| Basic Information | |
|---|---|
| Family ID | F004192 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 449 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKKDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Number of Associated Samples | 296 |
| Number of Associated Scaffolds | 449 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 20.49 % |
| % of genes from short scaffolds (< 2000 bps) | 71.71 % |
| Associated GOLD sequencing projects | 257 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.024 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (20.045 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.693 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (73.497 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 449 Family Scaffolds |
|---|---|---|
| PF04542 | Sigma70_r2 | 40.98 |
| PF04404 | ERF | 15.37 |
| PF12684 | DUF3799 | 5.79 |
| PF14743 | DNA_ligase_OB_2 | 3.12 |
| PF02796 | HTH_7 | 2.45 |
| PF13619 | KTSC | 1.78 |
| PF08279 | HTH_11 | 1.11 |
| PF13662 | Toprim_4 | 1.11 |
| PF02151 | UVR | 0.67 |
| PF00118 | Cpn60_TCP1 | 0.22 |
| PF03819 | MazG | 0.22 |
| PF06356 | DUF1064 | 0.22 |
| PF08299 | Bac_DnaA_C | 0.22 |
| PF01510 | Amidase_2 | 0.22 |
| PF00303 | Thymidylat_synt | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 449 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 40.98 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 40.98 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 40.98 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 40.98 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.22 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.02 % |
| All Organisms | root | All Organisms | 38.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.04% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.80% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.13% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.57% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.45% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.45% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.23% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.56% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.34% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.12% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.34% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.34% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.11% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 1.11% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.11% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.11% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.67% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.67% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.67% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.45% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.45% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.45% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.45% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.45% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.45% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.45% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.45% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.45% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.45% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.45% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.22% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.22% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.22% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.22% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.22% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.22% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.22% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.22% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.22% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.22% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.22% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.22% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.22% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.22% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.22% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090012 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-236-260cm | Environmental | Open in IMG/M |
| 2100351001 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from low methane PC12-247-20cm | Environmental | Open in IMG/M |
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 2140918005 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm | Environmental | Open in IMG/M |
| 2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005733 | Seawater microbial communities from Vineyard Sound, MA, USA - crude oil ammended T14 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005748 | Seawater microbial communities from Vineyard Sound, MA, USA - control T7 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011251 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019700 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MG | Environmental | Open in IMG/M |
| 3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021471 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-2-3_MG | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022307 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023086 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025156 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026423 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027183 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029632 | Marine harbor viral communities from the Pacific Ocean - SMB3 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASHM260b_02942330 | 2088090012 | Coastal Water And Sediment | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCT |
| ASHM260b_00995800 | 2088090012 | Coastal Water And Sediment | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEIQCT |
| ASLM20b_05435770 | 2100351001 | Coastal Water And Sediment | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEVQCTKLHKI |
| ASMM170b_03793130 | 2100351011 | Coastal Water And Sediment | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT |
| ASHM485C_01739090 | 2140918005 | Coastal Water And Sediment | MKQDFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT |
| GS312G0146KB_00263500 | 2189573027 | Marine Estuarine | MKLDFNEWMASIKNIYYADNEKMLNAFEKLEEDEEV |
| DelMOSum2010_1002005910 | 3300000101 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCTKLCKI* |
| DelMOSum2010_100212263 | 3300000101 | Marine | MKLDFNEWMASIKNIYYADNEQMLNAFEKIEINEEI* |
| DelMOSum2010_100378882 | 3300000101 | Marine | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNDNEKI* |
| DelMOSum2010_100410823 | 3300000101 | Marine | MKLDFNEWMASIKNIYYADNEKMLNAFEKLEEDEEV* |
| DelMOSum2010_100457414 | 3300000101 | Marine | MRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEEV* |
| DelMOSum2010_100715982 | 3300000101 | Marine | MKQKFNEWMASIGNIYYADNNLMSKALEKIQDNEKV* |
| DelMOSum2010_100770374 | 3300000101 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEVQCT* |
| DelMOSum2010_100872292 | 3300000101 | Marine | MRKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| DelMOSum2010_101288972 | 3300000101 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| DelMOSum2010_101798192 | 3300000101 | Marine | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI* |
| DelMOSum2010_102740662 | 3300000101 | Marine | MKLDFNEWMARIKNIYYADNEQMLNAFEKLEKDEEV* |
| DelMOSum2011_100272275 | 3300000115 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEIQCT* |
| DelMOSum2011_100486722 | 3300000115 | Marine | MREKFNEWMASIGNIYYADNEMMDRAFEKIDQYEKI* |
| DelMOSum2011_101796273 | 3300000115 | Marine | MKQKFNEWMASIGNIYYADNELMSQAFEKIEDNEEI* |
| DelMOSpr2010_100341383 | 3300000116 | Marine | MKLDFNEWMARIKNIYYADNEKMLNAFEKLEKDEEV* |
| TDF_OR_ARG05_123mDRAFT_100014325 | 3300000118 | Marine | MKNDFNEWMASIGNIYYSDNELMLHAFEKLDDYEEI* |
| TDF_OR_ARG05_123mDRAFT_10214552 | 3300000118 | Marine | MKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| KGI_S1_ANT01_95mDRAFT_100652722 | 3300000119 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQRA* |
| TDF_OR_ARG04_113mDRAFT_10015403 | 3300000121 | Marine | MKQDFNEWMANIGNIYYADXRLMSQAFEKLEDYEEI* |
| TDF_OR_ARG04_113mDRAFT_10020497 | 3300000121 | Marine | MRKDFNEWMASIGNIYYANDNLMAKAFEKINEYEEI* |
| BS_KBA_SWE12_21mDRAFT_100108516 | 3300000124 | Marine | MSKEFNEWMAYIGNIYYANNALMEKAFEKLEKNEEI* |
| SA_S1_NOR05_45mDRAFT_100065086 | 3300000127 | Marine | MKEQFNEWMLSIGNIYYSNNELMCKAFEKIEDNEKV* |
| SA_S1_NOR05_45mDRAFT_100312233 | 3300000127 | Marine | MKQDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCT* |
| SA_S1_NOR08_45mDRAFT_101529192 | 3300000128 | Marine | KNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCTKLCKI* |
| LPaug09P1610mDRAFT_10027404 | 3300000149 | Marine | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV* |
| LPaug09P1610mDRAFT_10044645 | 3300000149 | Marine | MKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV* |
| SI34jun09_10mDRAFT_10565122 | 3300000224 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCAELCKI* |
| TDF_OR_ARG05_123mDRAFT_10343672 | 3300000242 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDDYEEI* |
| BpDRAFT_100518065 | 3300000930 | Freshwater And Marine | MKKDFNEWMASIGNIYYSDNNLMSQAFEKIEDNEEI* |
| BBAY92_100846233 | 3300000947 | Macroalgal Surface | MKEFDEWMARIGNIYYANNELMEKAFDKIEQNEKV* |
| BBAY93_100453423 | 3300000973 | Macroalgal Surface | MKEFNEWMARIGNIYYANNELMEKAFDKIEQHEKI* |
| JGI20154J14316_100549302 | 3300001348 | Pelagic Marine | MKKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV* |
| JGI20154J14316_100860563 | 3300001348 | Pelagic Marine | RTFKPTIMIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNDEEI* |
| JGI20154J14316_101177102 | 3300001348 | Pelagic Marine | KERKRTFKPTIMIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT* |
| JGI20153J14318_100030828 | 3300001351 | Pelagic Marine | MREKFNEWMASIGNIYYADNEMMDRAFEKIDRYEKI* |
| JGI20153J14318_100461674 | 3300001351 | Pelagic Marine | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCTQLYKI* |
| JGI24006J15134_100653233 | 3300001450 | Marine | MKEFNEWMASIGNIYYANNILMEKAFEKIEQYEKI* |
| JGI24003J15210_100084672 | 3300001460 | Marine | MKEFNEWMASICNIYYANNELMEKAFDKIEQYEKI* |
| JGI24003J15210_100242094 | 3300001460 | Marine | MKNDFNEWMANIGNIYYADNELMSHAFEKLDNYEEIQCAELCKI* |
| JGI24003J15210_100512562 | 3300001460 | Marine | MVKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV* |
| JGI24003J15210_100597232 | 3300001460 | Marine | MKHKFNEWMASIGSIYYANNELMEKAFDKIEQHEEI* |
| JGI24003J15210_100644172 | 3300001460 | Marine | MKIDFNEWMASIKNIYYADNEQMLNAFEKIKTNEEI* |
| JGI24003J15210_101523372 | 3300001460 | Marine | MIKEFNEWMASIGXVYYANNELMEKAFDKIEQYEKV* |
| JGI24004J15324_100162491 | 3300001472 | Marine | MKLXFNEWMASIKNIYYADNEKMXNAFEKLXEDEEV* |
| JGI24004J15324_100291793 | 3300001472 | Marine | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQXEKV* |
| JGI24004J15324_100317965 | 3300001472 | Marine | MIKEFNEWMARIGNIYYANNFLMEKAFEKIEQHEKI* |
| JGI24004J15324_100523983 | 3300001472 | Marine | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKI* |
| GOS2242_10288594 | 3300001967 | Marine | MIQDFNEWMQRIGNIYYANNELMEKAFDKIEEYEKV* |
| GOScombined01_1030263362 | 3300002040 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEV* |
| Ga0055584_1017278192 | 3300004097 | Pelagic Marine | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT* |
| Ga0065861_10145512 | 3300004448 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCTELCKI* |
| Ga0066222_10823371 | 3300004460 | Marine | KRIIKPTIMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEEV* |
| Ga0066223_10886202 | 3300004461 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCT* |
| Ga0074648_10237484 | 3300005512 | Saline Water And Sediment | MKQEFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0074648_11824702 | 3300005512 | Saline Water And Sediment | MSKEFNEWMASIGNIYYADNELMSQAYDKIEQYEKV* |
| Ga0070728_104542062 | 3300005588 | Marine Sediment | RNMKLDFNEWMASIKNIYYADNEQMLNAFEKIEINEEI* |
| Ga0070728_107382632 | 3300005588 | Marine Sediment | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0070729_102278522 | 3300005589 | Marine Sediment | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQHEKV* |
