | 6.38 |
| PF00118 | Cpn60_TCP1 | 3.77 |
| PF14743 | DNA_ligase_OB_2 | 1.16 |
| PF00166 | Cpn10 | 0.87 |
| PF08291 | Peptidase_M15_3 | 0.58 |
| PF01068 | DNA_ligase_A_M | 0.58 |
| PF04404 | ERF | 0.58 |
| PF04542 | Sigma70_r2 | 0.58 |
| PF01391 | Collagen | 0.29 |
| PF05662 | YadA_stalk | 0.29 |
| PF02151 | UVR | 0.29 |
| PF12684 | DUF3799 | 0.29 |
| PF13619 | KTSC | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 345 Family Scaffolds |
|---|---|---|---|
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 6.38 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 3.77 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.58 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.58 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.58 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.91 % |
| All Organisms | root | All Organisms | 46.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090012|ASHM260b_contig00039 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1625 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10049558 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10108676 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10142195 | Not Available | 898 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10002512 | Not Available | 11583 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10033588 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300000118|TDF_OR_ARG05_123mDRAFT_c1007144 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300000118|TDF_OR_ARG05_123mDRAFT_c1016523 | Not Available | 607 | Open in IMG/M |
| 3300000121|TDF_OR_ARG04_113mDRAFT_c1001091 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 4229 | Open in IMG/M |
| 3300000121|TDF_OR_ARG04_113mDRAFT_c1019870 | Not Available | 792 | Open in IMG/M |
| 3300000121|TDF_OR_ARG04_113mDRAFT_c1038379 | Not Available | 566 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10037643 | All Organisms → Viruses → Predicted Viral | 1904 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10051897 | Not Available | 1688 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1001715 | All Organisms → Viruses → environmental samples → uncultured virus | 3643 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1020163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 531 | Open in IMG/M |
| 3300001344|JGI20152J14361_10054788 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300001344|JGI20152J14361_10089368 | Not Available | 643 | Open in IMG/M |
| 3300001348|JGI20154J14316_10178257 | Not Available | 541 | Open in IMG/M |
| 3300001349|JGI20160J14292_10056746 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
| 3300001349|JGI20160J14292_10061034 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300001349|JGI20160J14292_10063147 | All Organisms → Viruses → Predicted Viral | 1553 | Open in IMG/M |
| 3300001349|JGI20160J14292_10081778 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300001351|JGI20153J14318_10045705 | All Organisms → Viruses → Predicted Viral | 1658 | Open in IMG/M |
| 3300001352|JGI20157J14317_10087248 | Not Available | 1187 | Open in IMG/M |
| 3300001352|JGI20157J14317_10091564 | Not Available | 1135 | Open in IMG/M |
| 3300001352|JGI20157J14317_10214569 | Not Available | 540 | Open in IMG/M |
| 3300001450|JGI24006J15134_10016584 | All Organisms → Viruses → Predicted Viral | 3465 | Open in IMG/M |
| 3300001450|JGI24006J15134_10093001 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300001450|JGI24006J15134_10149691 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 766 | Open in IMG/M |
| 3300001450|JGI24006J15134_10192144 | Not Available | 630 | Open in IMG/M |
| 3300001450|JGI24006J15134_10193559 | Not Available | 626 | Open in IMG/M |
| 3300001450|JGI24006J15134_10200616 | Not Available | 609 | Open in IMG/M |
| 3300001450|JGI24006J15134_10237738 | Not Available | 531 | Open in IMG/M |
| 3300001460|JGI24003J15210_10015168 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3024 | Open in IMG/M |
| 3300001460|JGI24003J15210_10122506 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300001460|JGI24003J15210_10134542 | Not Available | 655 | Open in IMG/M |
| 3300001460|JGI24003J15210_10153627 | Not Available | 586 | Open in IMG/M |
| 3300001472|JGI24004J15324_10085542 | Not Available | 843 | Open in IMG/M |
| 3300001472|JGI24004J15324_10162353 | Not Available | 505 | Open in IMG/M |
| 3300001589|JGI24005J15628_10139659 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 751 | Open in IMG/M |
| 3300001589|JGI24005J15628_10183254 | Not Available | 602 | Open in IMG/M |
| 3300001685|JGI24024J18818_10118215 | Not Available | 826 | Open in IMG/M |
| 3300001718|JGI24523J20078_1001555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4140 | Open in IMG/M |
| 3300001941|GOS2219_1005231 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300001947|GOS2218_1026346 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300001965|GOS2243_1036371 | Not Available | 1635 | Open in IMG/M |
| 3300001965|GOS2243_1068206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1750 | Open in IMG/M |
| 3300002153|JGI24540J26637_10054197 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300002153|JGI24540J26637_10070913 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300002153|JGI24540J26637_10131600 | Not Available | 675 | Open in IMG/M |
| 3300002482|JGI25127J35165_1093296 | Not Available | 611 | Open in IMG/M |
| 3300002483|JGI25132J35274_1041605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1014 | Open in IMG/M |
| 3300002483|JGI25132J35274_1055690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 847 | Open in IMG/M |
| 3300002488|JGI25128J35275_1004365 | All Organisms → cellular organisms → Bacteria | 3934 | Open in IMG/M |
| 3300002488|JGI25128J35275_1114484 | Not Available | 539 | Open in IMG/M |
| 3300002514|JGI25133J35611_10133329 | Not Available | 696 | Open in IMG/M |
| 3300003145|Ga0052243_1008461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1110 | Open in IMG/M |
| 3300003216|JGI26079J46598_1013528 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
| 3300003346|JGI26081J50195_1013666 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300003346|JGI26081J50195_1056320 | Not Available | 782 | Open in IMG/M |
| 3300003540|FS896DNA_10233061 | Not Available | 716 | Open in IMG/M |
| 3300003878|Ga0063282_1014805 | Not Available | 731 | Open in IMG/M |
| 3300004279|Ga0066605_10375452 | Not Available | 513 | Open in IMG/M |
| 3300004448|Ga0065861_1008908 | Not Available | 9644 | Open in IMG/M |
| 3300004448|Ga0065861_1010469 | All Organisms → Viruses → Predicted Viral | 2464 | Open in IMG/M |
| 3300004457|Ga0066224_1000557 | Not Available | 589 | Open in IMG/M |
| 3300004457|Ga0066224_1010102 | All Organisms → Viruses → Predicted Viral | 3980 | Open in IMG/M |
| 3300004460|Ga0066222_1014420 | Not Available | 550 | Open in IMG/M |
| 3300004461|Ga0066223_1005552 | Not Available | 746 | Open in IMG/M |
| 3300005239|Ga0073579_1105531 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300005239|Ga0073579_1644994 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 887 | Open in IMG/M |
| 3300005433|Ga0066830_10020414 | Not Available | 1299 | Open in IMG/M |
| 3300005433|Ga0066830_10033709 | Not Available | 1030 | Open in IMG/M |
| 3300005433|Ga0066830_10123450 | Not Available | 557 | Open in IMG/M |
| 3300005433|Ga0066830_10129234 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 545 | Open in IMG/M |
| 3300005588|Ga0070728_10399701 | Not Available | 729 | Open in IMG/M |
| 3300005589|Ga0070729_10183139 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1222 | Open in IMG/M |
| 3300005595|Ga0066833_10062169 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300005600|Ga0070726_10526537 | Not Available | 596 | Open in IMG/M |
| 3300005609|Ga0070724_10183765 | Not Available | 907 | Open in IMG/M |
| 3300005609|Ga0070724_10462602 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 565 | Open in IMG/M |
| 3300005731|Ga0076919_1051574 | Not Available | 777 | Open in IMG/M |
| 3300005747|Ga0076924_1013218 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2066 | Open in IMG/M |
| 3300005825|Ga0074476_1379388 | All Organisms → Viruses → Predicted Viral | 2226 | Open in IMG/M |