| Ga0070727_104941932 | 3300005590 | Marine Sediment | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQNEKV* |
| Ga0070726_103351062 | 3300005600 | Marine Sediment | MKLDFNEWMANIKNIYYADNEQMLNAFEKIETNEEI* |
| Ga0076921_1107772 | 3300005733 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKIEEYEEI* |
| Ga0076924_11310804 | 3300005747 | Marine | MTKEFNEWMASIGNIYYANNELMSQAYDKIEEYEKV* |
| Ga0076925_10276721 | 3300005748 | Marine | MKQDFNEWMANIGNIYYSDNRLMSQAFEKLEEYEEI* |
| Ga0078746_10216742 | 3300005821 | Marine Sediment | MIMEKKFNEWMASIGNIYYSNNEMMDRAFEKINEYEKI* |
| Ga0078746_10505782 | 3300005821 | Marine Sediment | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEEYEEVQCT* |
| Ga0078893_104069317 | 3300005837 | Marine Surface Water | MRKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEKV* |
| Ga0075119_10388832 | 3300005931 | Saline Lake | MEKKFNEWMASIGNIYYADDEKMARAFKIIEDYEKL* |
| Ga0070743_100747622 | 3300005941 | Estuarine | MTANNFNEWMASIGNIYYADNNLMSQAFEKLNDNEKI* |
| Ga0070742_100981122 | 3300005942 | Estuarine | MSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEI* |
| Ga0075466_10846402 | 3300006029 | Aqueous | MTANGFNEWMANIGNIYYADNNLMSQAFEKLNNNEEI* |
| Ga0075466_11044112 | 3300006029 | Aqueous | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNEKI* |
| Ga0075466_11964402 | 3300006029 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEIQCT* |
| Ga0075441_100376976 | 3300006164 | Marine | MVNNFNEWMFKIGNIYYANDELMAKAFEQIERYEKV* |
| Ga0075494_10651311 | 3300006382 | Aqueous | MKQKFNEWMASIGNIYYADNNLMSQAFEKLNNNEKI* |
| Ga0070744_100109891 | 3300006484 | Estuarine | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0070744_100615902 | 3300006484 | Estuarine | MSKDFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI* |
| Ga0070744_101798042 | 3300006484 | Estuarine | MRQNFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI* |
| Ga0098073_10024117 | 3300006734 | Marine | MTKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV* |
| Ga0098038_10326163 | 3300006735 | Marine | MKEFNEWMARIGNIYYANNKLMEKAFDKIEQHEKV* |
| Ga0098038_10344371 | 3300006735 | Marine | MIKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV* |
| Ga0098037_12953013 | 3300006737 | Marine | MKEFNEWMARIGNIYYANNELMEKAFDKIEQHEKV* |
| Ga0098058_11468231 | 3300006750 | Marine | KEFNEWMARIGNIYYANNELMEKAFDKIEQNEKV* |
| Ga0098048_10276983 | 3300006752 | Marine | MSKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV* |
| Ga0098048_12625182 | 3300006752 | Marine | MSKEFNEWMASIGNIYYANNELMSQAFEKLESNEEV* |
| Ga0098054_11214371 | 3300006789 | Marine | KRKRLFKSTIMTKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV* |
| Ga0098054_11355292 | 3300006789 | Marine | MIAKEFNEWMASINNIYYADNNLMSQAFEKLKDNEEI* |
| Ga0098055_100323316 | 3300006793 | Marine | MTASNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEI* |
| Ga0098055_10408832 | 3300006793 | Marine | MRKDFNEWMASIKNIYYADNNLMSQAFEKIEDNEEV* |
| Ga0098055_10929961 | 3300006793 | Marine | RIIKSTIMKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| Ga0098055_13073892 | 3300006793 | Marine | MIKDFNEWMASIGNIYYADNKLMSQAFEKLEEYEKI* |
| Ga0098055_13518531 | 3300006793 | Marine | MKEFNEWMARIGNIYYANNKLMEKAFDKIEQHEKI* |
| Ga0098055_13551632 | 3300006793 | Marine | MSKEFNEWMASIGNIYYANNELMSQAFEKLESNEKV* |
| Ga0098055_13605712 | 3300006793 | Marine | MKLDFNEWMASIKNIYYADNEKMLNAFEKIDKDEEV* |
| Ga0070749_100222765 | 3300006802 | Aqueous | MSKEFNEWMAYIGNIYYAQNELMEKAFEKLEKNEKI* |
| Ga0070749_100259204 | 3300006802 | Aqueous | MSREFNEWMAYIGNVYYAQNELMEKAFEKLENNEKI* |
| Ga0070749_100632462 | 3300006802 | Aqueous | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCAKLCKI* |
| Ga0070749_100935234 | 3300006802 | Aqueous | MKQKFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV* |
| Ga0070754_102454932 | 3300006810 | Aqueous | MKLDFNEWMASIKNIYYADNEKMLNAFEKLEENEEV* |
| Ga0070754_104842712 | 3300006810 | Aqueous | MSKEFNEWMAKIGNIYYANNELMSQAYDKIEEYEKV* |
| Ga0070750_100777882 | 3300006916 | Aqueous | MKQDFNEWMASIGNIYYSDNRLMSQAFEKIEEYEEI* |
| Ga0070750_102784332 | 3300006916 | Aqueous | MSKEFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV* |
| Ga0070746_101173671 | 3300006919 | Aqueous | KQRIMKQDFNEWMANIGNIYYADNRLMSQAFEKIEEYEEI* |
| Ga0098051_11837221 | 3300006924 | Marine | TIMKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| Ga0098036_11665782 | 3300006929 | Marine | MKEFNEWMAHIGNIYYANNELMEKAFDKIEQNEKV* |
| Ga0075444_100593914 | 3300006947 | Marine | KQRNMKQDFNEWMANIKNIHYADNEQMLNAFEKLDNYEEI* |
| Ga0070747_10559062 | 3300007276 | Aqueous | MIKDFNEWMASIGNIYYADNELMSQAFEKLEKYEKI* |
| Ga0070745_12860682 | 3300007344 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEKI* |
| Ga0070752_10205361 | 3300007345 | Aqueous | KDFNEWMASIGNIYYANDNLMAEAFEKIDQYEEV* |
| Ga0070752_10582583 | 3300007345 | Aqueous | MKLDFNEWMANIKNIYYADNEQMLNAFEKIEINEEI* |
| Ga0070753_13031483 | 3300007346 | Aqueous | MKQKFNEWMAKIGNVYYANNELMSQAYDKIEAYEKV* |
| Ga0105050_102120822 | 3300007516 | Freshwater | MNNKINKLCMVKDFNEWMASIGNIYYADDELMAKAFEKISKNEKL* |
| Ga0099851_100420010 | 3300007538 | Aqueous | MSKEFNEWMASIGNIYYANNELMSQAYDKIEEYEKV* |
| Ga0099851_11199842 | 3300007538 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEV* |
| Ga0099847_12154313 | 3300007540 | Aqueous | MKQKFNEWMAKIGNVYYANNELMSQAYNKIEEYEKV* |
| Ga0099847_12413912 | 3300007540 | Aqueous | MKQKFNEWMAKIGNIYYANNELMSQAYDKIEEYEKV* |
| Ga0099846_10601702 | 3300007542 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEEYEEI* |
| Ga0102879_11105421 | 3300007549 | Estuarine | KRKRIIKSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0102818_10065663 | 3300007552 | Estuarine | MTAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0102818_10968401 | 3300007552 | Estuarine | RIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0102862_11954812 | 3300007670 | Estuarine | MKLDFNEWMASIKNIYYADNEKMLNAFEKLKEDEEV* |
| Ga0105744_10135523 | 3300007863 | Estuary Water | MRKDFNEWMASIGNIYYSDNNLMSQAFEKIEDNEEI* |
| Ga0105743_10414402 | 3300007958 | Estuary Water | MRQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0102907_10752912 | 3300007962 | Estuarine | IMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0105746_13252002 | 3300007973 | Estuary Water | MIKDFNEWMASIGNIYYADNELMSQAFEKLEEYEKI* |