| 3300005837|Ga0078893_11415032 | All Organisms → cellular organisms → Bacteria | 4800 | Open in IMG/M |
| 3300005920|Ga0070725_10276284 | Not Available | 737 | Open in IMG/M |
| 3300005942|Ga0070742_10122367 | Not Available | 721 | Open in IMG/M |
| 3300006165|Ga0075443_10159686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 797 | Open in IMG/M |
| 3300006191|Ga0075447_10210430 | Not Available | 637 | Open in IMG/M |
| 3300006193|Ga0075445_10122501 | Not Available | 952 | Open in IMG/M |
| 3300006467|Ga0099972_10630893 | Not Available | 570 | Open in IMG/M |
| 3300006467|Ga0099972_11324556 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 991 | Open in IMG/M |
| 3300006467|Ga0099972_11886541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 944 | Open in IMG/M |
| 3300006484|Ga0070744_10001620 | All Organisms → cellular organisms → Bacteria | 6757 | Open in IMG/M |
| 3300006484|Ga0070744_10085535 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 914 | Open in IMG/M |
| 3300006484|Ga0070744_10189868 | Not Available | 585 | Open in IMG/M |
| 3300006734|Ga0098073_1005553 | Not Available | 2542 | Open in IMG/M |
| 3300006735|Ga0098038_1010520 | All Organisms → cellular organisms → Archaea | 3629 | Open in IMG/M |
| 3300006735|Ga0098038_1016633 | Not Available | 2835 | Open in IMG/M |
| 3300006735|Ga0098038_1022784 | All Organisms → Viruses → Predicted Viral | 2375 | Open in IMG/M |
| 3300006735|Ga0098038_1043709 | Not Available | 1634 | Open in IMG/M |
| 3300006735|Ga0098038_1086647 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1092 | Open in IMG/M |
| 3300006735|Ga0098038_1122405 | Not Available | 883 | Open in IMG/M |
| 3300006735|Ga0098038_1226649 | Not Available | 597 | Open in IMG/M |
| 3300006735|Ga0098038_1248160 | Not Available | 563 | Open in IMG/M |
| 3300006737|Ga0098037_1001037 | Not Available | 12993 | Open in IMG/M |
| 3300006737|Ga0098037_1011090 | All Organisms → cellular organisms → Archaea | 3489 | Open in IMG/M |
| 3300006737|Ga0098037_1135956 | Not Available | 832 | Open in IMG/M |
| 3300006737|Ga0098037_1189983 | Not Available | 675 | Open in IMG/M |
| 3300006738|Ga0098035_1245784 | Not Available | 590 | Open in IMG/M |
| 3300006749|Ga0098042_1000768 | Not Available | 12329 | Open in IMG/M |
| 3300006749|Ga0098042_1101479 | Not Available | 729 | Open in IMG/M |
| 3300006749|Ga0098042_1106073 | Not Available | 709 | Open in IMG/M |
| 3300006749|Ga0098042_1144272 | Not Available | 585 | Open in IMG/M |
| 3300006750|Ga0098058_1033993 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1473 | Open in IMG/M |
| 3300006752|Ga0098048_1003977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5910 | Open in IMG/M |
| 3300006752|Ga0098048_1015237 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
| 3300006752|Ga0098048_1036439 | All Organisms → Viruses → Predicted Viral | 1585 | Open in IMG/M |
| 3300006789|Ga0098054_1200167 | Not Available | 728 | Open in IMG/M |
| 3300006789|Ga0098054_1232990 | Not Available | 667 | Open in IMG/M |
| 3300006810|Ga0070754_10100260 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1432 | Open in IMG/M |
| 3300006810|Ga0070754_10115213 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300006919|Ga0070746_10065762 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300006925|Ga0098050_1072874 | Not Available | 888 | Open in IMG/M |
| 3300006928|Ga0098041_1132958 | Not Available | 802 | Open in IMG/M |
| 3300006947|Ga0075444_10249337 | Not Available | 699 | Open in IMG/M |
| 3300006990|Ga0098046_1009389 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300006990|Ga0098046_1011459 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300006990|Ga0098046_1046421 | Not Available | 1024 | Open in IMG/M |
| 3300007344|Ga0070745_1200020 | Not Available | 738 | Open in IMG/M |
| 3300007539|Ga0099849_1044652 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1861 | Open in IMG/M |
| 3300007540|Ga0099847_1001084 | Not Available | 9442 | Open in IMG/M |
| 3300007555|Ga0102817_1000472 | Not Available | 11413 | Open in IMG/M |
| 3300007864|Ga0105749_1002266 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2848 | Open in IMG/M |
| 3300008470|Ga0115371_10202362 | Not Available | 645 | Open in IMG/M |
| 3300009002|Ga0102810_1053829 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1288 | Open in IMG/M |
| 3300009026|Ga0102829_1166636 | Not Available | 708 | Open in IMG/M |
| 3300009034|Ga0115863_1200596 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300009074|Ga0115549_1050909 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300009132|Ga0118730_1208659 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1134 | Open in IMG/M |
| 3300009149|Ga0114918_10038093 | All Organisms → Viruses → Predicted Viral | 3349 | Open in IMG/M |
| 3300009172|Ga0114995_10140663 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300009428|Ga0114915_1206288 | Not Available | 539 | Open in IMG/M |
| 3300009434|Ga0115562_1056609 | Not Available | 1707 | Open in IMG/M |
| 3300009438|Ga0115559_1054598 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
| 3300009442|Ga0115563_1034894 | All Organisms → Viruses → Predicted Viral | 2543 | Open in IMG/M |
| 3300009467|Ga0115565_10225128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 861 | Open in IMG/M |
| 3300009496|Ga0115570_10434262 | Not Available | 556 | Open in IMG/M |
| 3300009526|Ga0115004_10307153 | Not Available | 941 | Open in IMG/M |
| 3300009529|Ga0114919_10113027 | Not Available | 1969 | Open in IMG/M |
| 3300009544|Ga0115006_11362784 | Not Available | 638 | Open in IMG/M |
| 3300009785|Ga0115001_10222748 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300010153|Ga0098059_1245169 | Not Available | 691 | Open in IMG/M |
| 3300010413|Ga0136851_11142116 | Not Available | 755 | Open in IMG/M |
| 3300010430|Ga0118733_100968138 | All Organisms → Viruses → Predicted Viral | 1699 | Open in IMG/M |
| 3300010932|Ga0137843_1005338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2386 | Open in IMG/M |
| 3300011128|Ga0151669_100255 | Not Available | 20495 | Open in IMG/M |
| 3300011254|Ga0151675_1002682 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2234 | Open in IMG/M |
| 3300011256|Ga0151664_1030787 | Not Available | 611 | Open in IMG/M |
| 3300011256|Ga0151664_1037168 | Not Available | 861 | Open in IMG/M |
| 3300011261|Ga0151661_1028566 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 693 | Open in IMG/M |
| 3300012952|Ga0163180_10435827 | Not Available | 966 | Open in IMG/M |
| 3300012953|Ga0163179_10171771 | All Organisms → cellular organisms → Archaea | 1638 | Open in IMG/M |
| 3300012953|Ga0163179_11548585 | Not Available | 598 | Open in IMG/M |
| 3300012954|Ga0163111_10138978 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2042 | Open in IMG/M |
| 3300013098|Ga0164320_10033715 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2034 | Open in IMG/M |
| 3300013098|Ga0164320_10166765 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300013099|Ga0164315_11112520 | Not Available | 625 | Open in IMG/M |
| 3300013101|Ga0164313_10072155 | All Organisms → Viruses → Predicted Viral | 2905 | Open in IMG/M |
| 3300013101|Ga0164313_10095720 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300013101|Ga0164313_10880166 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 732 | Open in IMG/M |
| 3300013101|Ga0164313_11160221 | Not Available | 626 | Open in IMG/M |
| 3300013103|Ga0164318_10067365 | Not Available | 3347 | Open in IMG/M |
| 3300014903|Ga0164321_10061665 | Not Available | 1459 | Open in IMG/M |
| 3300017706|Ga0181377_1005188 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300017709|Ga0181387_1006512 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300017713|Ga0181391_1004422 | All Organisms → Viruses → Predicted Viral | 3829 | Open in IMG/M |
| 3300017714|Ga0181412_1005754 | All Organisms → cellular organisms → Bacteria | 4038 | Open in IMG/M |
| 3300017719|Ga0181390_1022405 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300017719|Ga0181390_1105471 | Not Available | 749 | Open in IMG/M |
| 3300017721|Ga0181373_1001603 | Not Available | 4467 | Open in IMG/M |
| 3300017721|Ga0181373_1069856 | Not Available | 627 | Open in IMG/M |
| 3300017727|Ga0181401_1001893 | Not Available | 7945 | Open in IMG/M |
| 3300017727|Ga0181401_1008107 | All Organisms → Viruses → Predicted Viral | 3447 | Open in IMG/M |
| 3300017727|Ga0181401_1012246 | All Organisms → cellular organisms → Archaea | 2681 | Open in IMG/M |
| 3300017727|Ga0181401_1023877 | All Organisms → Viruses → Predicted Viral | 1802 | Open in IMG/M |
| 3300017728|Ga0181419_1003747 | Not Available | 4842 | Open in IMG/M |
| 3300017731|Ga0181416_1001795 | Not Available | 5342 | Open in IMG/M |
| 3300017738|Ga0181428_1030811 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300017740|Ga0181418_1007009 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
| 3300017740|Ga0181418_1148198 | Not Available | 564 | Open in IMG/M |
| 3300017741|Ga0181421_1029678 | Not Available | 1481 | Open in IMG/M |
| 3300017743|Ga0181402_1053207 | Not Available | 1089 | Open in IMG/M |
| 3300017746|Ga0181389_1005312 | All Organisms → Viruses → Predicted Viral | 4545 | Open in IMG/M |
| 3300017748|Ga0181393_1050258 | Not Available | 1140 | Open in IMG/M |
| 3300017749|Ga0181392_1006038 | Not Available | 4140 | Open in IMG/M |
| 3300017749|Ga0181392_1066115 | Not Available | 1098 | Open in IMG/M |
| 3300017760|Ga0181408_1076945 | Not Available | 876 | Open in IMG/M |
| 3300017763|Ga0181410_1033569 | Not Available | 1634 | Open in IMG/M |
| 3300017763|Ga0181410_1099072 | Not Available | 846 | Open in IMG/M |
| 3300017764|Ga0181385_1011623 | Not Available | 2830 | Open in IMG/M |
| 3300017768|Ga0187220_1017354 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2164 | Open in IMG/M |
| 3300017773|Ga0181386_1101604 | Not Available | 896 | Open in IMG/M |
| 3300017951|Ga0181577_10703801 | Not Available | 615 | Open in IMG/M |
| 3300017963|Ga0180437_10862762 | Not Available | 651 | Open in IMG/M |
| 3300017991|Ga0180434_10047078 | All Organisms → Viruses → Predicted Viral | 3869 | Open in IMG/M |
| 3300018418|Ga0181567_10425568 | Not Available | 877 | Open in IMG/M |
| 3300018421|Ga0181592_10514743 | Not Available | 825 | Open in IMG/M |
| 3300018980|Ga0192961_10110807 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300019737|Ga0193973_1033527 | Not Available | 642 | Open in IMG/M |
| 3300020165|Ga0206125_10013307 | Not Available | 5507 | Open in IMG/M |
| 3300020165|Ga0206125_10082070 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300020165|Ga0206125_10125472 | Not Available | 1056 | Open in IMG/M |
| 3300020166|Ga0206128_1066974 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300020166|Ga0206128_1092573 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300020169|Ga0206127_1048897 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2167 | Open in IMG/M |
| 3300020187|Ga0206130_10037401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3718 | Open in IMG/M |
| 3300020235|Ga0212228_1405237 | Not Available | 5715 | Open in IMG/M |
| 3300020274|Ga0211658_1012344 | Not Available | 2016 | Open in IMG/M |
| 3300020347|Ga0211504_1009442 | All Organisms → Viruses → Predicted Viral | 2997 | Open in IMG/M |
| 3300020347|Ga0211504_1025997 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300020352|Ga0211505_1001212 | Not Available | 8311 | Open in IMG/M |
| 3300020352|Ga0211505_1002709 | All Organisms → cellular organisms → Bacteria | 5271 | Open in IMG/M |
| 3300020396|Ga0211687_10018847 | Not Available | 3569 | Open in IMG/M |
| 3300020404|Ga0211659_10048729 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300020419|Ga0211512_10068135 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300020442|Ga0211559_10005790 | Not Available | 6655 | Open in IMG/M |
| 3300020452|Ga0211545_10055292 | Not Available | 1909 | Open in IMG/M |
| 3300020457|Ga0211643_10050955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2066 | Open in IMG/M |
| 3300020469|Ga0211577_10004065 | Not Available | 12934 | Open in IMG/M |
| 3300021084|Ga0206678_10031997 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2903 | Open in IMG/M |
| 3300021085|Ga0206677_10001709 | Not Available | 20097 | Open in IMG/M |
| 3300021364|Ga0213859_10010582 | Not Available | 4185 | Open in IMG/M |
| 3300021365|Ga0206123_10003533 | Not Available | 12846 | Open in IMG/M |
| 3300021368|Ga0213860_10191355 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 901 | Open in IMG/M |
| 3300021375|Ga0213869_10184831 | Not Available | 949 | Open in IMG/M |
| 3300021378|Ga0213861_10114823 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| 3300021389|Ga0213868_10039048 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 3421 | Open in IMG/M |
| 3300021389|Ga0213868_10201732 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1192 | Open in IMG/M |
| 3300021504|Ga0190344_1055707 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 795 | Open in IMG/M |
| 3300021957|Ga0222717_10002364 | Not Available | 14655 | Open in IMG/M |
| 3300021957|Ga0222717_10013159 | Not Available | 5691 | Open in IMG/M |
| 3300021957|Ga0222717_10035348 | All Organisms → Viruses → Predicted Viral | 3290 | Open in IMG/M |
| 3300021957|Ga0222717_10125182 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1587 | Open in IMG/M |
| 3300021957|Ga0222717_10291565 | Not Available | 934 | Open in IMG/M |
| 3300022169|Ga0196903_1000526 | Not Available | 5715 | Open in IMG/M |
| 3300022169|Ga0196903_1024276 | Not Available | 727 | Open in IMG/M |
| 3300022178|Ga0196887_1030437 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300022217|Ga0224514_10035199 | Not Available | 1655 | Open in IMG/M |
| 3300022306|Ga0224509_10041736 | Not Available | 1537 | Open in IMG/M |
| 3300022934|Ga0255781_10247921 | Not Available | 840 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10038419 | Not Available | 3165 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10086476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 997 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10059800 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1560 | Open in IMG/M |
| 3300023674|Ga0228697_106039 | Not Available | 1133 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10003923 | All Organisms → Viruses → Predicted Viral | 4659 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10031124 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
| 3300024185|Ga0228669_1006482 | All Organisms → Viruses → Predicted Viral | 3281 | Open in IMG/M |
| 3300024229|Ga0233402_1003626 | Not Available | 4188 | Open in IMG/M |
| 3300024229|Ga0233402_1105123 | Not Available | 586 | Open in IMG/M |
| 3300024231|Ga0233399_1045989 | Not Available | 1167 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10039457 | All Organisms → Viruses → Predicted Viral | 2521 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10127227 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300024262|Ga0210003_1002931 | Not Available | 14132 | Open in IMG/M |
| 3300024262|Ga0210003_1164975 | Not Available | 937 | Open in IMG/M |
| 3300024346|Ga0244775_10114079 | All Organisms → Viruses → Predicted Viral | 2292 | Open in IMG/M |
| 3300024346|Ga0244775_10254689 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10007558 | Not Available | 5907 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10108313 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300025057|Ga0208018_100131 | Not Available | 26133 | Open in IMG/M |
| 3300025071|Ga0207896_1000783 | Not Available | 6343 | Open in IMG/M |
| 3300025072|Ga0208920_1004028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 3506 | Open in IMG/M |
| 3300025083|Ga0208791_1003411 | All Organisms → Viruses → Predicted Viral | 4869 | Open in IMG/M |
| 3300025086|Ga0208157_1002381 | Not Available | 7873 | Open in IMG/M |
| 3300025086|Ga0208157_1002397 | Not Available | 7838 | Open in IMG/M |
| 3300025086|Ga0208157_1008945 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 3300025086|Ga0208157_1041495 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1276 | Open in IMG/M |
| 3300025098|Ga0208434_1006542 | Not Available | 3551 | Open in IMG/M |
| 3300025099|Ga0208669_1003435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 5208 | Open in IMG/M |