| Ga0105748_100115764 | 3300007992 | Estuary Water | MKKDFNEWMASIGNIYYSDNNLMSQAFEKIEDNEKI* |
| Ga0105748_104066431 | 3300007992 | Estuary Water | NMIKDFNEWMASIGNIYYADNKLMSQAFEKLEEYEKI* |
| Ga0115371_102844833 | 3300008470 | Sediment | MKEKFNEWMASIGNVYYSNNELMCKAFEKIEDNEKV* |
| Ga0115371_104274445 | 3300008470 | Sediment | MKQDFNEWMASIGNIYYANNRLMSQAFEKLEDYEEI* |
| Ga0102816_11955192 | 3300008999 | Estuarine | MIKDFNEWMASIGNIYYADNELMSQAFEKLEKYEEI* |
| Ga0102813_10728761 | 3300009003 | Estuarine | NMTANNFNEWMASIGNIYYADNNLMSQAFEKLNDNEKI* |
| Ga0102811_13477392 | 3300009024 | Estuarine | MSKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKI* |
| Ga0114950_113490532 | 3300009030 | Deep Subsurface | MIKEFNEWMASIGNIYYANNELMEKAFDKIEQHEKV* |
| Ga0102911_11248851 | 3300009049 | Estuarine | RIIKSRIMKQDFNEWMASIGNIYYADNRLMSHAFEKLEDYEEI* |
| Ga0102886_11009131 | 3300009052 | Estuarine | QDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0102826_11530141 | 3300009054 | Estuarine | KRLFKSTIMSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEI* |
| Ga0102860_11420962 | 3300009056 | Estuarine | MIKEFNEWMASIGNIYYANNKLMEKAFDKIEQNEKV* |
| Ga0115549_10142015 | 3300009074 | Pelagic Marine | MRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV* |
| Ga0115549_10904322 | 3300009074 | Pelagic Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEEYEEV* |
| Ga0115549_11952082 | 3300009074 | Pelagic Marine | MIKEFNEWMASIGNVYYANNELMEKAFDKIEENEKV* |
| Ga0115549_12977561 | 3300009074 | Pelagic Marine | RIIKSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0115550_10597233 | 3300009076 | Pelagic Marine | MTANGFNEWMANIGNIYYADNNLMSQAFEKLNDNEKI* |
| Ga0115550_10895141 | 3300009076 | Pelagic Marine | KDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV* |
| Ga0102814_107178341 | 3300009079 | Estuarine | RIIKSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEYYEEI* |
| Ga0102812_100578474 | 3300009086 | Estuarine | MSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEV* |
| Ga0102812_101428143 | 3300009086 | Estuarine | KSRIMKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0118736_100826272 | 3300009135 | Marine Sediment | MKLDFNEWMANIKNIYYADNEQMLNAFEKIKTNEEI* |
| Ga0118736_101113232 | 3300009135 | Marine Sediment | MKLDFNEWMASIKNIYYADNEQMLNAFEKIKTNEEI* |
| Ga0118735_100417503 | 3300009136 | Marine Sediment | IKQRDMKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCT* |
| Ga0114995_1000654022 | 3300009172 | Marine | MIAENFNDWMASIKNIYYADNNLMSQAFEKLNDNDEKI* |
| Ga0114995_100472943 | 3300009172 | Marine | MKEKFNEWMASIGNVYYANNEMMDRAFEKIDQYEKI* |
| Ga0114998_100479943 | 3300009422 | Marine | MKNDFNEWMASIGNIYYSDNELMSHAFEKLDNYEEI* |
| Ga0115548_10736791 | 3300009423 | Pelagic Marine | IMRKDFNEWMASIGNIYYANDNLMAEALEKIDQYEKV* |
| Ga0114915_10057984 | 3300009428 | Deep Ocean | MKKEFNEWMASIGNVYYANNEMMDRAFEKIDQYEEI* |
| Ga0114915_10091352 | 3300009428 | Deep Ocean | MKEKFNEWMLSIGNIYYSNNELMCKAFEKIEDNEKV* |
| Ga0114915_11496482 | 3300009428 | Deep Ocean | MTAENFNEWMASIKNIYYADNNLMSQAFEKLNNTDEEI* |
| Ga0115005_108496862 | 3300009432 | Marine | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNYEEI* |
| Ga0115005_116965161 | 3300009432 | Marine | RIAKPTTMIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0115546_12372722 | 3300009435 | Pelagic Marine | MKQKFNEWMASIGNIYYANNELMEKAFDKIEQHEEI* |
| Ga0115008_103569031 | 3300009436 | Marine | KPTIMIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0115560_10100221 | 3300009447 | Pelagic Marine | RIIKPTIMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEEV* |
| Ga0115560_10711031 | 3300009447 | Pelagic Marine | RIIKPTIMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV* |
| Ga0115565_100321621 | 3300009467 | Pelagic Marine | RIIKSAIMRQNFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI* |
| Ga0115571_11886112 | 3300009495 | Pelagic Marine | ANNFNEWMASIGNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0115571_13442262 | 3300009495 | Pelagic Marine | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNE |
| Ga0115564_102804852 | 3300009505 | Pelagic Marine | MTANGFNEWMANIGNIYYADNNLMSQAFEKLNNNEKI* |
| Ga0115003_100272983 | 3300009512 | Marine | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEI* |
| Ga0115003_101065344 | 3300009512 | Marine | MKEKFNEWMASIGNIYYSNNELMCKAFEKIEDNEKV* |
| Ga0115004_102117853 | 3300009526 | Marine | MKNDFNEWMASIGNIYYSDNELMSHAFEKLDNYEEIQCT* |
| Ga0114919_100798264 | 3300009529 | Deep Subsurface | MTKEFNEWMASIGNIYYANNELMSQAYDKIKEYEKV* |
| Ga0114919_102477422 | 3300009529 | Deep Subsurface | MKQKFNEWMASIGNIYYADNELMSKAFEKIEDNEEI* |
| Ga0115006_104580753 | 3300009544 | Marine | MKEKFNEWMLSIGNIYYSNNELMCKAFEKIEENEKV* |
| Ga0115013_100249811 | 3300009550 | Marine | MKEFNEWMARIGNIYYADNELMEKAFDKIEQHEKV* |
| Ga0115013_100864755 | 3300009550 | Marine | MKEFNEWMASIGNIYYANNELMEKAFDKIEQHEKI* |
| Ga0115011_115183082 | 3300009593 | Marine | MKDFNEWMARIGNIYYANNELMEKAFDKIEQHEKV* |
| Ga0115103_15137321 | 3300009599 | Marine | MKQDFNEWMANIGNIYYADNRLMSQAFEKIEDYEEI* |
| Ga0115103_15483411 | 3300009599 | Marine | KQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0115103_17166951 | 3300009599 | Marine | KSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0115001_101288282 | 3300009785 | Marine | MKLDFNEWMANIKNIYYADNEQMLNAFEKIRTNEKI* |
| Ga0098043_11317271 | 3300010148 | Marine | MKEFNEWMARIGNIYYANNELMEKAFDKIEQNEKV* |
| Ga0098056_10719042 | 3300010150 | Marine | MKLDFNEWMASIKNIYYADNEQMLNAFEKIDKDEEV* |
| Ga0098056_12020162 | 3300010150 | Marine | MSKEFNEWMASIGNIYYADNELMSQAFEKLEINEEI* |
| Ga0098059_12704131 | 3300010153 | Marine | DMKLDFNEWMASIKNIYYADNEQMLNAFEKIDKDEEV* |
| Ga0129342_10936262 | 3300010299 | Freshwater To Marine Saline Gradient | MTKEFNEWMAKIGNIYYANNELMSQAYDKIEEYEKV* |
| Ga0136651_102035473 | 3300010330 | Marine Hydrothermal Vent | MTKEFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV* |
| Ga0136651_102902572 | 3300010330 | Marine Hydrothermal Vent | MKEFNEWMARIGNIYYANNKLMEKAFEKFEQNEKV* |