| 3300025101|Ga0208159_1000787 | Not Available | 12300 | Open in IMG/M |
| 3300025101|Ga0208159_1002446 | Not Available | 6461 | Open in IMG/M |
| 3300025101|Ga0208159_1069515 | Not Available | 685 | Open in IMG/M |
| 3300025102|Ga0208666_1020080 | All Organisms → Viruses → Predicted Viral | 2123 | Open in IMG/M |
| 3300025110|Ga0208158_1112074 | Not Available | 636 | Open in IMG/M |
| 3300025120|Ga0209535_1003017 | Not Available | 10882 | Open in IMG/M |
| 3300025120|Ga0209535_1025709 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2876 | Open in IMG/M |
| 3300025127|Ga0209348_1000064 | Not Available | 64561 | Open in IMG/M |
| 3300025127|Ga0209348_1002408 | Not Available | 8838 | Open in IMG/M |
| 3300025127|Ga0209348_1051639 | Not Available | 1385 | Open in IMG/M |
| 3300025131|Ga0209128_1042350 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
| 3300025132|Ga0209232_1028270 | All Organisms → Viruses → Predicted Viral | 2158 | Open in IMG/M |
| 3300025132|Ga0209232_1038998 | Not Available | 1784 | Open in IMG/M |
| 3300025137|Ga0209336_10013184 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3176 | Open in IMG/M |
| 3300025137|Ga0209336_10117781 | Not Available | 731 | Open in IMG/M |
| 3300025138|Ga0209634_1010335 | Not Available | 5652 | Open in IMG/M |
| 3300025138|Ga0209634_1048119 | Not Available | 2123 | Open in IMG/M |
| 3300025138|Ga0209634_1052919 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300025141|Ga0209756_1030889 | Not Available | 2881 | Open in IMG/M |
| 3300025141|Ga0209756_1062127 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
| 3300025151|Ga0209645_1003467 | Not Available | 7186 | Open in IMG/M |
| 3300025151|Ga0209645_1124225 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 815 | Open in IMG/M |
| 3300025168|Ga0209337_1013775 | All Organisms → Viruses → Predicted Viral | 4963 | Open in IMG/M |
| 3300025168|Ga0209337_1067132 | All Organisms → Viruses → Predicted Viral | 1789 | Open in IMG/M |
| 3300025276|Ga0208814_1020756 | All Organisms → Viruses → Predicted Viral | 2196 | Open in IMG/M |
| 3300025543|Ga0208303_1006757 | All Organisms → Viruses → Predicted Viral | 3789 | Open in IMG/M |
| 3300025620|Ga0209405_1003326 | Not Available | 9824 | Open in IMG/M |
| 3300025620|Ga0209405_1024664 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300025626|Ga0209716_1007838 | Not Available | 5311 | Open in IMG/M |
| 3300025626|Ga0209716_1020090 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300025641|Ga0209833_1002327 | Not Available | 11541 | Open in IMG/M |
| 3300025671|Ga0208898_1014031 | All Organisms → Viruses → Predicted Viral | 3825 | Open in IMG/M |
| 3300025809|Ga0209199_1015216 | Not Available | 5203 | Open in IMG/M |
| 3300025809|Ga0209199_1034135 | Not Available | 2802 | Open in IMG/M |
| 3300026390|Ga0247558_100266 | All Organisms → Viruses → Predicted Viral | 3224 | Open in IMG/M |
| 3300026403|Ga0247557_1012753 | Not Available | 934 | Open in IMG/M |
| 3300026458|Ga0247578_1001002 | Not Available | 3627 | Open in IMG/M |
| 3300026461|Ga0247600_1001196 | Not Available | 3600 | Open in IMG/M |
| 3300027188|Ga0208921_1006426 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300027320|Ga0208923_1039355 | Not Available | 843 | Open in IMG/M |
| 3300027506|Ga0208973_1129543 | Not Available | 538 | Open in IMG/M |
| 3300027668|Ga0209482_1023515 | All Organisms → Viruses → Predicted Viral | 2606 | Open in IMG/M |
| 3300027668|Ga0209482_1026702 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300027753|Ga0208305_10004053 | Not Available | 6511 | Open in IMG/M |
| 3300027753|Ga0208305_10007978 | Not Available | 4530 | Open in IMG/M |
| 3300027833|Ga0209092_10057536 | Not Available | 2387 | Open in IMG/M |
| 3300027859|Ga0209503_10005576 | Not Available | 5720 | Open in IMG/M |
| 3300027859|Ga0209503_10013693 | All Organisms → Viruses → Predicted Viral | 3594 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10373577 | Not Available | 698 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10073272 | Not Available | 1350 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10290037 | Not Available | 702 | Open in IMG/M |
| 3300028109|Ga0247582_1000753 | Not Available | 5413 | Open in IMG/M |
| 3300028135|Ga0228606_1082905 | Not Available | 832 | Open in IMG/M |
| 3300028197|Ga0257110_1014281 | All Organisms → Viruses → Predicted Viral | 3542 | Open in IMG/M |
| 3300028282|Ga0256413_1142948 | Not Available | 868 | Open in IMG/M |
| 3300028338|Ga0247567_1090663 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031539|Ga0307380_11116889 | Not Available | 618 | Open in IMG/M |
| 3300031569|Ga0307489_10024303 | All Organisms → Viruses → Predicted Viral | 3378 | Open in IMG/M |
| 3300031622|Ga0302126_10035928 | All Organisms → Viruses → Predicted Viral | 2153 | Open in IMG/M |
| 3300031673|Ga0307377_10667932 | Not Available | 734 | Open in IMG/M |
| 3300031687|Ga0308008_1125697 | Not Available | 595 | Open in IMG/M |
| 3300031687|Ga0308008_1169570 | Not Available | 505 | Open in IMG/M |
| 3300031766|Ga0315322_10028768 | Not Available | 4148 | Open in IMG/M |
| 3300032073|Ga0315315_10009129 | Not Available | 9133 | Open in IMG/M |
| 3300032073|Ga0315315_10023037 | Not Available | 5772 | Open in IMG/M |
| 3300032073|Ga0315315_10170135 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.12% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.80% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.51% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.77% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.19% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.19% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.32% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.32% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.03% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.03% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.03% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.45% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.16% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.16% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.16% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.87% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.58% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.58% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.58% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.29% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.29% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.29% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.29% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.29% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.29% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.29% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.29% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.29% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.29% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.29% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.29% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.29% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.29% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.29% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.29% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.29% |
| Subsea Pool | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090012 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-236-260cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001941 | Marine microbial communities from Browns Bank, Gulf of Maine - GS003 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300003145 | Marine sediment microbial communities from deep subseafloor - Sample from 0.8 mbsf | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003878 | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagen | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010932 | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020235 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021504 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-2-3_MG | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023674 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300026390 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026403 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026458 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026461 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASHM260b_02185450 | 2088090012 | Coastal Water And Sediment | MATQSYQLLKISWNLYDTHYTKLTEEQRSKVWDIYYDFY |
| DelMOSum2010_100495585 | 3300000101 | Marine | MSTFSYTLLKISWNLYDKHYTKLTDEQKSKVMDIYYDFY* |
| DelMOSum2010_101086764 | 3300000101 | Marine | MSTKSYTLLKISWNLFDKHFTELTEKQKSKVLDIYYDFY* |
| DelMOSum2010_101421951 | 3300000101 | Marine | MCTKSYTLLKISWNLFDTDFDKLTDKQKSKVIDIYYDFY* |
| DelMOSum2011_1000251218 | 3300000115 | Marine | MSTFSYTLLKISLRVYKTHWLDLNDEQKSEVLDIYYNFC* |
| DelMOSum2011_100335884 | 3300000115 | Marine | MSTFSYTLLKISWRLYDKHYTKLTDEQKSHVLDIYYDFY* |
| TDF_OR_ARG05_123mDRAFT_10071443 | 3300000118 | Marine | MATKSYTLLKIARRIFKKDFPELTSEQKSEVLDIYYDFY* |
| TDF_OR_ARG05_123mDRAFT_10165232 | 3300000118 | Marine | MSTKSYTLLKISWRLFDKHFTELTDKQKSEVIDVYDDFY* |
| TDF_OR_ARG04_113mDRAFT_10010913 | 3300000121 | Marine | MANKSYTLLKIARRIFKKDFPELTSEQKSEVLDIYYDFY* |
| TDF_OR_ARG04_113mDRAFT_10198704 | 3300000121 | Marine | MATKSYTLLKISWNLFDKHFTELTDKQKSKVLDIYDDFY* |
| TDF_OR_ARG04_113mDRAFT_10383793 | 3300000121 | Marine | MATQSYQLLKISWNLFDKHYTKLTADERSKVWDIYYDFY* |
| SA_S1_NOR08_45mDRAFT_100376436 | 3300000128 | Marine | MATQSYQLLKISWNLYDTHFTELTEEQKSKVIDIYYDFY* |
| SA_S2_NOR15_50mDRAFT_100518973 | 3300000130 | Marine | MATQSYQLLKISWNLFDKHYTKLTVDERSKVWDIYYDFY* |
| LPaug09P1610mDRAFT_10017155 | 3300000149 | Marine | MSNFSWTLLKISLRVYKTHWLDLNDEQKSKVLDIYYDFY* |
| LPjun09P1210mDRAFT_10201631 | 3300000168 | Marine | MSNKSYTLLKISWRIFKEDYWKLTDEQKSEVLDIYDDFY* |
| JGI20152J14361_100547882 | 3300001344 | Pelagic Marine | MCNKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY* |
| JGI20152J14361_100893683 | 3300001344 | Pelagic Marine | MCTKSYTLLKISRRVFKKEFPELTSEEKSQVLDIYYDFY* |
| JGI20154J14316_101782572 | 3300001348 | Pelagic Marine | MATKSYALLKISRNLFKKDFTDLTSEQKSQVINIYYDFY* |
| JGI20160J14292_100567462 | 3300001349 | Pelagic Marine | MCTKSYTLLKISWRXYDKHYTKLTDXQKSNVLDIYYDFY* |
| JGI20160J14292_100610344 | 3300001349 | Pelagic Marine | MCTKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY* |
| JGI20160J14292_100631476 | 3300001349 | Pelagic Marine | MATKSYQLLKISWNLYDTHFTKLTDEQKSKVIDIYYDFY* |
| JGI20160J14292_100817787 | 3300001349 | Pelagic Marine | MCTKSYTLLKISWNLFDKHYTKLTDKQKSKVIDIYYDFY* |
| JGI20153J14318_100457057 | 3300001351 | Pelagic Marine | MCTKSYTLLKISWNLFDKHYTKLTEEQKSKVIDIYYDFY* |
| JGI20157J14317_100872482 | 3300001352 | Pelagic Marine | MCTKSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY* |
| JGI20157J14317_100915646 | 3300001352 | Pelagic Marine | MSTKSYQLLKISWNLYDTHFTKLTEEQKSKVWDIYYDFY* |
| JGI20157J14317_102145691 | 3300001352 | Pelagic Marine | MATKSYALLKISRNLFKKDFTDLTPEQKSKVIDIYYDFY* |
| JGI24006J15134_1001658413 | 3300001450 | Marine | MSTFSYTLLKISWNLYDKHYTKLTEEQKSKVMDIYYDFY* |
| JGI24006J15134_100930011 | 3300001450 | Marine | MSNKSYTLLKISLRVFKKHYLELTDXQKSEVLDIYYDFY* |
| JGI24006J15134_101496911 | 3300001450 | Marine | MATQSYQLLKISWNLYDKHYTKLTEEQRSKVWDIYYDFY* |
| JGI24006J15134_101921441 | 3300001450 | Marine | YTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY* |
| JGI24006J15134_101935592 | 3300001450 | Marine | MSNKSYTLLKISLRVFKKHYLKLTDEQKSEVLDIYYNYC* |
| JGI24006J15134_102006164 | 3300001450 | Marine | MSNFSYTLLKISWKVYDKHYTELTEDQRSNVLSIYYDFY* |
| JGI24006J15134_102377383 | 3300001450 | Marine | MCTKSYTLLKISWRVFDKHYTKLNDEQKSKVLDIYYDFY* |
| JGI24003J15210_100151687 | 3300001460 | Marine | MSTFSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY* |
| JGI24003J15210_101225061 | 3300001460 | Marine | NKSYTLLKISWRIFKEDYWKLTDEQKSEVLDIYDDFY* |
| JGI24003J15210_101345423 | 3300001460 | Marine | MSNFSYTLLKISWRVYDKHYTKLTDEEKSNVLDIYYDFY* |
| JGI24003J15210_101536273 | 3300001460 | Marine | MSNKSYTLLKISLRVFKKHYLKLTDEQKSEVLDIYYDFY* |
| JGI24004J15324_100855422 | 3300001472 | Marine | MSTKSYTLLKISWKLYDKHYLKLTDEQKSKVLDIYYDFY* |
| JGI24004J15324_101623531 | 3300001472 | Marine | MSXKSYTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY* |
| JGI24005J15628_101396594 | 3300001589 | Marine | MATQSYQLLKISWNLYDTHYTKLNEEQRSKVWDIYYDFY* |
| JGI24005J15628_101832542 | 3300001589 | Marine | MATQSYTLLKISWNLYDTHYTKLTEEQRSKVWDIYYDFY* |
| JGI24024J18818_101182151 | 3300001685 | Marine | MSNKSYTLLKISWKLYDKHFTKLTSEQKSKVLDIYYDFY* |
| JGI24523J20078_10015555 | 3300001718 | Marine | MCNYSYTLLKISWRLFDKHYTELTNEQKSKVRDTYSDFY* |
| GOS2219_10052315 | 3300001941 | Marine | TIPQTLNQLTMSTKSYTLLKIGWRRFGLNWLDLTDEQKSEVMDIYYDFY* |
| GOS2218_10263461 | 3300001947 | Marine | MSTKSYTLLKISWRVFNLNYWHLTDEQKSEVLDIYYDFY* |
| GOS2243_10363713 | 3300001965 | Marine | MATKSYTLLKISWKLFGLNYPDLTEEQKSKVLDIYYDFY* |
| GOS2243_10682066 | 3300001965 | Marine | MCTKSYTLLKISWRLFDKHYNKLTEEQKSKVLDIYYDFY* |
| JGI24540J26637_100541974 | 3300002153 | Marine | MATQSYQLLKISWNLYDTDYTKLTDKQKSKVWDIYYDFY* |
| JGI24540J26637_100709133 | 3300002153 | Marine | MCNYSYTLLKISWRLFDKHYTELTNEQKSKVRDIYSDFY* |
| JGI24540J26637_101316003 | 3300002153 | Marine | MSTQSYTLLKISWNLYDTHYTKLNEEQRSKVWDIYYDFY* |
| JGI25127J35165_10932961 | 3300002482 | Marine | MSNKSYTLLKISFRIYKKHWLELTSEQKSEVLDIYYNFY* |
| JGI25132J35274_10416052 | 3300002483 | Marine | MSTYSYTLLKISWRLFDKHYNKLTQEQKDKVHEIYYDFY* |
| JGI25132J35274_10556902 | 3300002483 | Marine | MCTKSYTLLKISWRLFDKHYNELTNEQKSEVLDIYYDFY* |
| JGI25128J35275_10043656 | 3300002488 | Marine | MSNYSYTLIKISWLVFNKNYWHLTDDQKSKVLEIYNNNY* |
| JGI25128J35275_11144841 | 3300002488 | Marine | MSTKSYTLLKISWRVFGLNYQDLTDEQKSEVLDIYYNFY* |
| JGI25133J35611_101333291 | 3300002514 | Marine | NTNLIKLNTMCTKSYTLLKISWKLFDKHYNKLTDEQKSKVLDVYYDFY* |
| Ga0052243_10084612 | 3300003145 | Marine Sediment | MCTKSYTLLKISWRIFDKHYTKLNDEQKSKVLDIYYDFY* |
| JGI26079J46598_10135283 | 3300003216 | Marine | MCTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDFY* |
| JGI26081J50195_10136665 | 3300003346 | Marine | MSTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDFY* |
| JGI26081J50195_10563201 | 3300003346 | Marine | MSTQSYTLLKISWNLYDTHYTKLTEEQRSKVWDIYYDFY* |
| FS896DNA_102330611 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MSNFSYTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY* |
| Ga0063282_10148052 | 3300003878 | Marine | MCTKSYTLLKISWRLYDKHYTKLTDEQRSNVLDIYYDFY* |
| Ga0066605_103754521 | 3300004279 | Marine | MATQSYQLLKISWNLFDKHYTELNADERSKVWDIYYDFY* |
| Ga0065861_100890812 | 3300004448 | Marine | MSTKSYQLLKISWNLYDTHFTKLTDEQKSKVWDIYYDFY* |
| Ga0065861_10104694 | 3300004448 | Marine | MSTFSYTLLKISWNLYDKHYTKLTDEQKSHVMDIYYDFY* |
| Ga0066224_10005571 | 3300004457 | Marine | MATQSYQLLKISWNSFDKHYTKLTVDERSKVWDIYYDFY* |
| Ga0066224_101010212 | 3300004457 | Marine | MSTKSYQLLKISWNLYDTHFTKLTDEQKSKVIDIYYDFY* |
| Ga0066222_10144201 | 3300004460 | Marine | MCTKSYTLLKISWRLYDKHYTKLTDEQKSKVIDIYYDFY* |
| Ga0066223_10055523 | 3300004461 | Marine | MATQSYQLLKISWNLYDTHYTKLTEEQRSKVWDIYYDFY* |
| Ga0073579_11055314 | 3300005239 | Marine | MSSKSYTLLKISWKLFNEDYWKLTNEQKSEVMNIYYDFY* |
| Ga0073579_16449942 | 3300005239 | Marine | MCTKSYTLLKISWRVFGLNFQDLTNEQKSKVLDIYYDFY* |
| Ga0066830_100204143 | 3300005433 | Marine | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDIYYDFY* |
| Ga0066830_100337092 | 3300005433 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVREIYYDFY* |
| Ga0066830_101234503 | 3300005433 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVRDIYNDFY* |
| Ga0066830_101292343 | 3300005433 | Marine | MSTYSYTLLKISWRVFDKHYNKLTQEQKDKVHEIYYDFY* |
| Ga0070728_103997014 | 3300005588 | Marine Sediment | MSTKSYTLLKISWRVFGLNYPDLTDEQKSKVLDIYYDFY* |
| Ga0070729_101831397 | 3300005589 | Marine Sediment | TMSTKSYTLLKISWRVFGLNYPDLTDEQKSKVLDIYYDFY* |
| Ga0066833_100621694 | 3300005595 | Marine | MCTKSYTLLKISWRLFDKHYTKLTQEQKDKVIEVYYDFH* |
| Ga0070726_105265372 | 3300005600 | Marine Sediment | MSTKSYTLLKISWRLFDKHYTKLTDEQKSKVREIYYDFY* |
| Ga0070724_101837653 | 3300005609 | Marine Sediment | MCTKSYTLLKISWRLYDKHYTELTDEQKSKVIDIYYDFY* |
| Ga0070724_104626021 | 3300005609 | Marine Sediment | MSTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDIYYDFY* |
| Ga0076919_10515742 | 3300005731 | M | MCTKSYTLLKISWRLYDKHYTKLTDEQKSNVLDIYYDFY* |
| Ga0076924_10132185 | 3300005747 | Marine | MSTFSYTLLKISWRLYDKHYTKLTDEQKSHVMDIYYDFY* |
| Ga0074476_13793883 | 3300005825 | Sediment (Intertidal) | MSTKSYTLLKISWNLFDKHFTKLTEKQKSKVLDIYYDFY* |
| Ga0078893_114150325 | 3300005837 | Marine Surface Water | MSTQSYDLLKISWNLFNENYWKLTDQQKAKVWDIYYDFY* |
| Ga0070725_102762841 | 3300005920 | Marine Sediment | MCTKSYTLLKISWRLYDKHYTELTDEQKSNVIDIYYDFY* |
| Ga0070742_101223671 | 3300005942 | Estuarine | TMATQSYQLLKISWNLFDKHYTKLTADERSKVWDIYYDFY* |
| Ga0075443_101596861 | 3300006165 | Marine | KSYQLLKISWSLYDTHFTKLTEEQKEKVIDIYYDFY* |
| Ga0075447_102104302 | 3300006191 | Marine | MATFSYTLLKISWKLYDKDYAKLNDEQKSKVMDLYYDFY* |
| Ga0075445_101225012 | 3300006193 | Marine | MANKFYQLLKISWNLYDTHFTKLTEEQKEKVIDIYYDFY* |
| Ga0099972_106308931 | 3300006467 | Marine | MSNFSWTLLKISLRVYKTHWLDLNDEQKSKVLDIYYDFC* |
| Ga0099972_113245565 | 3300006467 | Marine | MCTKSYTLLKISWNLFDTDFNKLTDEQKSKVIDIYYDFY* |
| Ga0099972_118865413 | 3300006467 | Marine | MSNKSYTLLKISLRVFKKHWLELTNEQKSEVLDIYYDFY* |
| Ga0070744_1000162012 | 3300006484 | Estuarine | MSTFSYTLLKISRNLFKKDFNELTSEQRSEVMDIYYDFY* |
| Ga0070744_100855352 | 3300006484 | Estuarine | MSNFSYTLLKISWRVFDKHYTKLTDEQKSKVLDIYYDFY* |
| Ga0070744_101898681 | 3300006484 | Estuarine | MCTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYYDFY* |
| Ga0098073_10055535 | 3300006734 | Marine | MATKSYTLLKISWRMFDKHFNELTQEQKDKVLERYYDYY* |
| Ga0098038_10105204 | 3300006735 | Marine | MATKSYTLLKISWRLFDKHYTKLNDEQKSKVLDIYYDFY* |
| Ga0098038_10166335 | 3300006735 | Marine | MSNFSYTLLKISLRIFKKHYLELTDKQKSEVLDIYYDFY* |
| Ga0098038_10227849 | 3300006735 | Marine | MSNKSYTLLKISWRVFNLNYWHLTDEQKSEVLDIYYDYY* |
| Ga0098038_10437095 | 3300006735 | Marine | MSNFSYTLLKISLRVYKTHWLDLTDKQKSEVLDIYYDFC* |
| Ga0098038_10866473 | 3300006735 | Marine | MCTKSYTLLKISWRLFDKHYNKLTDEQKSEVLDIYYDFY* |
| Ga0098038_11224052 | 3300006735 | Marine | MCTKSYTLLKISWRLFDKHYNKLTDEQKSEVLDMYYDFY* |
| Ga0098038_12266491 | 3300006735 | Marine | MCTYSYTLLKISWRLFDKHYNKLTDEQKSEVLDIYYDFY* |
| Ga0098038_12481602 | 3300006735 | Marine | MCTKSYTLLKISWRVFGLNYQDLTDKQKSEVLDIYYDFY* |
| Ga0098037_100103729 | 3300006737 | Marine | MCTYSYTLLKISWRLFDTHYTKLTQEQKDKVHEIYYDFY* |
| Ga0098037_101109011 | 3300006737 | Marine | MATKSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY* |
| Ga0098037_11359565 | 3300006737 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVREIYSDFY* |
| Ga0098037_11899833 | 3300006737 | Marine | MCTKSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY* |
| Ga0098035_12457841 | 3300006738 | Marine | MSNKSYTLLKISLRVFKKHYLELTDKQKSEVLDIYYDFY* |
| Ga0098042_10007686 | 3300006749 | Marine | MCTKSYTLLKISWRLFDKHYNKLTQKQKSKVLDIYYDFY* |
| Ga0098042_11014791 | 3300006749 | Marine | NNNTMCNFSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY* |
| Ga0098042_11060732 | 3300006749 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVRDIYDDFY* |
| Ga0098042_11442722 | 3300006749 | Marine | MSNKSYTLLKISLRVFKKHFTELTDKQKSEVLDIYYDFY* |
| Ga0098058_10339934 | 3300006750 | Marine | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVREIYSDFY* |
| Ga0098048_100397710 | 3300006752 | Marine | MSNQSYTLLKISFNLYKKHWTKLNDEQKSKVMDIYYDFY* |
| Ga0098048_101523710 | 3300006752 | Marine | MATKSYTLLKISWRLYDKHFNELTDEQKSNVIDIYYDFY* |
| Ga0098048_10364394 | 3300006752 | Marine | MATRSYTLLKISWRLYDKHYNKLTDEQKSHVLDIYDDFY* |
| Ga0098054_12001672 | 3300006789 | Marine | MATKSYTLLKISRNLFKKDFTDLTSEQRSQVMDIYYDFY* |
| Ga0098054_12329902 | 3300006789 | Marine | MATKSYTLLKISWRLYDKHFNELTDEQKSNVIDIYDDFY* |
| Ga0070754_101002606 | 3300006810 | Aqueous | MATKSYILLKISWNLFDKHYTELTDEQKSKVLDIYYDFY* |
| Ga0070754_101152137 | 3300006810 | Aqueous | YTLLKISWRLYDKHYTKLTDEQKSNVLDIYYDFY* |
| Ga0070746_100657624 | 3300006919 | Aqueous | MCTKSYTLLKISWRLYDKHYTELNDEQKSNVLDIYYDFY* |
| Ga0098050_10728743 | 3300006925 | Marine | MSNFSYTLLKISLRIFKKHYLELTDEQKSEVLDIYYDFY* |
| Ga0098041_11329582 | 3300006928 | Marine | MSTFSYTLLKISLRVYKTHWLDLTDKQKSEVLDIYYDFY* |
| Ga0075444_102493371 | 3300006947 | Marine | MATKSYQLLKISWSLYDTHFTKLTEEQKEKVIDIYYDFY* |
| Ga0098046_10093894 | 3300006990 | Marine | MATRSYTLLKISWRLYDKHYTKLTDEQKSHVLDIYDDFY* |
| Ga0098046_10114591 | 3300006990 | Marine | MCTKSYTLLKISRRIFKKEFPELTSEEKSQVIDIYYDFY* |
| Ga0098046_10464211 | 3300006990 | Marine | NNTMCNFSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY* |
| Ga0070745_12000203 | 3300007344 | Aqueous | MVTKSYTLLKISWRMFDKHWNELTQEQKDKVLERYYDYY* |
| Ga0099849_10446523 | 3300007539 | Aqueous | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDVYYDFY* |
| Ga0099847_10010846 | 3300007540 | Aqueous | MATQSYQLLKISWNLFDKHYTKLNADERSKVWDIYYDFY* |
| Ga0102817_100047212 | 3300007555 | Estuarine | MSTFSYTLLKISRNIFKKDFNELTSEQRSEVMDIYYDFY* |
| Ga0105749_10022662 | 3300007864 | Estuary Water | MSNFSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY* |
| Ga0115371_102023621 | 3300008470 | Sediment | MANKSYQLLKISWKLYDTHFTKLTEEQKEKVIDIYYDFY* |
| Ga0102810_10538297 | 3300009002 | Estuarine | MSNKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDFY* |
| Ga0102829_11666364 | 3300009026 | Estuarine | ITMSTKSYTLLKISWNLFDKHFTELTEKQKSKVLDIYYDFY* |
| Ga0115863_12005961 | 3300009034 | Sediment, Intertidal | MCTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYDDFY* |
| Ga0115549_10509095 | 3300009074 | Pelagic Marine | MCNKSYTLLKISRRVFKKEFPELTSEEKSQVLDIYYDFY* |
| Ga0118730_12086592 | 3300009132 | Marine | MCTKSYTLLKISWRLFDKHYNELNEKQKSKVLDIYYDFY* |
| Ga0114918_100380931 | 3300009149 | Deep Subsurface | MATKSYQLLKISWNLFDKHYTELTDEQKSKVIDIYYDFY* |
| Ga0114995_101406634 | 3300009172 | Marine | MATFSYTLLKISWNLYDTDYNKLTEEQKSKVMDIYYDFY* |
| Ga0114915_12062881 | 3300009428 | Deep Ocean | NNTMATKSYQLLKISWSLYDTHFTKLTEEQKEKVIDIYYDFY* |
| Ga0115562_10566094 | 3300009434 | Pelagic Marine | MSTFSYTLLKISWNLYDKHYTKLTDEQKSKVMDIYY |
| Ga0115559_10545982 | 3300009438 | Pelagic Marine | MCTKSYTLLKISWRLYDKHYTELTEEQKSNVLDIYYDFY* |
| Ga0115563_10348941 | 3300009442 | Pelagic Marine | MSTFSYTLLKISWRLYDKHYTKLTNEQKSHVLDIYYDFY* |
| Ga0115565_102251281 | 3300009467 | Pelagic Marine | MCTKSYTLLKISWRLYDKHYTKLTDEQKSNVLDIYY |
| Ga0115570_104342621 | 3300009496 | Pelagic Marine | YQLLKISWNLYDTHYTKLTEEQRSKVWDIYYDFY* |
| Ga0115004_103071531 | 3300009526 | Marine | MATQSYQLLKISWNLYDTDYTKLTEEQRSKVWDIYYDFY* |
| Ga0114919_101130277 | 3300009529 | Deep Subsurface | MATKSYTLLKISWRMFDKHYNELTQEQKDKVLERYYDYY* |
| Ga0115006_113627843 | 3300009544 | Marine | MATQSYQLLKISWNLYDTHYTKLTDEQKSKVWDIYYDFY* |
| Ga0115001_102227485 | 3300009785 | Marine | MATFSYTLLKISWNLYDTDYNKLTKEQKSKVMDIYYDFY* |
| Ga0098059_12451691 | 3300010153 | Marine | MNLKLITMSNYSYTLYKISMRVFKKCYSKLTFEQRSEVLDIYYDFY* |
| Ga0136851_111421163 | 3300010413 | Mangrove Sediment | MATKSYTLLKISWRMFDKHYNDLTQEQKDKVLERYYDYY* |
| Ga0118733_1009681381 | 3300010430 | Marine Sediment | LIKNITMSTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYYDFY* |
| Ga0137843_10053386 | 3300010932 | Subsea Pool | MCNFSYTLLKISWRMFDKHYNKLTQEEKDKVLQRYYDYY* |
| Ga0151669_10025531 | 3300011128 | Marine | MSNFSYTLLKISLRVYKKHYLKLTDEQKSKVLDIYYDFY* |
| Ga0151675_10026823 | 3300011254 | Marine | MSNFSYTLLKISLRVYKTHWLDLNDEQKSKVLDIYYDFY* |
| Ga0151664_10307874 | 3300011256 | Marine | NTMFTKSYTLLKISWRVFDKHYTKLNDEQKSKVLDIYYDFY* |
| Ga0151664_10371683 | 3300011256 | Marine | MSNFSWTLLKISLRIYKTHWLDLNDEQKSNVLDIYYDFY* |
| Ga0151661_10285663 | 3300011261 | Marine | MCTKSYTLLKISWRLFDKHYTKLTEEQKQKVIDVYYDFY* |
| Ga0163180_104358274 | 3300012952 | Seawater | MSTFSYTLLKISLRIFKKHYLELTDEQKSEVLDIYYDFY* |
| Ga0163179_101717718 | 3300012953 | Seawater | KSYTLLKISWRLFDKHYTKLTEEQKSKVLDIYYDFY* |
| Ga0163179_115485851 | 3300012953 | Seawater | TMSTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDIYYDFY* |
| Ga0163111_101389785 | 3300012954 | Surface Seawater | MSTKSYTLLKISWRLFDKHFNKLTDEQKSKVLDIYYDFY* |
| Ga0164320_100337151 | 3300013098 | Marine Sediment | MCTKSYTLLKISWRLFDKHYTKLTDEQKSKVLDVYYDFY* |
| Ga0164320_101667651 | 3300013098 | Marine Sediment | MCTKSYTLLKISWRLFDKHYNKLTDEQKSKVLDVYYDFY* |
| Ga0164315_111125201 | 3300013099 | Marine Sediment | MSNKSYTLLKISLRIFKKHYLELTDKQKSEVLDIYYDFY* |
| Ga0164313_100721551 | 3300013101 | Marine Sediment | MSTFSYTLLKISWRLYDKHYTKLTDEQKSKVMDIYYDFY* |
| Ga0164313_100957205 | 3300013101 | Marine Sediment | MSTFSYTLLKISWKLYNTDYTKLTDEQKSKVMDIYYDFY* |
| Ga0164313_108801662 | 3300013101 | Marine Sediment | MCTKSYTLLKISWRLFDKHYNKLTEEQKSKVIDIYYDFY* |
| Ga0164313_111602211 | 3300013101 | Marine Sediment | TMCTKSYTLLKISWKLFDKHYNKLTDEQKSKVLDVYYDFY* |
| Ga0164318_100673656 | 3300013103 | Marine Sediment | MCNKSYTLLKISRRVFKKEFPELTPEQKSQVLDIYYDFY* |
| Ga0164321_100616654 | 3300014903 | Marine Sediment | MCTKSYTLLKISWKLFDKHYNKLTDEQKSKVLDVYYDFY* |
| Ga0181377_10051884 | 3300017706 | Marine | MATKSYTLLKISWNLFDKHFTELTDKQKSEVLDIYDDFY |
| Ga0181387_10065121 | 3300017709 | Seawater | MSNKSYTLLKISWRVYNKNYWQLTDEQKSKVLDIYYDFY |
| Ga0181391_10044223 | 3300017713 | Seawater | MSTKSYTLLKISWRVFGLNYQDLTDEQKSKVIDIYYDFY |
| Ga0181412_100575412 | 3300017714 | Seawater | MSNFSYTLLKISWRVFDKHYTQLTDEQKSEVLDIYYDFY |
| Ga0181390_10224055 | 3300017719 | Seawater | MSNFPYTLLKISWRVFDKHYTQLTDEQKSEVLDIYYDFY |
| Ga0181390_11054712 | 3300017719 | Seawater | MATQSYQLLKISWNLFDKHYTELNADERAKVWDIYYDFY |
| Ga0181373_10016035 | 3300017721 | Marine | MATQSYQLLKISWNLFDKHYTKLTADERSKVWEIYYDFY |
| Ga0181373_10698561 | 3300017721 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVREIYY |
| Ga0181401_10018932 | 3300017727 | Seawater | MSNFSYTLLKISWRVFDKHYTKLTDEQKSNVLDIYYDFY |
| Ga0181401_10081075 | 3300017727 | Seawater | MSTFSYTLLKISWRLFDKHYTQLTDEQKSEVLDIYYDFY |
| Ga0181401_10122462 | 3300017727 | Seawater | MSNKSYTLLKISWKLYDKHFTKLTSEQKSKVLDIYYDFY |
| Ga0181401_10238771 | 3300017727 | Seawater | MSTFSYTLLKISLRIYKTHWLDLNDEQKSEVLDIYYDFY |
| Ga0181419_10037477 | 3300017728 | Seawater | MSTFSYTLLKISLRVYKTHWLDLNDDQKSKVLDIYYDFY |
| Ga0181416_100179518 | 3300017731 | Seawater | NTMSNKSYTLLKISLRVFKKHYLELTDKQKSEVLDIYYDFY |
| Ga0181428_10308111 | 3300017738 | Seawater | NTMSNKSYTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0181418_100700912 | 3300017740 | Seawater | MSTFSYTLLKISLRVYNTHWLDLNDEQKSEVLDIYYNYC |
| Ga0181418_11481981 | 3300017740 | Seawater | MSNYSYTLIKISWLVFNKNYWHLTDDQKSKVLEIYNNN |
| Ga0181421_10296786 | 3300017741 | Seawater | MSTKSYTLLKISLRIFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0181402_10532072 | 3300017743 | Seawater | MSNKSYTLLKISLRVYKTHWLELTDEQKSEVLDIYYDFY |
| Ga0181389_10053127 | 3300017746 | Seawater | MCNYSYTLLKISWRVFDKHYLKLTDEQKSKVREIYYDLY |
| Ga0181393_10502581 | 3300017748 | Seawater | QLIINNTMSNKSYTLLKISLRVFKKHFLELTDEQKSEVLDIYYDFY |
| Ga0181392_100603810 | 3300017749 | Seawater | MSNKSYTLLKISLRVFKKHFLELTDEQKSEVLDIYYDFY |
| Ga0181392_10661151 | 3300017749 | Seawater | MSNKSYTLLKISLRIFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0181408_10769455 | 3300017760 | Seawater | NNTMSTKSYTLLKISWRVFGLNYQDLTDEQKSKVLDIYYDFY |
| Ga0181410_10335694 | 3300017763 | Seawater | MSTFSYTLLKISLRIYKTHCLDLNDEQKSEVLDIYYDFY |
| Ga0181410_10990721 | 3300017763 | Seawater | MSTKSYTLLKISLRVYKTHWLELTDEQKSEVLDIYYDFY |
| Ga0181385_10116236 | 3300017764 | Seawater | MSTKSYTLLKISWRVYNKNYWQLTDEQKSKVLDIYYDFY |
| Ga0187220_10173542 | 3300017768 | Seawater | MSNFSYTLLKIAWRVYDKHYTKLTDEQKSNVLDIYYDFY |
| Ga0181386_11016042 | 3300017773 | Seawater | MSNKSYTLIKISWRVFNKNYWQLTDEQKSEVLDIYYDFY |
| Ga0181577_107038013 | 3300017951 | Salt Marsh | MVTKSYTLLKISWRMFDKHYNELTQEQKDKVLERYYDYY |
| Ga0180437_108627623 | 3300017963 | Hypersaline Lake Sediment | MTTKSYTLLKISWRVFGLNYQDLTDEQKSKVWDIYYDF |
| Ga0180434_100470781 | 3300017991 | Hypersaline Lake Sediment | MTTKSYTLLKISWNLFDKHYTELTDEQKSKVWDIYYDFY |
| Ga0181567_104255681 | 3300018418 | Salt Marsh | FLKYIIMTTYSYTLLKISWRMFNKHFTKLTKDQQEKVIQRYYDYY |
| Ga0181592_105147433 | 3300018421 | Salt Marsh | MATKSYTLLKISWRMFDKHWQELTQEQKDKVLQRYYDYY |
| Ga0192961_101108072 | 3300018980 | Marine | MATKSYTLLKIARRIFKKDFPELTSEQKSEVLDIYYDFY |
| Ga0193973_10335274 | 3300019737 | Sediment | MCTKSYTLLKISWNLFDTDFDKLTDKQKSKVIDIYYDFY |
| Ga0206125_1001330717 | 3300020165 | Seawater | MSTFSYTLLKISWRLYDKHYTKLTDEQKSHVLDIYYDFY |
| Ga0206125_100820702 | 3300020165 | Seawater | MATKSYALLKISRNLFKKDFTDLTSEQKSQVMDIYYDFY |
| Ga0206125_101254722 | 3300020165 | Seawater | MATKSYALLKISRNLFKKDFTDLTPEQKSKVIDIYYDFY |
| Ga0206128_10669743 | 3300020166 | Seawater | MATKSYALLKISRNLFKKDFTDLTSEQKSQVINIYYDFY |
| Ga0206128_10925732 | 3300020166 | Seawater | MCNKSYTLLKISRRVFKKEFPELTSEEKSQVLDIYYDFY |
| Ga0206127_10488971 | 3300020169 | Seawater | MCTKSYTLLKISRRVFKKEFPELTSEEKSQVLDIYYDFY |
| Ga0206130_100374016 | 3300020187 | Seawater | MSTFSYTLLKISWRLYDKHYTKLTNEQKSHVLDIYYDFY |
| Ga0212228_14052377 | 3300020235 | Sediment | MSTFSYTLLKISLRVFNTHWLDLNDEQKSEVLDIYYNFC |
| Ga0211658_10123442 | 3300020274 | Marine | MCTKSYTLLKISWRLFDKHYNKLTDEQKSEVLDIYYDFY |
| Ga0211504_10094425 | 3300020347 | Marine | MCTKSYTLLKISWNLFDTDFDKLNDEQKSKVIDIYYDFY |
| Ga0211504_10259972 | 3300020347 | Marine | MATKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY |
| Ga0211505_10012122 | 3300020352 | Marine | MANKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY |
| Ga0211505_100270914 | 3300020352 | Marine | MSTKSYTLLKISLRVFKKHYLKLTDEQKSKVLDIYYDFY |
| Ga0211687_100188475 | 3300020396 | Marine | MSNFSYTLLKISWKVYDKHYTELTEDQRSNVLSIYYDFY |
| Ga0211659_100487295 | 3300020404 | Marine | MSTFSYTLLKISWRLFDKHYTELTKEQKDKVMDIYYDFY |
| Ga0211512_100681352 | 3300020419 | Marine | MSTKSYTLLKISWRRFGLNWLDLTDEQKSEVLDIYDDFY |
| Ga0211559_1000579011 | 3300020442 | Marine | MVTKSYTLLKISWRMFDKHWNELTQEQKDKVLERYYDYY |
| Ga0211545_100552925 | 3300020452 | Marine | MSNFSWTLLKISLRVYKTHWLDLNDEQKSKVLDIYYDFY |
| Ga0211643_100509554 | 3300020457 | Marine | MSTLSYTLLKISWRLFDKHYTQLTQEQKDKVMDIYYDFY |
| Ga0211577_100040655 | 3300020469 | Marine | MSNKSYTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0206678_100319971 | 3300021084 | Seawater | MSTFSYTLLKISRNLFKKDFNELTSEQRSEVMDIYYDFY |
| Ga0206677_1000170945 | 3300021085 | Seawater | MSTQSYDLLKISWNLFNENYWKLTDQQKAEVWDIYYDFY |
| Ga0213859_100105826 | 3300021364 | Seawater | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDVYYDFY |
| Ga0206123_1000353324 | 3300021365 | Seawater | MCTKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY |
| Ga0213860_101913554 | 3300021368 | Seawater | KNNNTMCTKSYTLLKISWRLFDKHYNELTNEQKSKVLDVYYDFY |
| Ga0213869_101848311 | 3300021375 | Seawater | MSTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDFY |
| Ga0213861_101148237 | 3300021378 | Seawater | MCTKSYTLLKISWNLFDTDFNKLTDEQKSKVIDIYYDFY |
| Ga0213868_100390487 | 3300021389 | Seawater | MSTFSYTLLKISLRVYKTHWLDLNDEQKSEVLDIYYNFC |
| Ga0213868_102017321 | 3300021389 | Seawater | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDVYYD |
| Ga0190344_10557074 | 3300021504 | Hydrothermal Vent Microbial Mat | MCTKSYTLLKISWRLFDKHYTKLTDEQKSKVLDVYYDFY |
| Ga0222717_100023648 | 3300021957 | Estuarine Water | MSTQSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0222717_100131597 | 3300021957 | Estuarine Water | MCNYSYTLLKISWRLYDKHYTKLTDEQKSKVIDIYYDFY |
| Ga0222717_100353483 | 3300021957 | Estuarine Water | MATKSYTLLKISRNLFKKDWGDLTSEQKSEVMDIYYDFY |
| Ga0222717_101251822 | 3300021957 | Estuarine Water | MVTKSYTLLKISWRLYDKHYNELTDEQKSNVIDIYYDFY |
| Ga0222717_102915652 | 3300021957 | Estuarine Water | MATKSYTLLKISWRMFDKHYNDLTQEQKDKVLERYYDYY |
| Ga0196903_100052611 | 3300022169 | Aqueous | MCTKSYTLLKISWRLYDKHYTELTDEQKSNVIDIYYDFY |
| Ga0196903_10242761 | 3300022169 | Aqueous | MCTKSYTLLKISWNLFDTDFDKLTDKQKSKVIDIYY |
| Ga0196887_10304376 | 3300022178 | Aqueous | MSTKSYTLLKISWNLFDKHFTKLTEKQKSKVLDIYYDFY |
| Ga0224514_100351993 | 3300022217 | Sediment | MSTFSYTLLKISRNIFKKDFNELTSEQRSEVMDIYYDFY |
| Ga0224509_100417362 | 3300022306 | Sediment | MATRSYTLLKISWRLYDKHYTKLTDEQKSHVLDIYDDFY |
| Ga0255781_102479212 | 3300022934 | Salt Marsh | MATKSYTLLKISWRMFDKHWQELTQEQKDKVLERYYDYY |
| (restricted) Ga0233432_100384196 | 3300023109 | Seawater | MATQSYQLLKISWNLFDKHYTELNADERSKVWDIYYDFY |
| (restricted) Ga0233411_100864762 | 3300023112 | Seawater | MSTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDF |
| (restricted) Ga0233412_100598001 | 3300023210 | Seawater | MSNFSYTLLKISLRVYKTHWLDLTDKQKSEVLDIYYNYC |
| Ga0228697_1060396 | 3300023674 | Seawater | QSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| (restricted) Ga0255040_100039233 | 3300024059 | Seawater | MSTFSYTLLKISWKLYDKHYTKLTDEQKSKVMDIYYDFY |
| (restricted) Ga0255039_100311245 | 3300024062 | Seawater | MSTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYYDFY |
| Ga0228669_100648212 | 3300024185 | Seawater | MATRSYTLLKISWRLYDKHYNKLTDEQKSHVLDIYDDFY |
| Ga0233402_100362611 | 3300024229 | Seawater | MSNYSYTLYKISMRVFKKCYSKLTSEQRSEVLDIYYDFY |
| Ga0233402_11051234 | 3300024229 | Seawater | SYTLLKISWRLYDKHYNELTDEQKSNVIDIYYDFY |
| Ga0233399_10459895 | 3300024231 | Seawater | MCNKSYTLLKISRRIFKKEFPELTPEQKSQVLDIYYDFY |
| (restricted) Ga0233438_1003945713 | 3300024255 | Seawater | MSTKSYTLLKISWKLFDKHFTKLTEKQKSEVLDIYYDFY |
| (restricted) Ga0233438_101272273 | 3300024255 | Seawater | MSNFSYTLLKISWRVFDKHYTQLTDEQKSEVMDIYYDFY |
| Ga0210003_100293124 | 3300024262 | Deep Subsurface | MATQSYQLLKISWNLFDKHYTELTADERSKVWDIYYDFY |
| Ga0210003_11649751 | 3300024262 | Deep Subsurface | MATKSYQLLKISWNLFDKHYTELTDEQKSKVIDIYYDFY |
| Ga0244775_101140796 | 3300024346 | Estuarine | MCTKSYTLLKISWNLFDTDFDKLTDEQKSKVIDIYYDFY |
| Ga0244775_102546891 | 3300024346 | Estuarine | MSTKSYTLLKISWNLFDKHFTELTEKQKSKVLDIYYDFY |
| (restricted) Ga0255048_100075584 | 3300024518 | Seawater | MSTFSYTLLKISWNLYDKHYTKLTDEQKSKVMDIYYDFY |
| (restricted) Ga0255056_101083133 | 3300024521 | Seawater | MATFSYTLLKISWNLYDTDYNKLTEEQKSKVMDIYYDFY |
| Ga0208018_10013157 | 3300025057 | Marine | MATKSYTLLKISWRMFDKHFNELTQEQKDKVLERYYDYY |
| Ga0207896_10007832 | 3300025071 | Marine | MCTKSYTLLKISWRVFDKHYTKLNDEQKSKVLDIYYDFY |
| Ga0208920_10040286 | 3300025072 | Marine | MSNKSYTLLKISLRVFKKHYLELTDKQKSEVLDIYYDFY |
| Ga0208791_10034111 | 3300025083 | Marine | MTKSYTLTKISWKLFNKCYTKLTTQQKLQVTNIYYDFY |
| Ga0208157_100238122 | 3300025086 | Marine | MSNKSYTLLKISWRVFNLNYWHLTDEQKSEVLDIYYDYY |
| Ga0208157_100239710 | 3300025086 | Marine | MCTKSYTLLKISWRVFGLNYQDLTDKQKSEVLDIYYDFY |
| Ga0208157_100894511 | 3300025086 | Marine | MSNFSYTLLKISLRVYKTHWLDLTDKQKSEVLDIYYDFC |
| Ga0208157_10414955 | 3300025086 | Marine | TYSYTLLKISWRLFDTHYTKLTQEQKDKVHEIYYDFY |
| Ga0208434_10065427 | 3300025098 | Marine | MCTKSYTLLKISWRLFDKHYNKLTDEQKSEVLDMYYDFY |
| Ga0208669_10034357 | 3300025099 | Marine | MCTKSYTLLKISWRLFDKHYTKLTDKQKSEVLDIYDDFY |
| Ga0208159_10007876 | 3300025101 | Marine | MCTKSYTLLKISWRLFDKHYNKLTQKQKSKVLDIYYDFY |
| Ga0208159_10024466 | 3300025101 | Marine | MATKSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY |
| Ga0208159_10695151 | 3300025101 | Marine | NNNTMCNFSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYYDFY |
| Ga0208666_10200801 | 3300025102 | Marine | KSITMCTYSYTLLKISWRLFDTHYTKLTQEQKDKVHEIYYDFY |
| Ga0208158_11120741 | 3300025110 | Marine | MCNFSYTLLKISWRLFDKHYTKLTDEQKSKVLDIYY |
| Ga0209535_100301722 | 3300025120 | Marine | MSNKSYTLLKISWRIFKEDYWKLTDEQKSEVLDIY |
| Ga0209535_10257096 | 3300025120 | Marine | MSNFSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY |
| Ga0209348_100006466 | 3300025127 | Marine | MCTKSYTLLKISWRLFDKHYTKLTQEQKDKVIEVYYDFH |
| Ga0209348_10024088 | 3300025127 | Marine | MSSKSYTLIKISWRVFNKNYWQLTDEQKSEVLDIYYDFY |
| Ga0209348_10516395 | 3300025127 | Marine | MSTYSYTLLKISLRVFNKHYQKLTDDQKNKVKEIYYNYC |
| Ga0209128_10423503 | 3300025131 | Marine | MCTKSYTLLKISWKLFDKHYNKLTDEQKSKVLDVYYDFY |
| Ga0209232_10282709 | 3300025132 | Marine | MSNYSYTLIKISWLVFNKNYWHLTDDQKSKVLEIYNNNY |
| Ga0209232_10389983 | 3300025132 | Marine | MCTKSYTLLKISWRVFDKHYTKLTQEQKDKVLSIYYDFY |
| Ga0209336_1001318411 | 3300025137 | Marine | MCTKSYTLLKISWRVFDKHYTKLTDEQKSKVLDIYYDFY |
| Ga0209336_101177813 | 3300025137 | Marine | KSYTLLKISWRIFKEDYWKLTDEQKSEVLDIYDDFY |
| Ga0209634_101033511 | 3300025138 | Marine | MATQSYTLLKISWNLYDTHYTKLNEEQRSKVWDIYYDFY |
| Ga0209634_104811911 | 3300025138 | Marine | FSYTLLKISWNLYDKHYTKLTEEQKSKVMDIYYDFY |
| Ga0209634_10529198 | 3300025138 | Marine | MSNFSYTLLKISLRIFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0209756_10308897 | 3300025141 | Marine | MCTKSYTLLKISWKLFDKHYNKLTDEQKSKVLDVYYGFLLK |
| Ga0209756_10621271 | 3300025141 | Marine | YTMCTKSYTLLKISWRLFDKHYTKLTQEQKDKVIEVYYDFH |
| Ga0209645_100346714 | 3300025151 | Marine | MCNYSYTLLKISWRLFDKHYTKLTDEQKSKVREIYYDFY |
| Ga0209645_11242252 | 3300025151 | Marine | MCTKSYTLLKISWRLFDKHYTKLTEEQKSKVLDIYYDFY |
| Ga0209337_10137753 | 3300025168 | Marine | MSTFSYTLLKISWNLYDKHYTKLTEEQKSKVMDIYYDFY |
| Ga0209337_10671323 | 3300025168 | Marine | MSNKSYTLLKISLRVFKKHYLKLTDEQKSEVLDIYYDFY |
| Ga0208814_10207561 | 3300025276 | Deep Ocean | MSTKSYTLLKISWNLFDKHFTELTDEQKSNVIDIYDDFY |
| Ga0208303_10067571 | 3300025543 | Aqueous | MATKSYALLKISRNLFKKDWGDLTSEQKSEVIDIYYDFY |
| Ga0209405_100332627 | 3300025620 | Pelagic Marine | MATKSYQLLKISWNLYDTHFTKLTDEQKSKVIDIYYDFY |
| Ga0209405_10246648 | 3300025620 | Pelagic Marine | MSTKSYQLLKISWNLYDTHFTKLTEEQKSKVWDIYYDFY |
| Ga0209716_100783818 | 3300025626 | Pelagic Marine | MCTKSYTLLKISWRLYDKHYTELTDKQKSNVLDIYYDFY |
| Ga0209716_10200902 | 3300025626 | Pelagic Marine | MSSMSTTLLKISLRMYKKFYNELTSEEKGIVMDIYYDFY |
| Ga0209833_10023273 | 3300025641 | Pelagic Marine | MCNKSYTLLKISRRIFKKDFPELTSEQKSEVLDIYYDFY |
| Ga0208898_10140312 | 3300025671 | Aqueous | MATKSYILLKISWNLFDKHYTELTDEQKSKVLDIYYDFY |
| Ga0209199_10152162 | 3300025809 | Pelagic Marine | MSTKSYQLLKISWNLYDTHFTKLTEEQKSKVIDIYYDFY |
| Ga0209199_10341357 | 3300025809 | Pelagic Marine | MCTKSYTLLKISWNLFDKHYTKLTEEQKSKVIDIYYDFY |
| Ga0247558_10026614 | 3300026390 | Seawater | TQSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0247557_10127531 | 3300026403 | Seawater | ITMSTQSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0247578_10010021 | 3300026458 | Seawater | STQSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0247600_100119616 | 3300026461 | Seawater | TMSTQSTDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0208921_10064263 | 3300027188 | Estuarine | MSNYSYTLYKISMNVFKKCYSKLTSEQRSEVLDIYYDFY |
| Ga0208923_10393551 | 3300027320 | Estuarine | MSTKSYTLLKISWNLFDKHFTELTEKQKSKVLDIYYDF |
| Ga0208973_11295432 | 3300027506 | Marine | MSTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYY |
| Ga0209482_10235152 | 3300027668 | Marine | MATFSYTLLKISWKLYDKDYAKLNDEQKSKVMDLYYDFY |
| Ga0209482_10267022 | 3300027668 | Marine | MGTFSYTLLKISWKLYDTHYTKLNDEQKSKVIDIYYDFY |
| Ga0208305_1000405311 | 3300027753 | Estuarine | MCTKSYTLLKISWNLFDTDFDKLNDQQKSKVIDIYYDFY |
| Ga0208305_100079781 | 3300027753 | Estuarine | MCTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYYDFY |
| Ga0209092_100575367 | 3300027833 | Marine | MCNKSYTLLKISKRVFKKEFPELTSEEKSQVLDIYYDFY |
| Ga0209503_100055768 | 3300027859 | Marine | MSNFSYTLLKISLRIFKKHYLELTDEQKSKVLDIYYDFY |
| Ga0209503_100136939 | 3300027859 | Marine | MSTKSYTLLKISWRVFGLNYPDLTDEQKSKVLDIYYDFY |
| (restricted) Ga0255052_103735774 | 3300027865 | Seawater | NKNITMSTKSYTLLKISWNLFDKHFTKLTEKQKSEVLDIYYDFY |
| (restricted) Ga0233413_100732722 | 3300027996 | Seawater | MATQSYQLLKISWNLFDKHYTKLNADERSKVWDIYYDF |
| (restricted) Ga0233413_102900373 | 3300027996 | Seawater | SYTLLKISLRVYKTHWLDLTDKQKSEVLDIYYNYC |
| Ga0247582_10007534 | 3300028109 | Seawater | MSTQATDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0228606_10829051 | 3300028135 | Seawater | MATRSYTLLKISWRLYDKHYTKLTDEQKSHVLDIYD |
| Ga0257110_101428113 | 3300028197 | Marine | MSNFSYTLLKISLRVFKKHYLELTDEQKSEVLDIYYDFY |
| Ga0256413_11429481 | 3300028282 | Seawater | STDLLKISYNLFDKHYTKLTDEQRSKVWDIYYDFY |
| Ga0247567_10906632 | 3300028338 | Seawater | ATRSYTLLKISWRLYDKHYNKLTDEQKSHVLDIYDDFY |
| Ga0307380_111168891 | 3300031539 | Soil | YTNLKQITMANQSYTLYKISMNIFKMCYSKLTPEQRSEVLDIYYDFY |
| Ga0307489_100243039 | 3300031569 | Sackhole Brine | MSTFSYTLLKISWNLYDKHYTKLTEEQKSKVMSIYYDFY |
| Ga0302126_100359289 | 3300031622 | Marine | MATFSYTLLKISWNLYDTDYNKLTEEQKSKVMNIYYDFY |
| Ga0307377_106679321 | 3300031673 | Soil | MATQSYQLLKISWNLYDTHYTKLTEEQKAKVWEIYYDFY |
| Ga0308008_11256972 | 3300031687 | Marine | MATFSYTLLKISWKLYDKDYAKLNDEQKSKVMDLYYDF |
| Ga0308008_11695701 | 3300031687 | Marine | MATKSYQLLKISWNLYDTHFTKLTEEQKEKVIDIYYDFY |
| Ga0315322_1002876810 | 3300031766 | Seawater | MATQSYQLLKISWNLFDKHYTKLTADERSKVWDIYYDFY |
| Ga0315315_100091296 | 3300032073 | Seawater | MSTFSWTLLKISLRVYKTHWLDLNDEQKSKVLDIYYDFY |
| Ga0315315_100230377 | 3300032073 | Seawater | MSTKSYTLLKISWRVFGLNYQDLTDEQKSEVLDIYYNFY |
| Ga0315315_101701355 | 3300032073 | Seawater | MSTFSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY |
| ⦗Top⦘ |