| Ga0118731_1022075981 | 3300010392 | Marine | RKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| Ga0118731_1027039803 | 3300010392 | Marine | MKEQFNEWMLSIGNIYYSNNELMCKAFEKIEENEKV* |
| Ga0118731_1132471632 | 3300010392 | Marine | MKLDFNEWMASIKNIYYADNEQMLNAFEKINKNEEV* |
| Ga0136851_112115522 | 3300010413 | Mangrove Sediment | MTKEFNEWMANIGNIYYANNELMSQAYDKIEQYEKV* |
| Ga0118733_1028794171 | 3300010430 | Marine Sediment | KDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV* |
| Ga0118733_1040919081 | 3300010430 | Marine Sediment | RIMKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI* |
| Ga0118733_1041736091 | 3300010430 | Marine Sediment | KRKRTVKPTTMIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI* |
| Ga0118733_1055246302 | 3300010430 | Marine Sediment | MKQDFNDWMASIKNIYYSDNEKMLNAFEKIKENEEI* |
| Ga0151676_100199814 | 3300011251 | Marine | MIAKEFNEWMANIGNIYYADNNLMSRAFEKLKDNEEI* |
| Ga0151671_10023941 | 3300011253 | Marine | MIAKKFNEWMANIGNIYYADNNLMSQAFEKLKDNEEI* |
| Ga0151664_10113341 | 3300011256 | Marine | FKEWMANIGNRYYGDNRLMSQALEKLEEYEEIQCT* |
| Ga0163179_114546992 | 3300012953 | Seawater | MKKEFNEWMAKIGNVYYANNELMEKAFEKIEKHEKV* |
| Ga0164320_100166006 | 3300013098 | Marine Sediment | MKQDFNEWMASIGNIYYSDNRLMSQAFEKLEDYEEI* |
| Ga0164320_106830161 | 3300013098 | Marine Sediment | MKQKFNEWMASIGNIYYANNELMSQAFEKIEDNEEI* |
| Ga0164315_102646422 | 3300013099 | Marine Sediment | MKQKFNEWMANIGNIYYADNELMSQAFEKIEDNEEI* |
| Ga0164313_108520441 | 3300013101 | Marine Sediment | QKFNEWMASIGNIYYADNELMSQAFEKIEDNEEI* |
| Ga0164321_107785931 | 3300014903 | Marine Sediment | MIKEFNEWMANIGNIYYANNELMEKAFDKIEQNEKV* |
| Ga0180120_103080581 | 3300017697 | Freshwater To Marine Saline Gradient | RTFKQRNMKLDFNEWMARIKNIYYADNEQMLNAFEKLEKDEEV |
| Ga0180120_103905442 | 3300017697 | Freshwater To Marine Saline Gradient | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEE |
| Ga0181371_10767041 | 3300017704 | Marine | KTIMKEFNEWMARIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0181377_10985841 | 3300017706 | Marine | MKLDFNEWMASIKNIYYADNEQMLSAFEKIDKDEEV |
| Ga0181369_10385342 | 3300017708 | Marine | MRQDFNEWMASIKNIYYADNNLMSQAFEKIEDNEEV |
| Ga0181403_10017259 | 3300017710 | Seawater | MKQKFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0181391_10268342 | 3300017713 | Seawater | MIKEFNEWMASIGNVYYANNELMEKAFDKIEKYEKV |
| Ga0181412_10465922 | 3300017714 | Seawater | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKI |
| Ga0181412_10971393 | 3300017714 | Seawater | MKEFNEWMASIGNVYYANNELMEKAFDKIEQNEKV |
| Ga0181412_11464093 | 3300017714 | Seawater | MIREFNEWMASIGNIYYANNELMEKAFDKIEKNEKV |
| Ga0181390_10345091 | 3300017719 | Seawater | KSTIMSKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0181373_10115744 | 3300017721 | Marine | MIKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0181388_10079511 | 3300017724 | Seawater | KSTIMTKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0181398_100170413 | 3300017725 | Seawater | MIKDFNEWMASIGNIYYANNELMSQAFEKLEKYEKI |
| Ga0181419_10146424 | 3300017728 | Seawater | MRKDFNEWMASIGNIYYSDNNLMSQAFEKIEDNEE |
| Ga0181417_10507172 | 3300017730 | Seawater | MKEFNEWMASIGNIYYANNELMEKAFDKIEQHEKV |
| Ga0181416_10472893 | 3300017731 | Seawater | FIKQTIMIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0187222_10074629 | 3300017734 | Seawater | MKQKFNEWMACIGNIYYANNELMEKAFDKIEKYEEI |
| Ga0181433_10742103 | 3300017739 | Seawater | MIKEFNEWMASIGNVYYANNELMEKAFDKIEKNEKV |
| Ga0181418_10548091 | 3300017740 | Seawater | MKQDFNEWMASIGNIYYSDNKLMSQAFEKLEDYEEI |
| Ga0181397_10715562 | 3300017744 | Seawater | MIKEFNEWMANIGNVYYANNELMEKAFDKIEQHEKV |
| Ga0181393_10217272 | 3300017748 | Seawater | MIKEFNEWMANIGNVYYANNELMEKAFDKIEQYEKI |
| Ga0181411_12089021 | 3300017755 | Seawater | MIKEFNEWMASIGNVYYANNELMEKAFYKIEQNEKV |
| Ga0181410_12013631 | 3300017763 | Seawater | QTIMIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0181413_100118111 | 3300017765 | Seawater | MIKDFNEWMASIGNIYYADNELMSQACEKLEKYEKI |
| Ga0181425_10433103 | 3300017771 | Seawater | MKQKFNEWMASIGNIYYANNELMSQAFEKLESNEEV |
| Ga0181430_10092917 | 3300017772 | Seawater | NIKSRNMIKDFNEWMASIGNIYYADNELMSQAFEKLEKYEKI |
| Ga0181432_10841933 | 3300017775 | Seawater | MIKEFNEWMARIGNIYYANNELMEKAFDKIEQYEKV |
| Ga0181395_10441523 | 3300017779 | Seawater | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQHEKV |
| Ga0181552_104541212 | 3300017824 | Salt Marsh | MKQDFNEWMANIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0180434_103043811 | 3300017991 | Hypersaline Lake Sediment | MTKEFNEWMAKIGNIYYANNELMSQAYDKIEEYEKV |
| Ga0180433_108183193 | 3300018080 | Hypersaline Lake Sediment | MKQKFNEWMAKIGNIYYANNDLMSQAYDKIEEYEKV |
| Ga0181563_103625092 | 3300018420 | Salt Marsh | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEEYEEI |
| Ga0194006_10040802 | 3300019700 | Sediment | MKQKFNEWMASIGNIYYADNELMSQAFEKIEDNEEI |
| Ga0193973_10705532 | 3300019737 | Sediment | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQNEKV |
| Ga0194029_10753332 | 3300019751 | Freshwater | MSKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0206125_100043319 | 3300020165 | Seawater | MRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEEV |
| Ga0206125_100128122 | 3300020165 | Seawater | MRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0206125_101605732 | 3300020165 | Seawater | KRIIKPTIMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0206128_10184656 | 3300020166 | Seawater | MRQNFNEWMAPIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0206128_11239873 | 3300020166 | Seawater | MREKFNEWMASIGNIYYADNEMMDRAFEKIDRYEKI |
| Ga0206127_10668842 | 3300020169 | Seawater | MRQNFNEWMANIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0181602_100538292 | 3300020173 | Salt Marsh | MTKEFNEWMASIGNIYYANNELMSQAYDKIEEYEKV |
| Ga0206129_1000836516 | 3300020182 | Seawater | MREKFNEWMASIGNIYYADNEMMDRAFEKIDQYEKI |
| Ga0206129_100177426 | 3300020182 | Seawater | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEEYEEV |
| Ga0206129_100222475 | 3300020182 | Seawater | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNDEEI |
| Ga0206129_103125671 | 3300020182 | Seawater | IMIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT |
| Ga0206129_104104101 | 3300020182 | Seawater | IKSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0206131_100166667 | 3300020185 | Seawater | MRQNFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0206131_100320747 | 3300020185 | Seawater | KRTFKPTIMIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNDEEI |
| Ga0206131_100460768 | 3300020185 | Seawater | MTANGFNEWMANIGNIYYADNNLMSQAFEKLKDNEEI |
| Ga0206131_100563404 | 3300020185 | Seawater | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0206131_100656446 | 3300020185 | Seawater | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0206131_101156562 | 3300020185 | Seawater | MKQEFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0206130_102538451 | 3300020187 | Seawater | MKQDFNEWMANIGNIYYADNRLMSQAFEKLENYEEI |
| Ga0211504_10100222 | 3300020347 | Marine | MKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV |
| Ga0211504_10132533 | 3300020347 | Marine | MTKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0211505_10018767 | 3300020352 | Marine | MTKEFNEWMASIGNVYYANNELMEKAFDKIEQNEKV |
| Ga0211659_100414634 | 3300020404 | Marine | MIQDFNEWMQRIGNIYYANNELMEKAFDKIEEYEKV |
| Ga0211554_103286752 | 3300020431 | Marine | MIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0211576_106860862 | 3300020438 | Marine | MKLDFNEWMASIKNIYYADNEQMLNAFEKINKNEEV |
| Ga0211545_100260574 | 3300020452 | Marine | MIKEFNEWMAGIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0211577_107369723 | 3300020469 | Marine | MIKEFNEWMASIGNIYYANNELMEKAFDKIEKNEKV |
| Ga0206126_101569161 | 3300020595 | Seawater | MKKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0206677_100201823 | 3300021085 | Seawater | MTANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEKI |
| Ga0206677_100630904 | 3300021085 | Seawater | MTANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEI |
| Ga0213862_102090232 | 3300021347 | Seawater | MKQKFNEWMASIGNIYYADNELMSQAFEKIEEYEEI |
| Ga0213862_103196551 | 3300021347 | Seawater | TFKSTIMTANGFNEWMANIGNIYYANNNLMSQAFEKLNNNEEI |
| Ga0206123_101433502 | 3300021365 | Seawater | MKLNFNEWMDSIKNIYYADNEQMLNAFEKIDEDEEV |
| Ga0213863_100457141 | 3300021371 | Seawater | MRQNFNEWMASIGNIYYANDNLMAKAFEKIDQYEEV |
| Ga0213863_102095512 | 3300021371 | Seawater | MTANGFNEWMANIGNIYYADNNLMSQAFEKLNNNEEI |
| Ga0213865_104978982 | 3300021373 | Seawater | MKQKFNEWMANIGNIYYADNELMSQAFEKIEDNEEI |
| Ga0213869_102012992 | 3300021375 | Seawater | MKEFNEWMARIGNIYYANNELMEKAFDKIEQHEKV |
| Ga0213861_101000684 | 3300021378 | Seawater | IKSRIMKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0213868_101045061 | 3300021389 | Seawater | KSRMMKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0213868_101063032 | 3300021389 | Seawater | MRKDFNEWMASIGNIYYANDNLMAKAFEKIDQYEEV |
| Ga0190359_10077695 | 3300021471 | Hydrothermal Vent Microbial Mat | MKEFNEWMARIGNIYYANNKLMEKAFEKFEQNEKV |
| Ga0190359_10196815 | 3300021471 | Hydrothermal Vent Microbial Mat | MIKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0226832_101151773 | 3300021791 | Hydrothermal Vent Fluids | MKEFNEWMARIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0222717_103085942 | 3300021957 | Estuarine Water | MSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEI |
| Ga0222717_106199452 | 3300021957 | Estuarine Water | KQRDMKLDFNEWMASIKNIYYADNEKMLNAFEKLEEDEEV |
| Ga0222715_100014408 | 3300021960 | Estuarine Water | MSKEFNEWMAYIGNIYYANNALMEKAFEKLEKNEEI |
| Ga0222714_100414897 | 3300021961 | Estuarine Water | MSKEFNEWMAYIGNIYYAQNELMEKAFEKLEKNEKI |
| Ga0222719_1000026920 | 3300021964 | Estuarine Water | MKKDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0222719_102810801 | 3300021964 | Estuarine Water | MTKEFNEWMANIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0212030_10004906 | 3300022053 | Aqueous | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEIQCT |
| Ga0212030_10006034 | 3300022053 | Aqueous | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCTKLCKI |
| Ga0212030_10462102 | 3300022053 | Aqueous | MSKEFNEWMASIGNIYYANNELMSQAYDKIEEYEKV |
| Ga0212023_10175952 | 3300022061 | Aqueous | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNEKI |
| Ga0212023_10662461 | 3300022061 | Aqueous | MKLDFNEWMARIKNIYYADNEQMLNAFEKVEKDEEV |
| Ga0212029_10086762 | 3300022063 | Aqueous | MIANDFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT |
| Ga0212029_10171892 | 3300022063 | Aqueous | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEVQCT |
| Ga0212029_10217712 | 3300022063 | Aqueous | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEKI |
| Ga0212026_10550522 | 3300022069 | Aqueous | MKLDFNEWMARIKNIYYADNEQMLNAFEKLEKDEEV |
| Ga0224906_10312044 | 3300022074 | Seawater | MKQKFNEWMASIGNIYYANNELMSQAFEKIEDNEEI |
| Ga0212022_10097273 | 3300022164 | Aqueous | TFKQRNMKLDFNEWMARIKNIYYADNEQMLNAFEKLEKDEEV |
| Ga0196903_10167292 | 3300022169 | Aqueous | NKKRKSTFKSTIMTANGFNEWMANIGNIYYADNNLMSQAFEKLNNNEEI |
| Ga0196899_10952752 | 3300022187 | Aqueous | MRKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV |
| Ga0196901_10423274 | 3300022200 | Aqueous | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEIQCT |
| Ga0224513_100395293 | 3300022220 | Sediment | MIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI |
| Ga0224509_103425382 | 3300022306 | Sediment | MSKEFNEWMASIGNIYYANNELMSQAFEKLESNEKV |
| Ga0224507_101999452 | 3300022307 | Sediment | MSKEFNEWMASIGNIYYADNELMSQAFEKLESNEE |
| Ga0224507_103511421 | 3300022307 | Sediment | MSKEFNEWMASIGNIYYADNELMSQAYDKIEQYEKV |
| Ga0224504_104199792 | 3300022308 | Sediment | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCAELCKI |
| (restricted) Ga0233409_100173762 | 3300022938 | Seawater | MIKEFNEWMASIGNIYYANNKLMEKAFDKIEQNEKV |
| (restricted) Ga0233409_100844742 | 3300022938 | Seawater | MKLDFNEWMASIKNVYYADNEKMLNAFEKIEKDEEV |
| (restricted) Ga0233409_101852142 | 3300022938 | Seawater | MKKDFNEWMASIGNIYYANDNLMSRAFEKIDQYENR |
| (restricted) Ga0233407_100585532 | 3300023086 | Seawater | MKQDFNEWMANIGNIYYADNRLMSQAFEKLKDYEEI |
| (restricted) Ga0233408_100226762 | 3300023089 | Seawater | MKKDFNEWMASIGNIYYANDNLMSRAFEKIDEYEEI |
| (restricted) Ga0233432_103717152 | 3300023109 | Seawater | MTAENFNEWMASIGNIYYADNNLMSQAFEKLNNNDEEI |
| (restricted) Ga0233411_100655952 | 3300023112 | Seawater | MIAKEFNEWMASIKNIYYADNNLMSKAFEKLEDNEEI |
| (restricted) Ga0233412_100424003 | 3300023210 | Seawater | MKQDFNEWMASIGNIYYSDNRLMSQAFEKIEEYEEI |
| (restricted) Ga0233412_100688913 | 3300023210 | Seawater | MKLDFNEWMANIKNIYYADNEQMLNAFEKIEINEEI |
| (restricted) Ga0233412_101073012 | 3300023210 | Seawater | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEI |
| (restricted) Ga0233412_101442232 | 3300023210 | Seawater | MIKDFNEWMASIGNIYYADNELMSQAFEKLEKYEEI |
| (restricted) Ga0233412_101722942 | 3300023210 | Seawater | MRKKFNEWMASIGNIYYADNEMMDRAFEKIDQYEKI |
| (restricted) Ga0233412_102198772 | 3300023210 | Seawater | MSKEFNEWMASIGNIYYANNKLMSQAYDKIEKYEKV |
| (restricted) Ga0233412_103541812 | 3300023210 | Seawater | MIANNFNEWMASIGNIYYADNNLMSQAFEKLNDNEKI |
| (restricted) Ga0233410_100250372 | 3300023276 | Seawater | MKLDFNEWMASIKNVYYADNEKMLNAFEKLEKNEEV |
| (restricted) Ga0233410_101470192 | 3300023276 | Seawater | MSKEFNEWMESIGNIYYANNELMSQAYDKIEEYEKV |
| (restricted) Ga0255040_101208062 | 3300024059 | Seawater | MSKEFNEWMASIGNIYYANNELMSQAYDKIKQYEKV |
| (restricted) Ga0255040_104698462 | 3300024059 | Seawater | MKLDFNEWMASIKNIYYADNEKMLNAFEKIDKDEEV |
| Ga0228636_100094410 | 3300024191 | Seawater | MRKNFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0228633_10551912 | 3300024228 | Seawater | MSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEV |
| Ga0228673_10472322 | 3300024242 | Seawater | ERKRLFKSTIMSKEFNEWMASIGNIYYANNELMSQAFEKLESNEEV |
| (restricted) Ga0233438_100294266 | 3300024255 | Seawater | RIIKSRIMKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEV |
| Ga0210003_12907042 | 3300024262 | Deep Subsurface | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0228629_11238381 | 3300024296 | Seawater | MKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEE |
| Ga0244775_100350682 | 3300024346 | Estuarine | MSKDFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0244775_111142192 | 3300024346 | Estuarine | KSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEYYEEI |
| Ga0228650_10695612 | 3300024417 | Seawater | MIKDFNEWMASIGNIYYADNELMSQAFEKLEKYEKI |
| Ga0209986_100316264 | 3300024433 | Deep Subsurface | MTKEFNEWMASIGNIYYANNELMSQAYDKIKEYEKV |
| Ga0209986_101021781 | 3300024433 | Deep Subsurface | MKQKFNEWMASIGNIYYADNELMSKAFEKIEDNEEI |
| Ga0209986_101861252 | 3300024433 | Deep Subsurface | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEEYEEI |
| (restricted) Ga0255049_101711821 | 3300024517 | Seawater | KKDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0255049_103342961 | 3300024517 | Seawater | MKLDFNEWMASIKNVYYADNEKMLNAFEKIEKDEGV |
| (restricted) Ga0255048_100207782 | 3300024518 | Seawater | MKKDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0255046_101485053 | 3300024519 | Seawater | SRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0255047_106071332 | 3300024520 | Seawater | MKLDFNEWMASIKNVYYADNEKMLNAFEKLEKDEEV |
| (restricted) Ga0255047_106486521 | 3300024520 | Seawater | MSKEFNEWMESIGNIYYANNKLMSQAYDKIEEYEKV |
| (restricted) Ga0255056_101741202 | 3300024521 | Seawater | MKNDFNEWMASIGNIYYADNELMSHAFKKLDNYEEIQCTKLCKI |
| (restricted) Ga0255045_100109041 | 3300024528 | Seawater | IMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0255045_100725651 | 3300024528 | Seawater | KQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0255044_100784333 | 3300024529 | Seawater | KRTVKPTIMIAENFNEWMASIKNIYYADNNLMSQAFEKLNNNNEEI |
| (restricted) Ga0255044_100815401 | 3300024529 | Seawater | KPTIMIANNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEIQCT |
| (restricted) Ga0255044_103102502 | 3300024529 | Seawater | IKSRIMKKDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0207905_10510422 | 3300025048 | Marine | MKLDFNEWMASIKNIYYADNEQMLNAFEKIKTNEEI |
| Ga0207896_10448842 | 3300025071 | Marine | MKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0207896_10633042 | 3300025071 | Marine | MKEFNEWMASIGNIYYANNILMEKAFEKIEQYEKI |
| Ga0208298_100053023 | 3300025084 | Marine | MRKDFNEWMASIKNIYYADNNLMSQAFEKIEDNEEV |
| Ga0208298_10181092 | 3300025084 | Marine | MIAKEFNEWMASINNIYYADNNLMSQAFEKLKDNEEI |
| Ga0208298_10372702 | 3300025084 | Marine | MTASNFNEWMASIGNIYYADNNLMSQAFEKLNNNEEI |
| Ga0208157_10095524 | 3300025086 | Marine | MKEFNEWMARIGNIYYANNKLMEKAFDKIEQHEKV |
| Ga0208159_10720612 | 3300025101 | Marine | TNATRIMKEFNEWMARIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0208666_11070421 | 3300025102 | Marine | FTKQTIMIKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0209535_10001007 | 3300025120 | Marine | MKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0209535_100725916 | 3300025120 | Marine | MKEFNEWMASICNIYYANNELMEKAFDKIEQYEKI |
| Ga0209535_10124499 | 3300025120 | Marine | MKHKFNEWMASIGSIYYANNELMEKAFDKIEQHEEI |
| Ga0209535_10127749 | 3300025120 | Marine | MKQKFNEWMASIGNIYYADNNLMSKALEKIQDNEKV |
| Ga0209535_10212017 | 3300025120 | Marine | MKIDFNEWMASIKNIYYADNEQMLNAFEKIKTNEEI |
| Ga0209535_10257842 | 3300025120 | Marine | MRKDFNEWMASIGNIYYSDNNLMSQAFEKIEDNEEI |
| Ga0209535_10717973 | 3300025120 | Marine | MVKEFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0209535_11726322 | 3300025120 | Marine | MKLDFNEWMANIKNIYYADNEQMLNAFEKIRTNEKI |
| Ga0209348_10121503 | 3300025127 | Marine | MVREFNEWMASIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0208919_10602323 | 3300025128 | Marine | MKEFNEWMAHIGNIYYANNELMEKAFDKIEQNEKV |
| Ga0209232_12469882 | 3300025132 | Marine | MIKEFNEWMASIGNIYYANNELMEKAFDKIQQNEKV |
| Ga0209336_100158124 | 3300025137 | Marine | MIKEFNEWMARIGNIYYANNFLMEKAFEKIEQHEKI |
| Ga0209336_101344832 | 3300025137 | Marine | MKQDFNEWMASIGNIYYSDNRLMSQAFEKLEDYEEI |
| Ga0209634_12862071 | 3300025138 | Marine | MKNDFNEWMANIGNIYYADNELMSHAFEKLDNYEEIQCAELCKI |
| Ga0209834_101866342 | 3300025156 | Marine Hydrothermal Vent | MTKEFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV |
| Ga0209337_11283232 | 3300025168 | Marine | MKLDFNEWMANIKNIYYADNEQMLNAFEKIKTNEEI |
| Ga0208032_10013859 | 3300025266 | Deep Ocean | MKQDFNEWMANIKNIHYADNEQMLNAFEKLDNYEEI |
| Ga0208814_10010604 | 3300025276 | Deep Ocean | MKKEFNEWMASIGNVYYANNEMMDRAFEKIDQYEEI |
| Ga0208814_100444711 | 3300025276 | Deep Ocean | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQRA |
| Ga0208814_10318544 | 3300025276 | Deep Ocean | RIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0208814_10622982 | 3300025276 | Deep Ocean | MTAENFNEWMASIKNIYYADNNLMSQAFEKLNNTDEKI |
| Ga0208303_10036829 | 3300025543 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEEV |
| Ga0208660_10598432 | 3300025570 | Aqueous | NNMKQKFNEWMASIGNIYYADNNLMSKALEKIQDNEKV |
| Ga0209504_10947962 | 3300025621 | Pelagic Marine | MTANGFNEWMANIGNIYYADNNLMSQAFEKLNDNEKI |
| Ga0208643_11777942 | 3300025645 | Aqueous | MSKEFNEWMAKIGNIYYANNELMSQAYDKIEEYEKV |
| Ga0208162_11956592 | 3300025674 | Aqueous | MTKEFNEWMAKIGNIYYANNELMSQAYEKIEEYEKV |
| Ga0209532_10525241 | 3300025696 | Pelagic Marine | RKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0208899_11248832 | 3300025759 | Aqueous | MSKEFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV |
| Ga0209193_10779582 | 3300025816 | Pelagic Marine | IKPTIMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0208645_10238631 | 3300025853 | Aqueous | RKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV |
| Ga0208645_12114563 | 3300025853 | Aqueous | MKQKFNEWMAKIGNVYYANNELMSQAYDKIEEYEKV |
| Ga0209757_102494711 | 3300025873 | Marine | TKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0247569_10139185 | 3300026421 | Seawater | MKKDFNEWMASIGNIYYANDNLMAQAFEKINQYEEV |
| Ga0247580_10045261 | 3300026423 | Seawater | RIIKSTIIKKDFNEWMASIGNIYYANDNLMAQAFEKIDQYEEV |
| Ga0208798_10026693 | 3300027183 | Estuarine | MTAENFNEWMASIKNIYYADNNLMSQAFEKLNNNDEEI |
| Ga0208922_10697881 | 3300027197 | Estuarine | MKQDSNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0208439_10813442 | 3300027278 | Estuarine | MKQDFNEWMANIGNIYYADNRLMSQAFEKLEYYEEI |
| Ga0208439_11025522 | 3300027278 | Estuarine | RDMKLDFNEWMASIKNIYYADNEKMLNAFEKLEEDEEV |
| Ga0207994_10885541 | 3300027416 | Estuarine | FKSTIMSKEFNEWMASIGNIYYADNELMSQAFEKLESNEEI |
| Ga0208897_10670932 | 3300027571 | Estuarine | MTANNFNEWMASIGNIYYADNNLMSQAFEKLNDNEKI |
| Ga0209710_10288374 | 3300027687 | Marine | MKNDFNEWMASIGNIYYSDNELMSHAFEKLDNYEEI |
| Ga0209710_11255461 | 3300027687 | Marine | MKEKFNEWMASIGNVYYANNEMMDRAFEKIDQYEKI |
| Ga0209121_100794883 | 3300027742 | Marine | MKLDFNEWMASIKNIYYTDNEKMLNAFEKLEEDEEV |
| Ga0209192_100120404 | 3300027752 | Marine | MIAENFNDWMASIKNIYYADNNLMSQAFEKLNDNDEKI |
| Ga0209379_100626772 | 3300027758 | Marine Sediment | MKLDFNEWMASIKNIYYADNEQMLNAFEKIEINEEI |
| Ga0209502_100180277 | 3300027780 | Marine | MKQDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQCT |
| Ga0209711_102189942 | 3300027788 | Marine | MKEKFNEWMASIGNIYYSNNELMCKAFEKIEDNEKV |
| Ga0209092_100612774 | 3300027833 | Marine | MKEKFNEWMLSIGNIYYSNNELMCKAFEKIEDNEKV |
| Ga0209092_101655803 | 3300027833 | Marine | MKNDFNEWMANIGNIYYADNELMSHAFEKLDNYEEIQCTKLCKI |
| Ga0209092_103615652 | 3300027833 | Marine | MKLDFNEWMANIKNIYYADNEQMLNAFEKIETNEEI |
| Ga0209344_102601612 | 3300027834 | Marine | MIKDFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0209271_104551661 | 3300027845 | Marine Sediment | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEE |
| Ga0209712_100318516 | 3300027849 | Marine | MKEQFNEWMLSIGNIYYSNNELMCKAFEKIEDNEKV |
| Ga0209712_102647662 | 3300027849 | Marine | MIAENFNDWMASIKNIYYADNNLMSQAFEKLNNNDEEI |
| Ga0209013_103850442 | 3300027858 | Marine | TKQTIMIKEFNEWMASIGNVYYANNELMEKAFDKIEQNEKV |
| Ga0209503_100031137 | 3300027859 | Marine | MKEFNEWMARIGNIYYADNELMEKAFDKIEQHEKV |
| Ga0209503_1001159810 | 3300027859 | Marine | MKEFNEWMASIGNIYYANNELMEKAFDKIEQHEKI |
| Ga0209503_101683562 | 3300027859 | Marine | MKEFNDWMARIGNIYYANNELMEKAFDKIEQHEKV |
| (restricted) Ga0233415_104721051 | 3300027861 | Seawater | MIAANFNEWMASIGNIYYADNNLMSQAFEKLNNNEEVQCT |
| Ga0209404_107346112 | 3300027906 | Marine | MKDFNEWMARIGNIYYANNELMEKAFDKIEQHEKV |
| Ga0209702_100063254 | 3300027976 | Freshwater | MNNKINKLCMVKDFNEWMASIGNIYYADDELMAKAFEKISKNEKL |
| (restricted) Ga0233414_101965732 | 3300028045 | Seawater | RIMKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEI |
| (restricted) Ga0233414_105279292 | 3300028045 | Seawater | MKQDFNEWMASIGNIYYADNRLMSQAFEKLEDYEEV |
| Ga0256368_10313672 | 3300028125 | Sea-Ice Brine | MRKNFNEWMASIGNIYYANDNLMAQAFEKIDQYEKV |
| Ga0228648_10961662 | 3300028126 | Seawater | MSKEFNEWMASIGNIYYANNELMSQAFEKLESNEEI |
| Ga0228645_10595211 | 3300028128 | Seawater | KSKIMSKEFNEWMASIGNIYYANNELMSQAYDKIEQYEKV |
| Ga0228606_11006922 | 3300028135 | Seawater | MRQNFNEWMASIGNIYYANDNLMAKAFEKIDKYEEI |
| Ga0228614_10074602 | 3300028416 | Seawater | MRKDFNEWMASIGNIYYANDNLMAKAFEKIDQYEEI |
| Ga0265309_108896991 | 3300028599 | Sediment | IMRKDFNEWMASIGNIYYANDNLMAEAFEKIDQYEKV |
| Ga0183683_10544112 | 3300029309 | Marine | MKEFNEWMARIGNIYYANNKLMEKAFEKIEKNEKV |
| Ga0135266_1043232 | 3300029632 | Marine Harbor | MKLDFNEWMASIKNIYYADNEKMLNAFEKLEENEEV |
| Ga0135224_10208212 | 3300029753 | Marine Harbor | MTKEFNEWMAKIGNIYYANNKLMSQAYDKIEEYEKV |
| Ga0308024_100168114 | 3300031140 | Marine | MAKEFNEWMASIGNIYYCDNEKMAKAFEIIENYEEI |
| Ga0307488_105513261 | 3300031519 | Sackhole Brine | MKEKFNEWMASIGNVYYSNNELMCKAFEKIEDNEKV |
| Ga0307380_101534852 | 3300031539 | Soil | MSEEFNEWMAYIGNIYYANNALMEKAFEKLEKNEEI |
| Ga0307380_102388282 | 3300031539 | Soil | MSKEFNEWMAYIGNVYYAQNELMEKAFEKLKKNEKI |
| Ga0307380_106029492 | 3300031539 | Soil | MKQEFNEWMASIGNIYYADNRLMSQAFEKLEEYEEI |
| Ga0307379_101968544 | 3300031565 | Soil | MKQEFNEWMASIGNIYYADNRLMSQAFEKIEEYEEI |
| Ga0307379_102373752 | 3300031565 | Soil | MSKEFNEWMAYIGNVYYAQNELMEKAFEKLEKNEKI |
| Ga0307987_100456110 | 3300031631 | Marine | MANKFNEWMASIGNIYYTNDERMSKAFEIIDNYEEVQHKKLCKI |
| Ga0307994_12125482 | 3300031660 | Marine | MAKEFNEWMASIGNIYYCDNEKMAKAFEIIDNYEEI |
| Ga0307377_101090714 | 3300031673 | Soil | MKNDFNEWMASIGNIYYADNELMSHAFEKLDNYEEIQRT |
| Ga0315316_106516721 | 3300032011 | Seawater | LRIMIKEFNEWMASIGNVYYANNELMEKAFDKIEQYEKV |
| Ga0316202_100650812 | 3300032277 | Microbial Mat | MIKEFNEWMASIGNVYYANNELMEKAFEKIEQYEKI |
| Ga0314858_097022_616_744 | 3300033742 | Sea-Ice Brine | IIKSRIMKQDFNEWMANIGNIYYADNRLMSQAFEKLEDYEEI |
| Ga0348335_053226_91_201 | 3300034374 | Aqueous | MKQDFNEWMASIGNIYYADNRLMSQAFEKIEEYEKI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |