


| Basic Information | |
|---|---|
| Family ID | F003187 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 502 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKKFLVVICSVVLAFGLAGCVGKGKAPVGKGKAPVVQTKG |
| Number of Associated Samples | 344 |
| Number of Associated Scaffolds | 502 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.87 % |
| % of genes near scaffold ends (potentially truncated) | 26.29 % |
| % of genes from short scaffolds (< 2000 bps) | 68.33 % |
| Associated GOLD sequencing projects | 314 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.984 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.518 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.426 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 502 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 13.75 |
| PF13505 | OMP_b-brl | 2.59 |
| PF00515 | TPR_1 | 1.79 |
| PF03779 | SPW | 1.39 |
| PF04140 | ICMT | 1.20 |
| PF13467 | RHH_4 | 0.80 |
| PF00839 | Cys_rich_FGFR | 0.60 |
| PF01227 | GTP_cyclohydroI | 0.60 |
| PF00072 | Response_reg | 0.40 |
| PF00106 | adh_short | 0.40 |
| PF04392 | ABC_sub_bind | 0.40 |
| PF06411 | HdeA | 0.40 |
| PF16868 | NMT1_3 | 0.40 |
| PF07045 | DUF1330 | 0.40 |
| PF02371 | Transposase_20 | 0.40 |
| PF00589 | Phage_integrase | 0.40 |
| PF00005 | ABC_tran | 0.40 |
| PF13414 | TPR_11 | 0.40 |
| PF02518 | HATPase_c | 0.40 |
| PF13185 | GAF_2 | 0.40 |
| PF05532 | CsbD | 0.20 |
| PF00582 | Usp | 0.20 |
| PF13458 | Peripla_BP_6 | 0.20 |
| PF00149 | Metallophos | 0.20 |
| PF13561 | adh_short_C2 | 0.20 |
| PF04199 | Cyclase | 0.20 |
| PF00775 | Dioxygenase_C | 0.20 |
| PF00583 | Acetyltransf_1 | 0.20 |
| PF04138 | GtrA | 0.20 |
| PF00571 | CBS | 0.20 |
| PF09864 | MliC | 0.20 |
| PF07859 | Abhydrolase_3 | 0.20 |
| PF01042 | Ribonuc_L-PSP | 0.20 |
| PF12787 | EcsC | 0.20 |
| PF12833 | HTH_18 | 0.20 |
| PF02801 | Ketoacyl-synt_C | 0.20 |
| PF03544 | TonB_C | 0.20 |
| PF13090 | PP_kinase_C | 0.20 |
| PF00392 | GntR | 0.20 |
| PF09209 | CecR_C | 0.20 |
| PF05661 | DUF808 | 0.20 |
| PF06808 | DctM | 0.20 |
| PF03992 | ABM | 0.20 |
| PF09837 | DUF2064 | 0.20 |
| PF02798 | GST_N | 0.20 |
| PF00725 | 3HCDH | 0.20 |
| PF01590 | GAF | 0.20 |
| PF01408 | GFO_IDH_MocA | 0.20 |
| PF00248 | Aldo_ket_red | 0.20 |
| PF06823 | DUF1236 | 0.20 |
| PF08659 | KR | 0.20 |
| PF04964 | Flp_Fap | 0.20 |
| PF11784 | DUF3320 | 0.20 |
| PF13751 | DDE_Tnp_1_6 | 0.20 |
| PF01058 | Oxidored_q6 | 0.20 |
| PF05872 | HerA_C | 0.20 |
| PF00694 | Aconitase_C | 0.20 |
| PF13683 | rve_3 | 0.20 |
| PF08241 | Methyltransf_11 | 0.20 |
| PF00202 | Aminotran_3 | 0.20 |
| PF03411 | Peptidase_M74 | 0.20 |
| PF13539 | Peptidase_M15_4 | 0.20 |
| PF07690 | MFS_1 | 0.20 |
| PF04205 | FMN_bind | 0.20 |
| PF03330 | DPBB_1 | 0.20 |
| PF00724 | Oxidored_FMN | 0.20 |
| PF06779 | MFS_4 | 0.20 |
| PF03061 | 4HBT | 0.20 |
| PF01068 | DNA_ligase_A_M | 0.20 |
| PF13193 | AMP-binding_C | 0.20 |
| PF13538 | UvrD_C_2 | 0.20 |
| PF09948 | DUF2182 | 0.20 |
| PF03466 | LysR_substrate | 0.20 |
| COG ID | Name | Functional Category | % Frequency in 502 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 13.75 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 13.75 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.40 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.40 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.20 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.20 |
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.20 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.20 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.20 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.20 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.20 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.20 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.20 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.20 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.20 |
| COG2354 | Membrane protein MutK/YedI, may be involved in DNA repair | Replication, recombination and repair [L] | 0.20 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.20 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.20 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.20 |
| COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.20 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.98 % |
| All Organisms | root | All Organisms | 46.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320004|FACEMD_FWMYIUC02GLW9P | Not Available | 522 | Open in IMG/M |
| 2088090004|P1_DRAFT_NODE_120078_len_2012_cov_12_361829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2062 | Open in IMG/M |
| 2088090004|P1_DRAFT_NODE_57119_len_748_cov_6_913102 | Not Available | 798 | Open in IMG/M |
| 2124908041|P3_CLC_ConsensusfromContig62599 | Not Available | 810 | Open in IMG/M |
| 2140918006|ConsensusfromContig113350 | Not Available | 662 | Open in IMG/M |
| 2140918006|ConsensusfromContig48683 | Not Available | 663 | Open in IMG/M |
| 2140918006|ConsensusfromContig51132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 966 | Open in IMG/M |
| 2140918007|ConsensusfromContig148061 | Not Available | 611 | Open in IMG/M |
| 2166559005|cont_contig07688 | Not Available | 1734 | Open in IMG/M |
| 2170459013|GO6OHWN02IMWEI | Not Available | 527 | Open in IMG/M |
| 2170459020|G1P06HT01E2KFL | Not Available | 726 | Open in IMG/M |
| 2228664021|ICCgaii200_c0855252 | Not Available | 1868 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0598550 | Not Available | 525 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13096811 | Not Available | 570 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13188400 | Not Available | 553 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101767936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8701 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101770806 | Not Available | 1303 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101985345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2842 | Open in IMG/M |
| 3300000550|F24TB_11027749 | Not Available | 533 | Open in IMG/M |
| 3300000787|JGI11643J11755_11447554 | Not Available | 641 | Open in IMG/M |
| 3300001385|JGI20193J14888_1017547 | Not Available | 1237 | Open in IMG/M |
| 3300001396|JGI20175J14863_1002429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3467 | Open in IMG/M |
| 3300001397|JGI20177J14857_1006488 | Not Available | 2444 | Open in IMG/M |
| 3300001397|JGI20177J14857_1021238 | Not Available | 858 | Open in IMG/M |
| 3300001402|JGI20195J14853_1011269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2093 | Open in IMG/M |
| 3300001417|JGI20196J14858_1011888 | Not Available | 728 | Open in IMG/M |
| 3300001538|A10PFW1_10540476 | Not Available | 784 | Open in IMG/M |
| 3300001867|JGI12627J18819_10004131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 5435 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10028572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 2003 | Open in IMG/M |
| 3300002459|JGI24751J29686_10144700 | Not Available | 504 | Open in IMG/M |
| 3300002495|BRMGV_1012930 | Not Available | 648 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10078917 | Not Available | 583 | Open in IMG/M |
| 3300003267|soilL1_10201065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1247 | Open in IMG/M |
| 3300003324|soilH2_10087908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1791 | Open in IMG/M |
| 3300003369|JGI24140J50213_10285795 | Not Available | 503 | Open in IMG/M |
| 3300003987|Ga0055471_10125801 | Not Available | 768 | Open in IMG/M |
| 3300003988|Ga0055475_10071597 | Not Available | 1028 | Open in IMG/M |
| 3300003991|Ga0055461_10176245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 572 | Open in IMG/M |
| 3300003994|Ga0055435_10121196 | Not Available | 708 | Open in IMG/M |
| 3300004000|Ga0055458_10165940 | Not Available | 653 | Open in IMG/M |
| 3300004004|Ga0055451_10140872 | Not Available | 973 | Open in IMG/M |
| 3300004006|Ga0055453_10016811 | Not Available | 1749 | Open in IMG/M |
| 3300004012|Ga0055464_10272224 | Not Available | 516 | Open in IMG/M |
| 3300004018|Ga0055452_10078692 | Not Available | 1038 | Open in IMG/M |
| 3300004018|Ga0055452_10154345 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300004019|Ga0055439_10090034 | Not Available | 896 | Open in IMG/M |
| 3300004114|Ga0062593_100770193 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300004114|Ga0062593_101345868 | Not Available | 759 | Open in IMG/M |
| 3300004153|Ga0063455_101105963 | Not Available | 585 | Open in IMG/M |
| 3300004157|Ga0062590_101817447 | Not Available | 625 | Open in IMG/M |
| 3300004479|Ga0062595_100232027 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300004479|Ga0062595_101769355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 585 | Open in IMG/M |
| 3300004480|Ga0062592_102703245 | Not Available | 502 | Open in IMG/M |
| 3300004633|Ga0066395_10247927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 954 | Open in IMG/M |
| 3300004643|Ga0062591_102204426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 573 | Open in IMG/M |
| 3300004800|Ga0058861_11374509 | Not Available | 519 | Open in IMG/M |
| 3300004800|Ga0058861_11780654 | Not Available | 614 | Open in IMG/M |
| 3300004801|Ga0058860_12209799 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300005093|Ga0062594_100298963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1222 | Open in IMG/M |
| 3300005093|Ga0062594_100335796 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005162|Ga0066814_10055748 | Not Available | 662 | Open in IMG/M |
| 3300005162|Ga0066814_10075713 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005183|Ga0068993_10076655 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300005204|Ga0068997_10031704 | Not Available | 935 | Open in IMG/M |
| 3300005213|Ga0068998_10143664 | Not Available | 566 | Open in IMG/M |
| 3300005328|Ga0070676_10793506 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005330|Ga0070690_101195525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-15 | 606 | Open in IMG/M |
| 3300005331|Ga0070670_100136764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. ANG-S4 | 2117 | Open in IMG/M |
| 3300005332|Ga0066388_100003001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10684 | Open in IMG/M |
| 3300005332|Ga0066388_100023699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5498 | Open in IMG/M |
| 3300005332|Ga0066388_100026599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5291 | Open in IMG/M |
| 3300005332|Ga0066388_100039299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4642 | Open in IMG/M |
| 3300005332|Ga0066388_100045269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4424 | Open in IMG/M |
| 3300005332|Ga0066388_100056464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4104 | Open in IMG/M |
| 3300005332|Ga0066388_100060533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4006 | Open in IMG/M |
| 3300005332|Ga0066388_100263395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2365 | Open in IMG/M |
| 3300005332|Ga0066388_100284274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2297 | Open in IMG/M |
| 3300005332|Ga0066388_100399504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2020 | Open in IMG/M |
| 3300005332|Ga0066388_100714704 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300005332|Ga0066388_100739924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1585 | Open in IMG/M |
| 3300005332|Ga0066388_101127840 | Not Available | 1331 | Open in IMG/M |
| 3300005332|Ga0066388_101299991 | Not Available | 1254 | Open in IMG/M |
| 3300005332|Ga0066388_101612007 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005332|Ga0066388_101759354 | Not Available | 1100 | Open in IMG/M |
| 3300005332|Ga0066388_102148228 | Not Available | 1006 | Open in IMG/M |
| 3300005332|Ga0066388_102292964 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005332|Ga0066388_103941981 | Not Available | 757 | Open in IMG/M |
| 3300005332|Ga0066388_105251867 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005332|Ga0066388_108608134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 507 | Open in IMG/M |
| 3300005337|Ga0070682_100116658 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300005344|Ga0070661_100303301 | Not Available | 1244 | Open in IMG/M |
| 3300005366|Ga0070659_101185431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300005434|Ga0070709_10002808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 9405 | Open in IMG/M |
| 3300005435|Ga0070714_101950216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 573 | Open in IMG/M |
| 3300005436|Ga0070713_102008345 | Not Available | 561 | Open in IMG/M |
| 3300005437|Ga0070710_11049047 | Not Available | 596 | Open in IMG/M |
| 3300005440|Ga0070705_100016597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3827 | Open in IMG/M |
| 3300005441|Ga0070700_101446062 | Not Available | 582 | Open in IMG/M |
| 3300005445|Ga0070708_100911006 | Not Available | 825 | Open in IMG/M |
| 3300005445|Ga0070708_101130498 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005458|Ga0070681_10687529 | Not Available | 939 | Open in IMG/M |
| 3300005529|Ga0070741_10012766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15070 | Open in IMG/M |
| 3300005530|Ga0070679_100045997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4349 | Open in IMG/M |
| 3300005535|Ga0070684_101464354 | Not Available | 643 | Open in IMG/M |
| 3300005548|Ga0070665_102256286 | Not Available | 548 | Open in IMG/M |
| 3300005561|Ga0066699_11130548 | Not Available | 539 | Open in IMG/M |
| 3300005578|Ga0068854_100702332 | Not Available | 873 | Open in IMG/M |
| 3300005578|Ga0068854_102123277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium mucogenicum | 519 | Open in IMG/M |
| 3300005646|Ga0075040_1561842 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005713|Ga0066905_100007968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4785 | Open in IMG/M |
| 3300005713|Ga0066905_100088337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2062 | Open in IMG/M |
| 3300005713|Ga0066905_101894701 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005713|Ga0066905_102333108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-15 | 501 | Open in IMG/M |
| 3300005718|Ga0068866_10618969 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005764|Ga0066903_102284642 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005764|Ga0066903_103846231 | Not Available | 806 | Open in IMG/M |
| 3300005764|Ga0066903_104709808 | Not Available | 726 | Open in IMG/M |
| 3300005764|Ga0066903_105642801 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005764|Ga0066903_107585162 | Not Available | 559 | Open in IMG/M |
| 3300005764|Ga0066903_107651637 | Not Available | 556 | Open in IMG/M |
| 3300005764|Ga0066903_107698786 | Not Available | 554 | Open in IMG/M |
| 3300005875|Ga0075293_1044787 | Not Available | 623 | Open in IMG/M |
| 3300005877|Ga0075296_1008365 | Not Available | 746 | Open in IMG/M |
| 3300005888|Ga0075289_1056184 | Not Available | 624 | Open in IMG/M |
| 3300005937|Ga0081455_10011239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9009 | Open in IMG/M |
| 3300005937|Ga0081455_10020801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6166 | Open in IMG/M |
| 3300005938|Ga0066795_10065587 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005938|Ga0066795_10078511 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005938|Ga0066795_10089588 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005938|Ga0066795_10186427 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005938|Ga0066795_10222114 | Not Available | 560 | Open in IMG/M |
| 3300005947|Ga0066794_10020475 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300005980|Ga0066798_10036308 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300005980|Ga0066798_10046639 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005983|Ga0081540_1007328 | All Organisms → cellular organisms → Bacteria | 7889 | Open in IMG/M |
| 3300005983|Ga0081540_1059909 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300005983|Ga0081540_1088016 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300006028|Ga0070717_11900419 | Not Available | 537 | Open in IMG/M |
| 3300006041|Ga0075023_100005585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3116 | Open in IMG/M |
| 3300006041|Ga0075023_100243110 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006041|Ga0075023_100474777 | Not Available | 558 | Open in IMG/M |
| 3300006047|Ga0075024_100026374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2367 | Open in IMG/M |
| 3300006047|Ga0075024_100171820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 999 | Open in IMG/M |
| 3300006047|Ga0075024_100857898 | Not Available | 513 | Open in IMG/M |
| 3300006049|Ga0075417_10015381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2954 | Open in IMG/M |
| 3300006050|Ga0075028_100006936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4504 | Open in IMG/M |
| 3300006050|Ga0075028_100095734 | Not Available | 1507 | Open in IMG/M |
| 3300006050|Ga0075028_100828493 | Not Available | 565 | Open in IMG/M |
| 3300006055|Ga0097691_1005901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6837 | Open in IMG/M |
| 3300006055|Ga0097691_1016412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3371 | Open in IMG/M |
| 3300006057|Ga0075026_100773135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300006059|Ga0075017_100743553 | Not Available | 756 | Open in IMG/M |
| 3300006172|Ga0075018_10150221 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300006172|Ga0075018_10307291 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300006172|Ga0075018_10457226 | Not Available | 659 | Open in IMG/M |
| 3300006173|Ga0070716_100553338 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006175|Ga0070712_100812341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium NK4A136 | 803 | Open in IMG/M |
| 3300006175|Ga0070712_101238561 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006354|Ga0075021_10788462 | Not Available | 613 | Open in IMG/M |
| 3300006358|Ga0068871_100001713 | All Organisms → cellular organisms → Bacteria | 14743 | Open in IMG/M |
| 3300006579|Ga0074054_11872442 | Not Available | 579 | Open in IMG/M |
| 3300006605|Ga0074057_10963833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
| 3300006640|Ga0075527_10006149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2949 | Open in IMG/M |
| 3300006755|Ga0079222_10047604 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300006755|Ga0079222_10049543 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300006755|Ga0079222_10277371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300006806|Ga0079220_11255147 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006844|Ga0075428_100921948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 926 | Open in IMG/M |
| 3300006846|Ga0075430_100002147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16325 | Open in IMG/M |
| 3300006852|Ga0075433_10031236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4552 | Open in IMG/M |
| 3300006854|Ga0075425_100098935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3315 | Open in IMG/M |
| 3300006854|Ga0075425_100102678 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
| 3300006864|Ga0066797_1068475 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300006893|Ga0073928_10519953 | Not Available | 851 | Open in IMG/M |
| 3300006904|Ga0075424_100124151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2728 | Open in IMG/M |
| 3300006914|Ga0075436_100302838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
| 3300006914|Ga0075436_100985181 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006914|Ga0075436_101037674 | Not Available | 616 | Open in IMG/M |
| 3300006949|Ga0075528_10107804 | Not Available | 736 | Open in IMG/M |
| 3300006954|Ga0079219_10862243 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300007764|Ga0102950_1035144 | Not Available | 1369 | Open in IMG/M |
| 3300007769|Ga0102952_1007844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3323 | Open in IMG/M |
| 3300009012|Ga0066710_100268952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2477 | Open in IMG/M |
| 3300009094|Ga0111539_11206330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 879 | Open in IMG/M |
| 3300009100|Ga0075418_11666796 | Not Available | 693 | Open in IMG/M |
| 3300009147|Ga0114129_10067676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 4981 | Open in IMG/M |
| 3300009177|Ga0105248_13046466 | Not Available | 534 | Open in IMG/M |
| 3300009400|Ga0116854_1113565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 975 | Open in IMG/M |
| 3300009506|Ga0118657_10000482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 66613 | Open in IMG/M |
| 3300009523|Ga0116221_1072857 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300009651|Ga0105859_1276554 | Not Available | 519 | Open in IMG/M |
| 3300009792|Ga0126374_10016528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 3108 | Open in IMG/M |
| 3300010043|Ga0126380_11121485 | Not Available | 672 | Open in IMG/M |
| 3300010046|Ga0126384_10178964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1660 | Open in IMG/M |
| 3300010046|Ga0126384_10592867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 969 | Open in IMG/M |
| 3300010154|Ga0127503_11121222 | Not Available | 594 | Open in IMG/M |
| 3300010358|Ga0126370_11600919 | Not Available | 623 | Open in IMG/M |
| 3300010360|Ga0126372_12557186 | Not Available | 562 | Open in IMG/M |
| 3300010360|Ga0126372_12924213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300010362|Ga0126377_12040928 | Not Available | 649 | Open in IMG/M |
| 3300010362|Ga0126377_12069161 | Not Available | 645 | Open in IMG/M |
| 3300010371|Ga0134125_10124798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ORS 375 | 2866 | Open in IMG/M |
| 3300010376|Ga0126381_103531643 | Not Available | 614 | Open in IMG/M |
| 3300010376|Ga0126381_104457355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 541 | Open in IMG/M |
| 3300010379|Ga0136449_100141873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Cp5.3 | 4746 | Open in IMG/M |
| 3300010397|Ga0134124_12569451 | Not Available | 552 | Open in IMG/M |
| 3300010399|Ga0134127_13088541 | Not Available | 543 | Open in IMG/M |
| 3300011418|Ga0153954_1075042 | Not Available | 847 | Open in IMG/M |
| 3300012019|Ga0120139_1010216 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300012207|Ga0137381_11394289 | Not Available | 593 | Open in IMG/M |
| 3300012209|Ga0137379_10972441 | Not Available | 754 | Open in IMG/M |
| 3300012212|Ga0150985_101697248 | Not Available | 1217 | Open in IMG/M |
| 3300012212|Ga0150985_107113441 | Not Available | 608 | Open in IMG/M |
| 3300012212|Ga0150985_116224484 | Not Available | 1145 | Open in IMG/M |
| 3300012469|Ga0150984_107934658 | Not Available | 612 | Open in IMG/M |
| 3300012469|Ga0150984_109105268 | Not Available | 553 | Open in IMG/M |
| 3300012469|Ga0150984_116597724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 843 | Open in IMG/M |
| 3300012469|Ga0150984_118553526 | Not Available | 1056 | Open in IMG/M |
| 3300012484|Ga0157333_1032276 | Not Available | 527 | Open in IMG/M |
| 3300012900|Ga0157292_10114454 | Not Available | 821 | Open in IMG/M |
| 3300012924|Ga0137413_10837873 | Not Available | 709 | Open in IMG/M |
| 3300012931|Ga0153915_10529803 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300012931|Ga0153915_10702827 | Not Available | 1168 | Open in IMG/M |
| 3300012948|Ga0126375_10001635 | All Organisms → cellular organisms → Bacteria | 7416 | Open in IMG/M |
| 3300012951|Ga0164300_10441544 | Not Available | 727 | Open in IMG/M |
| 3300012955|Ga0164298_10059801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1871 | Open in IMG/M |
| 3300012955|Ga0164298_10870375 | Not Available | 652 | Open in IMG/M |
| 3300012957|Ga0164303_10259264 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012957|Ga0164303_11017537 | Not Available | 591 | Open in IMG/M |
| 3300012964|Ga0153916_13301460 | Not Available | 507 | Open in IMG/M |
| 3300012971|Ga0126369_10050294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3558 | Open in IMG/M |
| 3300012971|Ga0126369_12419973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300012984|Ga0164309_10019066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3560 | Open in IMG/M |
| 3300012984|Ga0164309_10350285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1084 | Open in IMG/M |
| 3300012988|Ga0164306_11821917 | Not Available | 529 | Open in IMG/M |
| 3300012989|Ga0164305_10009668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4592 | Open in IMG/M |
| 3300013102|Ga0157371_10951278 | Not Available | 653 | Open in IMG/M |
| 3300013296|Ga0157374_10076397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3167 | Open in IMG/M |
| 3300013296|Ga0157374_10145436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2302 | Open in IMG/M |
| 3300013297|Ga0157378_11852787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 652 | Open in IMG/M |
| 3300013308|Ga0157375_12479012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300013503|Ga0120127_10017172 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300013503|Ga0120127_10058276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 791 | Open in IMG/M |
| 3300013770|Ga0120123_1159249 | Not Available | 538 | Open in IMG/M |
| 3300013772|Ga0120158_10204685 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300013772|Ga0120158_10301818 | Not Available | 774 | Open in IMG/M |
| 3300014269|Ga0075302_1180248 | Not Available | 530 | Open in IMG/M |
| 3300014308|Ga0075354_1051373 | Not Available | 760 | Open in IMG/M |
| 3300014314|Ga0075316_1117069 | Not Available | 648 | Open in IMG/M |
| 3300014502|Ga0182021_10829612 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300014502|Ga0182021_11549051 | Not Available | 798 | Open in IMG/M |
| 3300014968|Ga0157379_12178561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 550 | Open in IMG/M |
| 3300014969|Ga0157376_11559312 | Not Available | 694 | Open in IMG/M |
| 3300015063|Ga0167649_106470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
| 3300015063|Ga0167649_109459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 867 | Open in IMG/M |
| 3300015080|Ga0167639_1020841 | Not Available | 922 | Open in IMG/M |
| 3300015162|Ga0167653_1023988 | Not Available | 1163 | Open in IMG/M |
| 3300015171|Ga0167648_1031457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300015371|Ga0132258_10494816 | Not Available | 3056 | Open in IMG/M |
| 3300015371|Ga0132258_12835829 | Not Available | 1206 | Open in IMG/M |
| 3300015371|Ga0132258_13097710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300015371|Ga0132258_13962275 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300015372|Ga0132256_103477214 | Not Available | 529 | Open in IMG/M |
| 3300015373|Ga0132257_104528228 | Not Available | 506 | Open in IMG/M |
| 3300015374|Ga0132255_100007053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12790 | Open in IMG/M |
| 3300015374|Ga0132255_100535098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1725 | Open in IMG/M |
| 3300015374|Ga0132255_100566173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1676 | Open in IMG/M |
| 3300015374|Ga0132255_102207154 | Not Available | 839 | Open in IMG/M |
| 3300017792|Ga0163161_10444494 | Not Available | 1047 | Open in IMG/M |
| 3300017944|Ga0187786_10013191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2060 | Open in IMG/M |
| 3300017944|Ga0187786_10561816 | Not Available | 529 | Open in IMG/M |
| 3300017947|Ga0187785_10000043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 44085 | Open in IMG/M |
| 3300017947|Ga0187785_10021723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2275 | Open in IMG/M |
| 3300017947|Ga0187785_10601321 | Not Available | 564 | Open in IMG/M |
| 3300017959|Ga0187779_10000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 40639 | Open in IMG/M |
| 3300017959|Ga0187779_10006258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6939 | Open in IMG/M |
| 3300017959|Ga0187779_10019121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3900 | Open in IMG/M |
| 3300017959|Ga0187779_10073811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2018 | Open in IMG/M |
| 3300017959|Ga0187779_10115387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1631 | Open in IMG/M |
| 3300017961|Ga0187778_10093659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1862 | Open in IMG/M |
| 3300017961|Ga0187778_10476176 | Not Available | 827 | Open in IMG/M |
| 3300017966|Ga0187776_10358114 | Not Available | 965 | Open in IMG/M |
| 3300017966|Ga0187776_11301043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300017973|Ga0187780_10340371 | Not Available | 1058 | Open in IMG/M |
| 3300018029|Ga0187787_10063719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1117 | Open in IMG/M |
| 3300018029|Ga0187787_10207396 | Not Available | 695 | Open in IMG/M |
| 3300018032|Ga0187788_10009350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3019 | Open in IMG/M |
| 3300018032|Ga0187788_10033751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1685 | Open in IMG/M |
| 3300018032|Ga0187788_10088903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1103 | Open in IMG/M |
| 3300018032|Ga0187788_10355343 | Not Available | 606 | Open in IMG/M |
| 3300018058|Ga0187766_10082022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1935 | Open in IMG/M |
| 3300018058|Ga0187766_10136411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1514 | Open in IMG/M |
| 3300018064|Ga0187773_10138038 | Not Available | 1245 | Open in IMG/M |
| 3300018064|Ga0187773_10893849 | Not Available | 573 | Open in IMG/M |
| 3300018078|Ga0184612_10381232 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300018081|Ga0184625_10617521 | Not Available | 529 | Open in IMG/M |
| 3300018422|Ga0190265_12938176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 569 | Open in IMG/M |
| 3300018429|Ga0190272_10182797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1492 | Open in IMG/M |
| 3300018465|Ga0190269_11262432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300018476|Ga0190274_10062998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2756 | Open in IMG/M |
| 3300019767|Ga0190267_11627064 | Not Available | 506 | Open in IMG/M |
| 3300019878|Ga0193715_1121182 | Not Available | 506 | Open in IMG/M |
| 3300020018|Ga0193721_1096819 | Not Available | 758 | Open in IMG/M |
| 3300020078|Ga0206352_10583808 | Not Available | 600 | Open in IMG/M |
| 3300020146|Ga0196977_1126056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300020150|Ga0187768_1096628 | Not Available | 672 | Open in IMG/M |
| 3300021938|Ga0213847_1000528 | Not Available | 629 | Open in IMG/M |
| 3300021938|Ga0213847_1186267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1021 | Open in IMG/M |
| 3300022518|Ga0224548_1002029 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300022518|Ga0224548_1016155 | Not Available | 820 | Open in IMG/M |
| 3300022557|Ga0212123_10900602 | Not Available | 521 | Open in IMG/M |
| 3300025457|Ga0208850_1001620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5925 | Open in IMG/M |
| 3300025484|Ga0208587_1058839 | Not Available | 883 | Open in IMG/M |
| 3300025495|Ga0207932_1002810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5865 | Open in IMG/M |
| 3300025553|Ga0208080_1002577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8420 | Open in IMG/M |
| 3300025556|Ga0210120_1083723 | Not Available | 631 | Open in IMG/M |
| 3300025604|Ga0207930_1091324 | Not Available | 704 | Open in IMG/M |
| 3300025725|Ga0209638_1087470 | Not Available | 1136 | Open in IMG/M |
| 3300025780|Ga0210100_1026742 | Not Available | 757 | Open in IMG/M |
| 3300025797|Ga0210062_1000028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 37833 | Open in IMG/M |
| 3300025854|Ga0209176_10057640 | Not Available | 871 | Open in IMG/M |
| 3300025857|Ga0209014_10301708 | Not Available | 511 | Open in IMG/M |
| 3300025891|Ga0209585_10502604 | Not Available | 505 | Open in IMG/M |
| 3300025907|Ga0207645_10031403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3417 | Open in IMG/M |
| 3300025911|Ga0207654_10253615 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300025911|Ga0207654_11379209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 3300025912|Ga0207707_10604930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 927 | Open in IMG/M |
| 3300025916|Ga0207663_11415858 | Not Available | 560 | Open in IMG/M |
| 3300025922|Ga0207646_11139714 | Not Available | 685 | Open in IMG/M |
| 3300025924|Ga0207694_10632614 | Not Available | 901 | Open in IMG/M |
| 3300025928|Ga0207700_11166898 | Not Available | 688 | Open in IMG/M |
| 3300025931|Ga0207644_11811746 | Not Available | 511 | Open in IMG/M |
| 3300025933|Ga0207706_11069994 | Not Available | 675 | Open in IMG/M |
| 3300025939|Ga0207665_10272846 | Not Available | 1256 | Open in IMG/M |
| 3300025940|Ga0207691_11199049 | Not Available | 629 | Open in IMG/M |
| 3300025941|Ga0207711_10887550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 829 | Open in IMG/M |
| 3300025945|Ga0207679_11071790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300025955|Ga0210071_1020533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 811 | Open in IMG/M |
| 3300025955|Ga0210071_1035610 | Not Available | 631 | Open in IMG/M |
| 3300025960|Ga0207651_10243855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 1466 | Open in IMG/M |
| 3300025960|Ga0207651_11186413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300025979|Ga0210078_1006571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1373 | Open in IMG/M |
| 3300026078|Ga0207702_11151754 | Not Available | 770 | Open in IMG/M |
| 3300026127|Ga0209956_1070319 | Not Available | 678 | Open in IMG/M |
| 3300026142|Ga0207698_11451111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300026223|Ga0209840_1007923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2396 | Open in IMG/M |
| 3300026271|Ga0209880_1117407 | Not Available | 529 | Open in IMG/M |
| 3300026273|Ga0209881_1102468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300026464|Ga0256814_1001327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300026899|Ga0209326_1009889 | Not Available | 722 | Open in IMG/M |
| 3300027517|Ga0209113_1008731 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300027517|Ga0209113_1063573 | Not Available | 548 | Open in IMG/M |
| 3300027523|Ga0208890_1089479 | Not Available | 511 | Open in IMG/M |
| 3300027765|Ga0209073_10449466 | Not Available | 536 | Open in IMG/M |
| 3300027787|Ga0209074_10015670 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300027787|Ga0209074_10434152 | Not Available | 557 | Open in IMG/M |
| 3300027873|Ga0209814_10102219 | Not Available | 1216 | Open in IMG/M |
| 3300027894|Ga0209068_10001636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11138 | Open in IMG/M |
| 3300027894|Ga0209068_10194482 | Not Available | 1114 | Open in IMG/M |
| 3300027894|Ga0209068_10198063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1104 | Open in IMG/M |
| 3300027907|Ga0207428_10000322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 62220 | Open in IMG/M |
| 3300027910|Ga0209583_10007453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3153 | Open in IMG/M |
| 3300028379|Ga0268266_10324972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. ANG-S4 | 1441 | Open in IMG/M |
| 3300028379|Ga0268266_10611499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1047 | Open in IMG/M |
| 3300028784|Ga0307282_10080965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1487 | Open in IMG/M |
| 3300028787|Ga0307323_10382266 | Not Available | 504 | Open in IMG/M |
| 3300028796|Ga0307287_10342438 | Not Available | 564 | Open in IMG/M |
| 3300028819|Ga0307296_10565368 | Not Available | 622 | Open in IMG/M |
| 3300028884|Ga0307308_10025306 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300028885|Ga0307304_10180807 | Not Available | 894 | Open in IMG/M |
| 3300029827|Ga0134606_10098266 | Not Available | 922 | Open in IMG/M |
| 3300030570|Ga0247647_1105765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 704 | Open in IMG/M |
| 3300030606|Ga0299906_10475180 | Not Available | 960 | Open in IMG/M |
| 3300030916|Ga0075386_10005405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3176 | Open in IMG/M |
| 3300030916|Ga0075386_12052750 | Not Available | 676 | Open in IMG/M |
| 3300031114|Ga0308187_10058352 | Not Available | 1087 | Open in IMG/M |
| 3300031128|Ga0170823_12371723 | Not Available | 1059 | Open in IMG/M |
| 3300031226|Ga0307497_10382253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 668 | Open in IMG/M |
| 3300031241|Ga0265325_10046411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2253 | Open in IMG/M |
| 3300031241|Ga0265325_10049126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2179 | Open in IMG/M |
| 3300031256|Ga0315556_1015470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3539 | Open in IMG/M |
| 3300031280|Ga0307428_1000081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 84640 | Open in IMG/M |
| 3300031367|Ga0307440_1070992 | Not Available | 1023 | Open in IMG/M |
| 3300031368|Ga0307429_1014370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2738 | Open in IMG/M |
| 3300031379|Ga0307434_1078692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300031446|Ga0170820_11501010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3865 | Open in IMG/M |
| 3300031469|Ga0170819_11034512 | Not Available | 716 | Open in IMG/M |
| 3300031547|Ga0310887_10496558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 734 | Open in IMG/M |
| 3300031563|Ga0307436_1003571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6289 | Open in IMG/M |
| 3300031585|Ga0315534_1190197 | Not Available | 729 | Open in IMG/M |
| 3300031653|Ga0315550_1032807 | All Organisms → cellular organisms → Bacteria | 2564 | Open in IMG/M |
| 3300031691|Ga0316579_10024891 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300031716|Ga0310813_10106100 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300031719|Ga0306917_10266244 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300031744|Ga0306918_11482466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer → Ensifer adhaerens → Ensifer adhaerens OV14 | 519 | Open in IMG/M |
| 3300031820|Ga0307473_11160706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 572 | Open in IMG/M |
| 3300031890|Ga0306925_11531866 | Not Available | 651 | Open in IMG/M |
| 3300031908|Ga0310900_10318418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1151 | Open in IMG/M |
| 3300031910|Ga0306923_11654504 | Not Available | 663 | Open in IMG/M |
| 3300031940|Ga0310901_10168754 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031944|Ga0310884_10372434 | Not Available | 814 | Open in IMG/M |
| 3300031945|Ga0310913_10018054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4357 | Open in IMG/M |
| 3300032000|Ga0310903_10679108 | Not Available | 555 | Open in IMG/M |
| 3300032005|Ga0307411_10690301 | Not Available | 888 | Open in IMG/M |
| 3300032012|Ga0310902_10183074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1215 | Open in IMG/M |
| 3300032061|Ga0315540_10177993 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300032061|Ga0315540_10250990 | Not Available | 747 | Open in IMG/M |
| 3300032174|Ga0307470_10522149 | Not Available | 871 | Open in IMG/M |
| 3300032174|Ga0307470_11705586 | Not Available | 530 | Open in IMG/M |
| 3300032180|Ga0307471_100267765 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300032205|Ga0307472_100715996 | Not Available | 902 | Open in IMG/M |
| 3300032205|Ga0307472_100852512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 838 | Open in IMG/M |
| 3300032770|Ga0335085_11030561 | Not Available | 887 | Open in IMG/M |
| 3300032770|Ga0335085_11551670 | Not Available | 688 | Open in IMG/M |
| 3300032783|Ga0335079_10373006 | Not Available | 1544 | Open in IMG/M |
| 3300032783|Ga0335079_11097185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 806 | Open in IMG/M |
| 3300032805|Ga0335078_10566456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1442 | Open in IMG/M |
| 3300032805|Ga0335078_12182105 | Not Available | 585 | Open in IMG/M |
| 3300032828|Ga0335080_10183000 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300032828|Ga0335080_11152553 | Not Available | 782 | Open in IMG/M |
| 3300032828|Ga0335080_11387640 | Not Available | 699 | Open in IMG/M |
| 3300032892|Ga0335081_10012777 | All Organisms → cellular organisms → Bacteria | 13589 | Open in IMG/M |
| 3300033158|Ga0335077_11254688 | Not Available | 722 | Open in IMG/M |
| 3300033433|Ga0326726_10798131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 913 | Open in IMG/M |
| 3300033433|Ga0326726_11307467 | Not Available | 706 | Open in IMG/M |
| 3300033475|Ga0310811_10027351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7581 | Open in IMG/M |
| 3300033475|Ga0310811_10128317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3232 | Open in IMG/M |
| 3300033475|Ga0310811_11000764 | Not Available | 731 | Open in IMG/M |
| 3300033486|Ga0316624_10049779 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
| 3300034090|Ga0326723_0025026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2452 | Open in IMG/M |
| 3300034090|Ga0326723_0041306 | Not Available | 1938 | Open in IMG/M |
| 3300034090|Ga0326723_0075636 | Not Available | 1441 | Open in IMG/M |
| 3300034090|Ga0326723_0256262 | Not Available | 780 | Open in IMG/M |
| 3300034090|Ga0326723_0275622 | Not Available | 752 | Open in IMG/M |
| 3300034195|Ga0370501_0133999 | Not Available | 851 | Open in IMG/M |
| 3300034663|Ga0314784_091821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300034664|Ga0314786_106887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Enterovirga → Enterovirga rhinocerotis | 609 | Open in IMG/M |
| 3300034817|Ga0373948_0128443 | Not Available | 618 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.38% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.18% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.60% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.40% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.40% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.40% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.20% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.20% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.20% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.20% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.20% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.20% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.20% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.20% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.20% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.20% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.20% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.20% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.20% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.20% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320004 | Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- | Environmental | Open in IMG/M |
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004018 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026127 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031367 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10 | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031379 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034480 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEMDA_2797810 | 2032320004 | Soil | MGGVIMKKILVIVCSAILALGVAGCAGKAPVGKGKAPVVHTKG |
| P1_DRAFT_00859570 | 2088090004 | Soil | MKKCVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| P1_DRAFT_00939180 | 2088090004 | Soil | MKKIVVVICTVVLALGVAGCAGKGKAPIGKGKAPVVQTRG |
| P3_CLC_01598100 | 2124908041 | Soil | MKKCVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| P1_C_00588070 | 2140918006 | Soil | MKKFLVIFCTVILALGVVNCAGKGKGKAPAPVVHTKG |
| P1_C_01367780 | 2140918006 | Soil | MKKFVVVICTAVLALGVAGCAGKGKAPIGKGKAPVVQTKG |
| P1_C_00079360 | 2140918006 | Soil | MKKMVVVMCTIVLALGVAGCAGKGKAPIGKGKAPVVQTKG |
| A_all_C_01977520 | 2140918007 | Soil | MRKYVLVAIAVLACLSIAGCAGKAPIGKGKGKAPVVQTKG |
| cont_0688.00000770 | 2166559005 | Simulated | MKKFLVVVCSMVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| N57_08025210 | 2170459013 | Grass Soil | NLGSVMKKFLVVLCSVVLAFGLAGCWGKAPVGKGKAPVVQTRG |
| 2NP_02807820 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | VRKLLVAVCSIVLAFGLAGCIGKGKAPVGKGKAPVVQTRG |
| ICCgaii200_08552522 | 2228664021 | Soil | MKKVLLVVCSAILALGVAGCAGKGKVPIGKGKTPVVQTRG |
| ICChiseqgaiiDRAFT_05985501 | 3300000033 | Soil | MKKFLVAICSVVLAFGXAGCWGKGKAPVGKGKAPVVQTRG* |
| ICChiseqgaiiFebDRAFT_130968112 | 3300000363 | Soil | MKKMTLIICSMVLALGVSGCAGKGKVPVIGKGKAPVVQTKG* |
| ICChiseqgaiiFebDRAFT_131884002 | 3300000363 | Soil | MNKFLALICTVALALGVAGCAGKAPIVGKGKAPAVQTRG* |
| INPhiseqgaiiFebDRAFT_10176793615 | 3300000364 | Soil | MKKFLVVLCSAVLAFGFAGCVGKAPVGKGKAPVVQTRG* |
| INPhiseqgaiiFebDRAFT_1017708062 | 3300000364 | Soil | MKKFLVVLCSAVLAFGLAGCVGKAPVGKGKAPVVQTRG* |
| INPhiseqgaiiFebDRAFT_1019853451 | 3300000364 | Soil | MRKLLVAIFSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| F24TB_110277492 | 3300000550 | Soil | LNGDNLMKKFLVTICSVVLAFGLNGCWGKGKAPVGKGKAPVVQTRG* |
| AF_2010_repII_A1DRAFT_100108606 | 3300000597 | Forest Soil | MKKFLVILCSAVLAFGFAGCVGKGPIGKGKAPPPVVTRG* |
| JGI11643J11755_114475542 | 3300000787 | Soil | MKKVLLVVCSAILALGVAGCAGKGKVPIGKGKTPVVQTRG* |
| AP72_2010_repI_A001DRAFT_10574132 | 3300000893 | Forest Soil | MKKFVVVVCSIILSFSLASCVGKGPVGKGKAPAPVVQ |
| JGI20193J14888_10175471 | 3300001385 | Arctic Peat Soil | VVVICAAVLALGVAGCAGKGKAPIGKGKAPVVQTKG |
| JGI20175J14863_10024292 | 3300001396 | Arctic Peat Soil | MKKFVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| JGI20177J14857_10064882 | 3300001397 | Arctic Peat Soil | VVVICTAVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| JGI20177J14857_10212382 | 3300001397 | Arctic Peat Soil | VVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| JGI20195J14853_10112692 | 3300001402 | Arctic Peat Soil | MKKXVVLLCSLXLVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| JGI20196J14858_10118882 | 3300001417 | Arctic Peat Soil | VNWSVNLKTGRVMKKIVVVICTVVLALGVAGCAGKGKAPIGKGKAPVVQTRG* |
| A10PFW1_105404762 | 3300001538 | Permafrost | MKKFLVVICSVVLALGLAGCAGKGKTPIGKGKAPAPVVTKG* |
| JGI12627J18819_100041317 | 3300001867 | Forest Soil | MKKLLAAICTMGLVLCVAGCAGKAPIIGKGKAPVVQTKG* |
| JGIcombinedJ21911_100285722 | 3300002066 | Arctic Peat Soil | MKKCVVLLCSLVLVLGVAGCAGKGKAPIGKGXAPVVQTKG* |
| JGI24751J29686_101447001 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKFVXVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| BRMGV_10129301 | 3300002495 | Mangrove Soil | MKKFLVLVCSVILAIGVAGCAGKGKVPIGKGKAPVVHTKG* |
| JGIcombinedJ43975_100789171 | 3300002899 | Soil | MKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| soilL1_102010652 | 3300003267 | Sugarcane Root And Bulk Soil | MRKFVMVAIAIFAALSVAGCAGKAPIGKAPIGKGKAPVVTTKG* |
| soilH2_100879082 | 3300003324 | Sugarcane Root And Bulk Soil | MRKFVLLAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG* |
| JGI24140J50213_102857951 | 3300003369 | Arctic Peat Soil | MKKFVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0055471_101258012 | 3300003987 | Natural And Restored Wetlands | MKKFLVIVCSLALALGVASCAGKGKAPIGKGKAPVVTKG* |
| Ga0055475_100715972 | 3300003988 | Natural And Restored Wetlands | MRKVMLLMVTILTAVSVAGCVTAGKGKAPIGKGKAPVVHTKG* |
| Ga0055461_101762451 | 3300003991 | Natural And Restored Wetlands | MGGVIMKKILVLVCSAILALGVAGCAGKGKAPVGKGKAPVVHTKG* |
| Ga0055435_101211962 | 3300003994 | Natural And Restored Wetlands | MKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG* |
| Ga0055458_101659401 | 3300004000 | Natural And Restored Wetlands | MECTRWKLKRVNMGGVIMKKILVLVCSVILALGVASCAGKAPIGKGKAPVVHTKG* |
| Ga0055451_101408722 | 3300004004 | Natural And Restored Wetlands | MKMFFVIICSAVLALGLAGCAGKGKVPIGKGKAPAPVVSKG* |
| Ga0055453_100168111 | 3300004006 | Natural And Restored Wetlands | MGGVIMKKILVLVCSAILALGVASCAGKGKVPMGKGKAPVVHTKG* |
| Ga0055464_102722241 | 3300004012 | Natural And Restored Wetlands | IMKKILVLVCSAILALGVASCAGKGKVPMGKGKAPVVHTKG* |
| Ga0055452_100786921 | 3300004018 | Natural And Restored Wetlands | MHKVMLLMVTILTAVSVAGCVTAGKGKAPIGKGKAPVVHTKG* |
| Ga0055452_101543452 | 3300004018 | Natural And Restored Wetlands | GVIMKKILVLVCSVILALGVASCAGKAPIGKGKAPVVHTKG* |
| Ga0055439_100900342 | 3300004019 | Natural And Restored Wetlands | MKKILILFCSVILALGVANCAGKGKVPVGKGKAPVVHTKG* |
| Ga0062593_1007701933 | 3300004114 | Soil | MKKLVVVICSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0062593_1013458681 | 3300004114 | Soil | MGAPMRKYVLIAVAILTALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0063455_1011059631 | 3300004153 | Soil | MKKILILFCSAILALGVANCAGKGKVPVGKGKAPVVHTKG* |
| Ga0062590_1018174472 | 3300004157 | Soil | MKKILLVVCSIALALGVANCAGKGKVPIGKGKAPVVHTRG* |
| Ga0062595_1002320271 | 3300004479 | Soil | MKKILILFCSAILALGVAGCAGKGKVPIGKGKAPVVHTKG* |
| Ga0062595_1017693551 | 3300004479 | Soil | MKKFLIAICSVILAFGLTGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0062592_1027032451 | 3300004480 | Soil | MGLSMRKFVLIAVAIVSALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0066395_102479271 | 3300004633 | Tropical Forest Soil | MKKFLIVLCSFFLAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0062591_1022044261 | 3300004643 | Soil | MKKFVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0058861_113745093 | 3300004800 | Host-Associated | REMILDMGWHVMKKVMFFVCSAILVLGLAGCAGKGKVPIGKGKAPVVHTRG* |
| Ga0058861_117806541 | 3300004800 | Host-Associated | MGTRMRKFVLLAVAALAALSVAGCAGKGKAPILGKGKAPVVQTKG* |
| Ga0058860_122097991 | 3300004801 | Host-Associated | RKKLGSVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0062594_1002989632 | 3300005093 | Soil | MRKFVLIAVAIISALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0062594_1003357963 | 3300005093 | Soil | MKKLVVVFCSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066814_100557482 | 3300005162 | Soil | MRKFLVAMCSLILAFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0066814_100757132 | 3300005162 | Soil | MKKLVVVICSLVLALGLSGCVGKGKAPIGKGKAPVVQTRG* |
| Ga0068993_100766553 | 3300005183 | Natural And Restored Wetlands | MRKFLVVICSMVLAFGLAGCVGKGKAPVGKGKAPVVQTKG* |
| Ga0068997_100317041 | 3300005204 | Natural And Restored Wetlands | MKKFLVVICSMVLAFGLAGCVGKGKAPVGKGKAPVVQTKG* |
| Ga0068998_101436641 | 3300005213 | Natural And Restored Wetlands | WLMKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVIQTKG* |
| Ga0070676_107935062 | 3300005328 | Miscanthus Rhizosphere | MKKFLVVICSVVLALGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070690_1011955251 | 3300005330 | Switchgrass Rhizosphere | MKKVLIVICTAVLALGVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0070670_1001367643 | 3300005331 | Switchgrass Rhizosphere | MNFQKEGDLMKRFLIAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG* |
| Ga0066388_1000030017 | 3300005332 | Tropical Forest Soil | MRKFLVVICSVILAFGLSACGKGKAPVVGKGKAPVVQTKG* |
| Ga0066388_1000236992 | 3300005332 | Tropical Forest Soil | MGDTMKKFLVAFCSIVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1000265995 | 3300005332 | Tropical Forest Soil | MKKLLVAICSLVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1000392992 | 3300005332 | Tropical Forest Soil | MKKFVVVVCSIILSFSLASCVGKGPVGKGKAPAPVVQTKG* |
| Ga0066388_1000452696 | 3300005332 | Tropical Forest Soil | MKKFVVVLCSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1000564647 | 3300005332 | Tropical Forest Soil | MRKMLVVICSVILAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1000605337 | 3300005332 | Tropical Forest Soil | MRKLLVAMCSVILAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1002633953 | 3300005332 | Tropical Forest Soil | MKKLVVVICSLALAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1002842742 | 3300005332 | Tropical Forest Soil | MKKFLIVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG* |
| Ga0066388_1003995044 | 3300005332 | Tropical Forest Soil | MRKLLIAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1007147042 | 3300005332 | Tropical Forest Soil | MKKFLVAICSIVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1007399242 | 3300005332 | Tropical Forest Soil | MKKLVVVICSLMLAFGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1011278402 | 3300005332 | Tropical Forest Soil | MNLPTEGDLMKRFLVAICSIALAFGLAGCWTGAPLGKGKAPVVYTKG* |
| Ga0066388_1011989191 | 3300005332 | Tropical Forest Soil | MKKFLVILCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG* |
| Ga0066388_1012999911 | 3300005332 | Tropical Forest Soil | MKKFLIAVCSVVLAFGLTGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1016120071 | 3300005332 | Tropical Forest Soil | LMKKFVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1017593542 | 3300005332 | Tropical Forest Soil | MKRLLVAICSVILAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1021482282 | 3300005332 | Tropical Forest Soil | MKRFLVVICSVILAFGLSACVGKGKYPVGKGKAPVVQTKG* |
| Ga0066388_1022929642 | 3300005332 | Tropical Forest Soil | MKKLVVVICSLVLAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1039419811 | 3300005332 | Tropical Forest Soil | MKRFLVVICSVILAFGLTGCAGKGKYPVGKGKAPVVVTKG* |
| Ga0066388_1051914131 | 3300005332 | Tropical Forest Soil | YGNMGSVMKKFLIAVCSIILAIGVSGCVGKAPVGKGKAPAPVVTRG* |
| Ga0066388_1052518671 | 3300005332 | Tropical Forest Soil | LGSVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066388_1086081341 | 3300005332 | Tropical Forest Soil | MKKFVVVICSLVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070666_104887432 | 3300005335 | Switchgrass Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVDAGLI |
| Ga0070682_1001166581 | 3300005337 | Corn Rhizosphere | MKKFLVAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070691_102478962 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGNMGSAMKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG* |
| Ga0070661_1003033012 | 3300005344 | Corn Rhizosphere | MRKFLVVICSMVLAFGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070668_1005176491 | 3300005347 | Switchgrass Rhizosphere | MKQIVIAICAIALSIGVVACVGKSPVGKGKAPPPVVTRG* |
| Ga0070659_1011854312 | 3300005366 | Corn Rhizosphere | MRHRFTLNNPKGLSMRKFVLIAVAIISALSVAGCAGKGKSPIGKGKAPVVQTRG* |
| Ga0070709_100028082 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKFVIVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070714_1019502161 | 3300005435 | Agricultural Soil | MKKFLIAICSVVLAFGLTGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070713_1020083451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLLALICTVGLVLCVAGCAGKAPIIGKGKAPVVQTKG* |
| Ga0070710_110490471 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKLLVVICSAVLAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070705_1000165975 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKFMVVICSVILAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070700_1014460622 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGDLMKKFLVAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG* |
| Ga0070708_1009110062 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKFLVVLCSAILAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070708_1011304981 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKFLVVICSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070681_106875291 | 3300005458 | Corn Rhizosphere | MGTRMRKFVLLAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG* |
| Ga0070741_1001276610 | 3300005529 | Surface Soil | MKKILILFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG* |
| Ga0070679_1000459973 | 3300005530 | Corn Rhizosphere | MRKLLLAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070684_1014643542 | 3300005535 | Corn Rhizosphere | MRKYVLIAVAILTALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0070665_1022562862 | 3300005548 | Switchgrass Rhizosphere | MKKFLVVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVT |
| Ga0066699_111305482 | 3300005561 | Soil | VGWLMKKFLVVLCSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0068854_1007023321 | 3300005578 | Corn Rhizosphere | MRKFLVVICSMVLAFGLSGCIGKGKAPVGKGKAPVVQT |
| Ga0068854_1021232771 | 3300005578 | Corn Rhizosphere | MRKFVLLAVAALAALSVAGCAGKGKAPILGKGKAPVVQTKG* |
| Ga0075040_15618422 | 3300005646 | Permafrost Soil | LGCVMKKFLVIICTAILAFGLSACAGKAPIGKGKGKAPVVQTKG* |
| Ga0066905_1000079688 | 3300005713 | Tropical Forest Soil | MKKFLVAFCSVVLAFGLVGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066905_1000883373 | 3300005713 | Tropical Forest Soil | MVKVLSFICALVLAVGLGGCMGKGKAPVGKGKAPVVQTRG* |
| Ga0066905_1018947011 | 3300005713 | Tropical Forest Soil | NLRILKGCSMRKLLAAVCCVILAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0066905_1023331081 | 3300005713 | Tropical Forest Soil | MKKFLVAVCSIVIALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0068866_106189691 | 3300005718 | Miscanthus Rhizosphere | VGCLMKKLVVVICSLMLALGLSGCIGKGKAPVGKGKAPVVQTR |
| Ga0066903_1014756752 | 3300005764 | Tropical Forest Soil | VIQTLSRKKLGSVMKKFLIVLCSAVLAFGFAGCVGKAPLGKGKAPAPVVTRG* |
| Ga0066903_1022846423 | 3300005764 | Tropical Forest Soil | MKKFLIVLCSAVLAFGFAGCVGKAPLGKGKAPAPVVTRG* |
| Ga0066903_1038462312 | 3300005764 | Tropical Forest Soil | MKKLLFVVCSVILAFGVAGCVGKAPVGKGKAPAPVVQTKG* |
| Ga0066903_1047098081 | 3300005764 | Tropical Forest Soil | MKKFLVVICSMILALGLASCGKGKAPVGKGKAPVVQTKG* |
| Ga0066903_1056428011 | 3300005764 | Tropical Forest Soil | KFLVVMCSVVLALGLAGCVGKGKAPVGKGKAPVVQTRG* |
| Ga0066903_1075851622 | 3300005764 | Tropical Forest Soil | DPSCFRRGYSMRKLLVAMCSVILAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066903_1076516372 | 3300005764 | Tropical Forest Soil | VGTLVKKLLIAICSVFLAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0066903_1076987861 | 3300005764 | Tropical Forest Soil | SDKGGKMKKFLVVVCSVLLAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0075293_10447871 | 3300005875 | Rice Paddy Soil | MGGVIMKKILVLVCSAILALGVAGCAGKGKVPMGKGKAPVVHTKG* |
| Ga0075296_10083651 | 3300005877 | Rice Paddy Soil | MGGVIMKKILILVCSAILALGVAGCAGKGKVPMGKGKAPVVHTKG* |
| Ga0075289_10561841 | 3300005888 | Rice Paddy Soil | MGGVIMKKILVIVCSAILALGVAGCAGKGKAPMGKGKAPVVHTKG* |
| Ga0081455_1001123915 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKKFLVVICSVVLAFGLAGCVGKAPLGKGKAPVVQTRG* |
| Ga0081455_100208011 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKRLLVAMCSVLLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0066795_100655872 | 3300005938 | Soil | MKKIVVVICTVVLALGVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0066795_100785111 | 3300005938 | Soil | MRKFVVVICAAVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0066795_100895882 | 3300005938 | Soil | MKKFVVIICTAVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0066795_101864272 | 3300005938 | Soil | MKKMVVVMCTIVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0066795_102221142 | 3300005938 | Soil | MKKFVVLLCSLILVLGVAGCAGKGKAPIGKGKAPV |
| Ga0066794_100204752 | 3300005947 | Soil | MKKFLVIICTAVLALGVAGCAGKGKAPIGKGKGKAPVVQTKG* |
| Ga0066798_100363082 | 3300005980 | Soil | MKKCVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0066798_100466393 | 3300005980 | Soil | MKKFLVVICTAVLALGVAGCAGKGKAPVGKGKAPVVQTKG* |
| Ga0081540_10073285 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKKFLIAVCSIVLAIGVAGCVGKAPLGKGKAPVVQTRG* |
| Ga0081540_10599092 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKKFLIAICSVILAIGLTGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0081540_10880161 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MTFSDGDSFMKKFLVSICSVVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0070717_119004192 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVLVAICFAVLAFGVVGCIGKGKAPVGKGKAPVVQT |
| Ga0075023_1000055857 | 3300006041 | Watersheds | MKTFLVVICSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG* |
| Ga0075023_1002431102 | 3300006041 | Watersheds | MKKFLVVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075023_1004747771 | 3300006041 | Watersheds | VICSMVLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075024_1000263741 | 3300006047 | Watersheds | MKKFLIVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075024_1001718202 | 3300006047 | Watersheds | MKKFLVVICSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075024_1008578981 | 3300006047 | Watersheds | VVICSMILAFGLVGCVGKGKAPVGKGKAPVVQTKG* |
| Ga0075417_100153814 | 3300006049 | Populus Rhizosphere | MTFSDGDSFMKKFLVAICSVVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075028_1000069366 | 3300006050 | Watersheds | VGWLMKKFLVVICSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG* |
| Ga0075028_1000957343 | 3300006050 | Watersheds | MRKLLVAMCSLILVFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075028_1008284932 | 3300006050 | Watersheds | VGWLMKKFLVVICSLFLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0097691_100590113 | 3300006055 | Arctic Peat Soil | WGCVMKKFVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0097691_10164125 | 3300006055 | Arctic Peat Soil | VVVICAAVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0075026_1007731352 | 3300006057 | Watersheds | MKKFLALMCSMVLAFGFAGCAGKAPVGKGKAPVVQTR |
| Ga0075017_1007435531 | 3300006059 | Watersheds | MKKILILFCSVVLAIGVAGCAGKGKVPIGKGKAPVVHTKG* |
| Ga0075018_101502212 | 3300006172 | Watersheds | MKKFFVVICSMVLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075018_103072912 | 3300006172 | Watersheds | VKKFLVVICSAILAFGLAGCIGKGKAPVGKGKAPIVQTKG* |
| Ga0075018_104572261 | 3300006172 | Watersheds | MKKFLIVICSAVLAFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0070716_1005533382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVVICSVVLALGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070712_1005804842 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQFLIAICSIILAIGVVGCVGKGPIGKGKAPPPPVVTRG* |
| Ga0070712_1008123411 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLLVVICSAVLAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0070712_1012385612 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLVVVICSLMLALGLSGCIGKGKAPIGKGKAPVVQTRG* |
| Ga0075021_107884621 | 3300006354 | Watersheds | MNKFLVVICSVILAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0068871_1000017132 | 3300006358 | Miscanthus Rhizosphere | MKKFMIAVCSIVLAIGVTGCVGKAPVGKGKAPVVQTRG* |
| Ga0074054_118724421 | 3300006579 | Soil | VVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0074057_109638333 | 3300006605 | Soil | KKFLVVICSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0075527_100061492 | 3300006640 | Arctic Peat Soil | MRKFVVVICTAVLALGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0079222_100476044 | 3300006755 | Agricultural Soil | MKKFLVVIYSIILAFGVSGCLGKGKSPVGKGKAPVVQTKG* |
| Ga0079222_100495434 | 3300006755 | Agricultural Soil | MKKFLVVMCSLFLAFGLSGCIGKGKSPVGKGKAPVVQTKG* |
| Ga0079222_102773712 | 3300006755 | Agricultural Soil | MVAIAIFAALSVAGCAGKAPIGKAPIGKGKAPVVTTKG* |
| Ga0079220_112551472 | 3300006806 | Agricultural Soil | MRKFVRVAIAIFAALSVAGCAGKAPIGKAPIGKGKAPVVTTKG* |
| Ga0075428_1009219482 | 3300006844 | Populus Rhizosphere | NKYLLVAVAIVAALSVAGCAGKAPPIGKGKAPAPIVTKG* |
| Ga0075430_1000021475 | 3300006846 | Populus Rhizosphere | MKKFLVAVCSVVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075433_100312364 | 3300006852 | Populus Rhizosphere | MKKFLVAICSVVLAFGVAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075425_1000625255 | 3300006854 | Populus Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG* |
| Ga0075425_1000989356 | 3300006854 | Populus Rhizosphere | LQTGDLMRKVLVAVFSVILALGLSGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075425_1001026783 | 3300006854 | Populus Rhizosphere | MKKFVVVICSVALAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075425_1002462341 | 3300006854 | Populus Rhizosphere | IVIAICAIALSIGVVACVGKSPVGKGKAPPPVVTRG* |
| Ga0066797_10684752 | 3300006864 | Soil | MKKCVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0075434_1000714814 | 3300006871 | Populus Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPPPVVTRG* |
| Ga0073928_105199532 | 3300006893 | Iron-Sulfur Acid Spring | MKKILILVCSVILALGVANCAGKGKVPIGKGKAPVVHTKG* |
| Ga0075424_1001241512 | 3300006904 | Populus Rhizosphere | MRKVLVAVFSVILALGLSGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0075424_1025976282 | 3300006904 | Populus Rhizosphere | MKKVLVTICSVILAFGLTACVGKGPIGKGKAPPPVVTR |
| Ga0075436_1003028382 | 3300006914 | Populus Rhizosphere | MRKVLVAVFSVILALGLSGCWGKGKAPVGKGKAPIVQARG* |
| Ga0075436_1009851811 | 3300006914 | Populus Rhizosphere | LMKKLVVVFCSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0075436_1010376741 | 3300006914 | Populus Rhizosphere | MKKFLVAVCSVVLALGLAGCWGKGKAPVGKGKAPVVQTR |
| Ga0075436_1015318871 | 3300006914 | Populus Rhizosphere | MKQFLIAICSIILAIGVVGCVGKGPIGKGKAPPPVV |
| Ga0075528_101078042 | 3300006949 | Arctic Peat Soil | MANRGVMKKIVIVICTVVLAIGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0079219_108622432 | 3300006954 | Agricultural Soil | MKKFLVVMCSLFLAFGLSGCIGKGKSPVGKGKAPVV |
| Ga0075435_1009588441 | 3300007076 | Populus Rhizosphere | QIVIAICAVALSIGVVACVGKSPVGKGKAPPPVVTRG* |
| Ga0102950_10351442 | 3300007764 | Soil | MACTRKRVTRVNMGGVIMKKILVIVCSAILAIGVAGCAGKAPVGKGKAPVVHTKG* |
| Ga0102952_10078442 | 3300007769 | Soil | MGGVIMKKILVIVCSAILAIGVAGCAGKAPVGKGKAPVVHTKG* |
| Ga0066710_1002689522 | 3300009012 | Grasslands Soil | MRKFLVVICSMVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0111539_112063302 | 3300009094 | Populus Rhizosphere | MGLSMRKFVLIAVAIISALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0105245_124393001 | 3300009098 | Miscanthus Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPV |
| Ga0105245_124582281 | 3300009098 | Miscanthus Rhizosphere | MKKVLVTICSVILAFGLTACVGKGPVGKGKAPPPVVTRG* |
| Ga0075418_116667961 | 3300009100 | Populus Rhizosphere | FLVAICSVVLAFGVAACWGKGKAPVGKGKAPVVQTRG* |
| Ga0114129_100676767 | 3300009147 | Populus Rhizosphere | MKKFLIAICSVVLAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0105248_130464662 | 3300009177 | Switchgrass Rhizosphere | MRKLLLAMCSVILAFGVTGCIGKGKAPVGKGKAPVVQT |
| Ga0116854_11135652 | 3300009400 | Soil | MGIPMRKYVLIAVAVLTALSVAGCAGKGKAPILGKGKAPVVQTRG* |
| Ga0118657_1000048247 | 3300009506 | Mangrove Sediment | MGGVIMKKILVLVCSTILALGVASCAGKGKVPIGKGKAPVVHTKG* |
| Ga0116221_10728571 | 3300009523 | Peatlands Soil | MKKFLVIVCSLALALSVAGCVGKGKYPVGKGKAPP |
| Ga0105859_12765541 | 3300009651 | Permafrost Soil | MKKFLVIICTAILAFGLSACAGKAPIGKGKGKAPVVQTKG* |
| Ga0126374_100165283 | 3300009792 | Tropical Forest Soil | MKKVVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0126380_111214852 | 3300010043 | Tropical Forest Soil | MKKLLVVICSVVLALGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0126384_101789641 | 3300010046 | Tropical Forest Soil | MKKFLVVICSMVLAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0126384_105928671 | 3300010046 | Tropical Forest Soil | KFVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0127503_111212222 | 3300010154 | Soil | KKLVVVICSLVLALGLSGCVGKGKAPVGKGKAPVVQTRG* |
| Ga0126370_116009192 | 3300010358 | Tropical Forest Soil | FIVVICSVVLAFGLAGCWGKAPVGKGKAPVVQTRG* |
| Ga0126372_125571861 | 3300010360 | Tropical Forest Soil | ALMRKFLVAIFSVILAFGLSGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0126372_129242132 | 3300010360 | Tropical Forest Soil | MKKFLVVICSMVLAFGLAGCVGKAPVGKGKAPVVQTR |
| Ga0126377_120409281 | 3300010362 | Tropical Forest Soil | SRKKLGSVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0126377_120691612 | 3300010362 | Tropical Forest Soil | MKKFVIAICSVILAVGLTGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0134125_101247982 | 3300010371 | Terrestrial Soil | MKKFLVAMCSVILAFGLTGCIGKAPVGKGKAPVVQTRG* |
| Ga0126381_1035316432 | 3300010376 | Tropical Forest Soil | APFSNGDLHMRKLMVVICSAILAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0126381_1044573551 | 3300010376 | Tropical Forest Soil | LMKKVVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0136449_1001418732 | 3300010379 | Peatlands Soil | MNRFLVIVVSLVLALGVAGCAGKGKAPIGKGKAPAPVVTKG* |
| Ga0134124_125694511 | 3300010397 | Terrestrial Soil | FLVAICSIALAFGLAGCWAGSPVGKGKAPVVYTRG* |
| Ga0134127_130885412 | 3300010399 | Terrestrial Soil | MKKFLIVLCSAVLAFGFAGCVGKGPIGKGKAPPPPVVTRG |
| Ga0134121_127657281 | 3300010401 | Terrestrial Soil | MKKFLIAVCSIVLAVGISGCVGKAPVGKGKAPPPV |
| Ga0105246_110978632 | 3300011119 | Miscanthus Rhizosphere | GAEHMKKVLVTICSVILAFGLTACVGKGPVGKGKAPPPVVTRG* |
| Ga0153954_10750422 | 3300011418 | Attine Ant Fungus Gardens | MNKFLALVCTVLLGLCVAGCAGKAPIVGKGKAPVVQTKG* |
| Ga0120139_10102161 | 3300012019 | Permafrost | MKKFLVVICTVVLALGLAGCAGKGKTPIGKGQAPAPVGTKG |
| Ga0137381_113942891 | 3300012207 | Vadose Zone Soil | MKKFLVVLCSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0137379_109724412 | 3300012209 | Vadose Zone Soil | MIRGISNGAPMRKFLVVICSVILAFGLSGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0150985_1016972482 | 3300012212 | Avena Fatua Rhizosphere | TGGVTMKKILILFCSAILALGVANCAGKGKVPVGKGKAPVVHTKG* |
| Ga0150985_1071134412 | 3300012212 | Avena Fatua Rhizosphere | MRKYVLIAVAVLTALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0150985_1162244841 | 3300012212 | Avena Fatua Rhizosphere | DFNIHIKNPMGTRMRKFVLLAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG* |
| Ga0150984_1079346582 | 3300012469 | Avena Fatua Rhizosphere | MRKYVLIAVAVLTALSVAGCAGKGKSPIGKGKAPVVQTRG* |
| Ga0150984_1091052681 | 3300012469 | Avena Fatua Rhizosphere | MRKFVLIAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG* |
| Ga0150984_1165977241 | 3300012469 | Avena Fatua Rhizosphere | MRKYILVAVAVLAALSVAGCAGKGKAPIIGKGKAPV |
| Ga0150984_1185535262 | 3300012469 | Avena Fatua Rhizosphere | DDFNIHIKNPMGTRMRKFVLLAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG* |
| Ga0157333_10322761 | 3300012484 | Soil | MKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKDPVVQTRG* |
| Ga0157292_101144541 | 3300012900 | Soil | MRHRFTLNNPKGLSMRKFVLIAVAIISALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0137413_108378731 | 3300012924 | Vadose Zone Soil | MKKFLVIICTAVLAFGVAGCAGKGKAPIGKGKAPVVQTKG* |
| Ga0153915_105298031 | 3300012931 | Freshwater Wetlands | MKKILILFCSVVLALGVASCAGKGKVPIGKGKAPVVHTKG* |
| Ga0153915_107028272 | 3300012931 | Freshwater Wetlands | MKKILILFCSAILALGVANCAGKGKVPIGKGKAPVVHTKG* |
| Ga0126375_100016354 | 3300012948 | Tropical Forest Soil | MRKFLVAVFSVVFAFGLSGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0164300_104415442 | 3300012951 | Soil | MKKVLVILCSVVLAVGLAGCAGKGKAPIGKGKAPVPVVTKG* |
| Ga0164298_100598015 | 3300012955 | Soil | FVVVICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0164298_108703752 | 3300012955 | Soil | MKKLLVVVCSLVLALGLSGCVGKGKAPVGKGKAPVVQTRG* |
| Ga0164298_115855941 | 3300012955 | Soil | MKKVLVTICSVILAFGLTACVGKGPIGKGKAPPPVVTRG* |
| Ga0164303_102592641 | 3300012957 | Soil | LMNFQKEGDLMKRFLVAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG* |
| Ga0164303_107666121 | 3300012957 | Soil | NGAEHMKKVLVTICSVILAFGLTACVGKGPVGKGKAPPPVVTRG* |
| Ga0164303_110175372 | 3300012957 | Soil | GRILVKKLLVVLCPAALALGLAECIGKGKAPVGKGKAPVVQTRG* |
| Ga0153916_133014602 | 3300012964 | Freshwater Wetlands | MKKFLAVISTVILALSIAGCAGKGKAPIGKGKGKAPVVQTKG* |
| Ga0126369_100450294 | 3300012971 | Tropical Forest Soil | MRKLLVLICSMALAFGLTACVGKAPVGKGKAPGPVVTRG* |
| Ga0126369_100502943 | 3300012971 | Tropical Forest Soil | MKRFLVVVCSVVLAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0126369_121586972 | 3300012971 | Tropical Forest Soil | GSVMKKFLVVLCSAVIAFGFAGCVGKGPIGKGKAPPPVVTRG* |
| Ga0126369_124199731 | 3300012971 | Tropical Forest Soil | SKIGGRVMKKFLIVLCSFFLAFGLTGCIGKGKAPVGKGKAPVV* |
| Ga0126369_130345621 | 3300012971 | Tropical Forest Soil | MKKFLIAICSIVLAIGVSGCVGKAPLGKGKAPAPV |
| Ga0164309_100190666 | 3300012984 | Soil | MRKLLVVVCSMVLAFGLAGCIGKGKSPVGKGKAPVVQTRG* |
| Ga0164309_103502853 | 3300012984 | Soil | VICSVVLAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0164306_118219171 | 3300012988 | Soil | MEGDLMKKFLVAIRSIALAFGLAGCWAGSPVGKGKAPVVYTK |
| Ga0164305_100096685 | 3300012989 | Soil | MRKLLVAMCSVILAFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0157371_109512781 | 3300013102 | Corn Rhizosphere | MKKVLVILRSVVLAVGLAGCVGKGKAPIGKGKAPAPV |
| Ga0157374_100763975 | 3300013296 | Miscanthus Rhizosphere | LFRFNWWGALMKKLVVVFCSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0157374_101454364 | 3300013296 | Miscanthus Rhizosphere | MRKLLLAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQT |
| Ga0157378_100321804 | 3300013297 | Miscanthus Rhizosphere | MRKLLVVICSMALAFGLTACVGKAPVGKGKAPAPVVTRG* |
| Ga0157378_118527871 | 3300013297 | Miscanthus Rhizosphere | IIKGHLMKKFLVVICSVVLALGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0157375_124790121 | 3300013308 | Miscanthus Rhizosphere | EVMKKFVVVVCSVVLAFGLAGCWGKAPVGKGKAPVVQTRG* |
| Ga0120127_100171723 | 3300013503 | Permafrost | MKKILILFCSVILAIGVAGCAGKGKVPIGKGKAPVVH |
| Ga0120127_100582762 | 3300013503 | Permafrost | ILFCSVILAIGVAGCAGKGKVPIGKGKAPVVHTKG* |
| Ga0120123_11592491 | 3300013770 | Permafrost | MKKILILFCSVILALGVASCAGKGKVPIGKGKAPVVHTKG* |
| Ga0120158_102046851 | 3300013772 | Permafrost | MKKFLVVIGTVILALSVAGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0120158_103018182 | 3300013772 | Permafrost | MKKIGIIICTFVLAIGVSGCAGKGKAPIGKGKAPVVQTRG* |
| Ga0075302_11802481 | 3300014269 | Natural And Restored Wetlands | MKKFLVVLCSVFLAFGLTACVGKGKAPVGIGQAPVVQT* |
| Ga0075354_10513731 | 3300014308 | Natural And Restored Wetlands | REQEVGWLMKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG* |
| Ga0075316_11170692 | 3300014314 | Natural And Restored Wetlands | MKTFLVIICSAVLALGVAGCAGKGKAPIGKGKAPVVTKG* |
| Ga0182021_108296121 | 3300014502 | Fen | SIQFKEGLMRKFLVLAVTILTAVSVAGCVSGKGKAPIGKGKGKAPVVQTKG* |
| Ga0182021_115490511 | 3300014502 | Fen | MKKIMVVFCTLVLAIGVAGCAGKGKAPIGKGKGKAPVVTTKG* |
| Ga0157379_101603113 | 3300014968 | Switchgrass Rhizosphere | MKKFLVVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG* |
| Ga0157379_105561421 | 3300014968 | Switchgrass Rhizosphere | SVMKKFLVVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG* |
| Ga0157379_121785611 | 3300014968 | Switchgrass Rhizosphere | LVAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG* |
| Ga0157376_115593122 | 3300014969 | Miscanthus Rhizosphere | AEQMKKVLVAICSVILAFGLAGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0167649_1064703 | 3300015063 | Glacier Forefield Soil | MKKIMVVFCTVVLAIGVAGCAGKGKAPIGKGKGKAPVVTTKG* |
| Ga0167649_1094592 | 3300015063 | Glacier Forefield Soil | MRKILILAVTILTAVSVAGCVSGKGKAPIGKGKGKAPVVQTKG* |
| Ga0167639_10208412 | 3300015080 | Glacier Forefield Soil | MKKFLVIICTAVLAFGLSACAGKAPIGKGKGKAPVVQTKG* |
| Ga0167653_10239881 | 3300015162 | Glacier Forefield Soil | MKKIVVVICTAVLALGVAGCAGKGKSPIGKGKAPVVQTKG* |
| Ga0167648_10314572 | 3300015171 | Glacier Forefield Soil | MRKFLILAVTILTAVSVAGCVSGKGKAPIGKGKGKAPVVHTKG* |
| Ga0132258_104948167 | 3300015371 | Arabidopsis Rhizosphere | SDKGGKMKKFLVVICSVLLAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0132258_128358292 | 3300015371 | Arabidopsis Rhizosphere | MKKVLVAICFAVLAFGVVGSIGKGKESVGERKAPVVQTRG* |
| Ga0132258_130977103 | 3300015371 | Arabidopsis Rhizosphere | MRKLLVAACSIVLALGLAGCIGKGKAPVGKGKAPVVQ |
| Ga0132258_139622751 | 3300015371 | Arabidopsis Rhizosphere | GIPMKKFLIAICSVILAFGLAGCVGKAPVGKGKAPVVQTRG* |
| Ga0132256_1034772142 | 3300015372 | Arabidopsis Rhizosphere | VAVFSVILALGLSGCWGKGKAPVGKGKAPVVQTRG* |
| Ga0132257_1045282281 | 3300015373 | Arabidopsis Rhizosphere | MRKLLVAVCSIVLALGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0132255_10000705318 | 3300015374 | Arabidopsis Rhizosphere | RKLLVVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG* |
| Ga0132255_1005350983 | 3300015374 | Arabidopsis Rhizosphere | MRKLLVAACSIVLALGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0132255_1005661732 | 3300015374 | Arabidopsis Rhizosphere | MKKLLVVICSVILAIGLAGCVGKGKAPVGKGKAPVVQTRG* |
| Ga0132255_1022071542 | 3300015374 | Arabidopsis Rhizosphere | MRKLLVAVCSIVLGFGLAGCIGKGKAPVGKGKAPVVQTRG* |
| Ga0163161_104444942 | 3300017792 | Switchgrass Rhizosphere | LFRFNWWGALMKKLVVVFCSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG |
| Ga0187786_100131912 | 3300017944 | Tropical Peatland | MKKILILFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0187786_105618161 | 3300017944 | Tropical Peatland | TMKKILIVFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0187785_1000004335 | 3300017947 | Tropical Peatland | VGWLMKKFLVVLCSVFLAFGLTGCGKGKAPVVGKGKAPVVQTKG |
| Ga0187785_100217231 | 3300017947 | Tropical Peatland | TVGWLMKKFLVVICSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG |
| Ga0187785_106013211 | 3300017947 | Tropical Peatland | MKKFLVVICSVILAFGLTGCIGKGKAPVGKGKAPVVQTKG |
| Ga0187779_1000023332 | 3300017959 | Tropical Peatland | MKKILILFCSVILAIGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0187779_100062585 | 3300017959 | Tropical Peatland | MKKILFVICSVILAFGVSGCVGKGKAPVGKGKAPVVQTKG |
| Ga0187779_100191215 | 3300017959 | Tropical Peatland | MLDSLTWGLLVKKFLVVICSVILAFGLAGCAGKGKYPVGKGKAPVVQTKG |
| Ga0187779_100738111 | 3300017959 | Tropical Peatland | MKRFLVVICSVILAFGLSGCVGKGKAPVGKGKAPVVQTKG |
| Ga0187779_101153871 | 3300017959 | Tropical Peatland | MKKFFILICSIVLAFGLTGCGKGKAPVGKGKAPVVQTKG |
| Ga0187778_100936592 | 3300017961 | Tropical Peatland | MRKFLIVGIAILTALTIAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0187778_104761762 | 3300017961 | Tropical Peatland | MKKILILFCSVILALGVANCAGKGKVPIGKGKAPVVHTKG |
| Ga0187776_103581142 | 3300017966 | Tropical Peatland | VKYVAKTEQEVGWLMKKFLVVLCSVFLAFSLTACVGKGKAPYVGKGKAPAPVVTKG |
| Ga0187776_113010432 | 3300017966 | Tropical Peatland | MRKIFLLAIIVVAAVSVAGCAGKGKMPIGKGKTPVVVTKG |
| Ga0187780_103403712 | 3300017973 | Tropical Peatland | CTRDGVKRVNTGGVTMKKILILFCSVILALGVANCAGKGKVPIGKGKAPVVHTKG |
| Ga0187782_112332272 | 3300017975 | Tropical Peatland | VKKIVVIVSALALALSVAGCVGKGKAPIGKGKAPPPP |
| Ga0187787_100637193 | 3300018029 | Tropical Peatland | VKYTTKREQEVGWLMKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG |
| Ga0187787_102073962 | 3300018029 | Tropical Peatland | VKYVAKTEQEVGWLMKKFLVVLCSVFLAVGLTACVGKGKAPVGKGKAPVVQTKG |
| Ga0187788_100093504 | 3300018032 | Tropical Peatland | MGGVIMKKILVIVCSAILALGVAGCAGKAPMGKGKAPVVHTKG |
| Ga0187788_100337512 | 3300018032 | Tropical Peatland | VKYITKREQEVGWLMKKFLVVLCSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG |
| Ga0187788_100889031 | 3300018032 | Tropical Peatland | MKKVLVIFCSLIVAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0187788_103553431 | 3300018032 | Tropical Peatland | MKKILILFCSVILALGVAGCAGKVPIGKGKAPVVHTKG |
| Ga0187766_100820222 | 3300018058 | Tropical Peatland | MRLMKKFFILICSIVLAFGLTGCGKGKAPVGKGKAPVVQTKG |
| Ga0187766_101364112 | 3300018058 | Tropical Peatland | MKRFLVVICSVILAFGLSGCVGKGEAPVGKGKAPVVQTKG |
| Ga0187773_101380382 | 3300018064 | Tropical Peatland | VKYTTKREQEVGWLMKKFLVVLCSVFLAFGLTACVGKGKSPVGKGKAPVVQTKG |
| Ga0187773_108938492 | 3300018064 | Tropical Peatland | KALRVNMGGVIMKKILVIVCSAILALGVAGCAGKAPMGKGKAPVVHTKG |
| Ga0184612_103812322 | 3300018078 | Groundwater Sediment | MKKFLIAICSVVLAVGLTGCWGKGKAPVGKGKAPVVQT |
| Ga0184625_106175212 | 3300018081 | Groundwater Sediment | MKKFLIAICSVILAIGLTGCWGKGKAPVGKGKAPVVQT |
| Ga0190265_129381762 | 3300018422 | Soil | MGLSMRKFVLIAVAIVSALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0190272_101827972 | 3300018429 | Soil | MGLSMRKFVLIAVAIVSALSVAGCAGKGKSPIGKGKAPVVQTRG |
| Ga0190269_112624321 | 3300018465 | Soil | MRKFVLIAVAIVSALSVAGCAGKGKAPIGKGKAPVVQT |
| Ga0190274_100629982 | 3300018476 | Soil | MRKFVLIAVAIVSALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0190267_116270641 | 3300019767 | Soil | MNKFWVVVCSLVLAVGLAGCAAGKGKAPIGKGKGKAPVVQTRG |
| Ga0193715_11211822 | 3300019878 | Soil | MKKFLVVVCSMVLAFGLAGCWGKGKAPVGKGKAPV |
| Ga0193721_10293993 | 3300020018 | Soil | MKKFLVILCSAVLAFGLAGCVGKAPVGKGKAPAPVVTRG |
| Ga0193721_10968191 | 3300020018 | Soil | MMKKFLVAICSIVLAFGLTGCWGKGKAPVGKGKAPVVQTRG |
| Ga0206352_105838081 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGSVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0196977_11260562 | 3300020146 | Soil | MRKFVMVAVAIFAALSVAGCAGKAPVGKAPIGKGKAPVVQTKG |
| Ga0187768_10966282 | 3300020150 | Tropical Peatland | MKKFLVVLCSVFLAFGLTGCGKGKAPVVGKGKAPVVQTKG |
| Ga0213847_10005281 | 3300021938 | Watersheds | QTVGWLMKKFLVVICSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG |
| Ga0213847_11862672 | 3300021938 | Watersheds | MKKFLIVICSAVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0224548_10020294 | 3300022518 | Soil | MKKMVVVMCTIVLALGVAGCAGKGNAPIGKGKAPVVQTKG |
| Ga0224548_10161551 | 3300022518 | Soil | MKKFVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0212123_109006022 | 3300022557 | Iron-Sulfur Acid Spring | MKKILILVCSVILALGVANCAGKGKVPIGKGKAPVVHTKG |
| Ga0222622_104059631 | 3300022756 | Groundwater Sediment | KLLVVICSVALAFGLTACVGKAPVGKGKAPAPVVTRG |
| Ga0208850_10016204 | 3300025457 | Arctic Peat Soil | MKKFLVVICTAVLALGVAGCAGKGKAPVGKGKAPVVQTKG |
| Ga0208587_10588392 | 3300025484 | Arctic Peat Soil | GRVMKKIVVVICTVVLALGVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0207932_10028104 | 3300025495 | Arctic Peat Soil | MKKIVIVICTVVLAIGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0208080_10025778 | 3300025553 | Arctic Peat Soil | MKKFLVIICTAVLALGVAGCAGKGKAPIGKGKGKAPVVQTKG |
| Ga0210120_10837231 | 3300025556 | Natural And Restored Wetlands | MGGVIMKKILVLVCSAILALGVASCAGKGKVPMGKGKAPVVHTKG |
| Ga0207930_10913241 | 3300025604 | Arctic Peat Soil | KFVVVICAAVLALGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0209638_10874702 | 3300025725 | Arctic Peat Soil | MKKFVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0210100_10028763 | 3300025780 | Natural And Restored Wetlands | MKKFLVIVCSLALALGVASCAGKGKAPIGKGKAPVVTKG |
| Ga0210100_10267422 | 3300025780 | Natural And Restored Wetlands | MRKLLTLALVVLAALSVAACAGKGKAPIGKGKAPVVTRG |
| Ga0210062_100002811 | 3300025797 | Natural And Restored Wetlands | MRKVMLLMVTILTAVSVAGCVTAGKGKAPIGKGKAPVVHTKG |
| Ga0209176_100576402 | 3300025854 | Arctic Peat Soil | ETGVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0209014_103017081 | 3300025857 | Arctic Peat Soil | LVVICTAVLALGVAGCAGKGKAPVGKGKAPVVQTKG |
| Ga0209585_105026041 | 3300025891 | Arctic Peat Soil | MKKIGIIICTFVLAIGVSGCAGKGKAPLGKGKAPVVQTRG |
| Ga0207685_104206701 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TMLGNMGSAMKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0207699_103763171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0207645_100314032 | 3300025907 | Miscanthus Rhizosphere | MKKLVVVFCSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG |
| Ga0207654_102536151 | 3300025911 | Corn Rhizosphere | MNKFMVVICSVILAFGLAGCIGKGKAPVGKGKAPVVQTRG |
| Ga0207654_113792091 | 3300025911 | Corn Rhizosphere | MRKFVLLAVAALAALSVAGCAGKGKAPILGKGKAPVVQTKG |
| Ga0207707_106049302 | 3300025912 | Corn Rhizosphere | MRKFVLLAVAALAALSVAGCAGKGKAPIIGKGKAPVVQTKG |
| Ga0207663_114158582 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLLVVVCSLVLALGLSGCVGKGKAPVGKGKAPVVQTRG |
| Ga0207646_111397142 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KKFLVVICSVVLALGLAGCIGKGKAPVGKGKAPVVQTRG |
| Ga0207694_106326141 | 3300025924 | Corn Rhizosphere | CPVCTSWIVKRVNTGGVTMKKILILFCSAILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0207700_111668982 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKLLVAMCSVILAFGLAGCIGRGKAPVGKGKAPVV |
| Ga0207644_118117461 | 3300025931 | Switchgrass Rhizosphere | MEGDLMKKFLVAIRSIALAFGLAGCWAGSPVGKGKAPVVYTKG |
| Ga0207706_110699942 | 3300025933 | Corn Rhizosphere | MRKLLLAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQTRG |
| Ga0207686_100885044 | 3300025934 | Miscanthus Rhizosphere | FEGDPMRKLLVVICSMALAFGLTACVGKAPVGKGKAPAPVVTRG |
| Ga0207709_107539801 | 3300025935 | Miscanthus Rhizosphere | WQYKMLGKMGSAMKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0207665_102728462 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GDSMKKFMIAVCSIVLAIGVTGCVGKAPVGKGKAPVVQTRG |
| Ga0207691_111990491 | 3300025940 | Miscanthus Rhizosphere | KKFMIAVCSIVLAIGVTGCVGKAPVGKGKAPVVQTRG |
| Ga0207711_108875501 | 3300025941 | Switchgrass Rhizosphere | MKKFLVAMCSVILAFGLTGCIGKGKAPVGKGKAPVVQTR |
| Ga0207679_110717901 | 3300025945 | Corn Rhizosphere | MKKLVVVICSLMLALGLSGCIGKGKAPVGKGKAPVV |
| Ga0210071_10205332 | 3300025955 | Natural And Restored Wetlands | MKKFLVVICSVVLAFGLAGCVGKGKAPVGKGKAPVVQTKG |
| Ga0210071_10356101 | 3300025955 | Natural And Restored Wetlands | MKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG |
| Ga0207651_102438551 | 3300025960 | Switchgrass Rhizosphere | VVICSVVLALGLAGCIGKGKAPVGKGKAPVVQTRG |
| Ga0207651_111864132 | 3300025960 | Switchgrass Rhizosphere | VLIAVAILTALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0210078_10065712 | 3300025979 | Natural And Restored Wetlands | MKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVIQTKG |
| Ga0207677_122978391 | 3300026023 | Miscanthus Rhizosphere | MKKFLIAVCSIVLAIGVSGCVGKAPLGKGKAPPPV |
| Ga0208421_10197411 | 3300026058 | Natural And Restored Wetlands | VMKKFLVIVCSLALALGVASCAGKGKAPIGKGKAPVVTKG |
| Ga0207678_109240041 | 3300026067 | Corn Rhizosphere | YKMLGNMGSAMKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0207702_111517541 | 3300026078 | Corn Rhizosphere | MEGDLMKKFLVAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG |
| Ga0209956_10703192 | 3300026127 | Soil | MGGVIMKKILVIVCSAILAIGVAGCAGKAPVGKGKAPVVHTKG |
| Ga0207698_114511111 | 3300026142 | Corn Rhizosphere | VGCLMKKLVVVICSLMLALGLSGCIGKGKAPVGKGKAPVVQTRG |
| Ga0209840_10079234 | 3300026223 | Soil | WGCVMKKCVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0209880_11174071 | 3300026271 | Soil | MKKFVVLLCSLILVLGVAGCAGKGKAPIGKGKAPVV |
| Ga0209881_11024682 | 3300026273 | Soil | VMKKCVVLLCSLVLVLGVAGCAGKGKAPIGKGKAPVVQTKG |
| Ga0256814_10013271 | 3300026464 | Sediment | VKCITKREQEVGWLMKKFLVVLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG |
| Ga0209326_10098892 | 3300026899 | Forest Soil | MKKLLAAICTMGLVLCVAGCAGKAPIIGKGKAPVVQTKG |
| Ga0209113_10087311 | 3300027517 | Forest Soil | MRKLLAAICTMGLVLCVAGCAGKAPIIGKGKAPVVQTKG |
| Ga0209113_10635731 | 3300027517 | Forest Soil | MKKLLALICAAGLVLCVAGCAGKAPIIGKGKAPVVQTKG |
| Ga0208890_10894791 | 3300027523 | Soil | VNYITKREQTVGWLMKKFLVVICSVFLAFGLTGCIGKGKAPVGKGKAPVVQTKG |
| Ga0209073_104494661 | 3300027765 | Agricultural Soil | MKKILLVVCSVALALSVANCAGKGKVPIGKGKAPVVHTRG |
| Ga0209074_100156702 | 3300027787 | Agricultural Soil | MKKFLVVIYSIILAFGVSGCLGKGKSPVGKGKAPVVQTKG |
| Ga0209074_104341521 | 3300027787 | Agricultural Soil | MKKFLVVMCSLFLAFGLSGCIGKGKSPVGKGKAPVVQTKG |
| Ga0209814_101022191 | 3300027873 | Populus Rhizosphere | FLVVLCSAVLAFGLAGCVGKAPVGKGKAPVVQTRG |
| Ga0209068_100016365 | 3300027894 | Watersheds | VGWLMKKFLVVICSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG |
| Ga0209068_101944821 | 3300027894 | Watersheds | MKKFLIVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0209068_101980631 | 3300027894 | Watersheds | IVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0207428_1000032255 | 3300027907 | Populus Rhizosphere | MKKFLVAVCSVVLALGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0207428_108124921 | 3300027907 | Populus Rhizosphere | VQIKGGPMKKFLIALCSIVLAIGVSGCVGKGPIGKGKAPPPVVTRG |
| Ga0209583_100074535 | 3300027910 | Watersheds | MKKFLVVICSVFLAFGLTGCIGKGKSPVGKGKAPVVQTKG |
| Ga0268266_103249722 | 3300028379 | Switchgrass Rhizosphere | MNFQKEGDLMKRFLIAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG |
| Ga0268266_106114992 | 3300028379 | Switchgrass Rhizosphere | MKRFLIVICSMVLAFGLAGCVGKGKTPVGKGKAPVVQTMG |
| Ga0268264_115059752 | 3300028381 | Switchgrass Rhizosphere | MKKVLVTICSVILAFGLTACVGKGPIGKGKAPPPVVTRG |
| Ga0307307_101627851 | 3300028718 | Soil | NLGSVMKKFLVILCSAVLAFGVAGCVGKAPVGKGKAPAPVVTRG |
| Ga0307282_100809651 | 3300028784 | Soil | MKKFLVVVCSMVLAFGLAGCWGKGKAPVGKGKAPVVQT |
| Ga0307323_103822662 | 3300028787 | Soil | MKKFLVAICSIVLAFGLTGCWGKGKAPVGKGKAPVVQTRG |
| Ga0307287_103424382 | 3300028796 | Soil | MRKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0307296_105653682 | 3300028819 | Soil | MKKFLIAICSVDLAFDLSGCWGKGKAPVGKGKAPVVQTRG |
| Ga0307310_103394822 | 3300028824 | Soil | LVVICSMALAFGLTACVGKAPVGKGKAPAPVVTRG |
| Ga0307312_111795051 | 3300028828 | Soil | FLVILCSAVLAFGLAGCVGKAPVGKGKAPAPVVTRG |
| Ga0307308_100253063 | 3300028884 | Soil | MGLNLMKKLLVTICSVILAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0307308_106365521 | 3300028884 | Soil | LLVVICSMALAFGLTACVGKAPVGKGKAPPPVVTRG |
| Ga0307304_101808071 | 3300028885 | Soil | GDDFMKKALIAICSIVLAFGLTGCWGKGKAPVGKGKAPVVQTKG |
| Ga0134606_100982661 | 3300029827 | Marine Sediment | MGGVIMKKILVLVCSTILALGVASCAGKGKVPIGKGKAPVVHTKG |
| Ga0247647_11057651 | 3300030570 | Soil | SVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0299906_104751801 | 3300030606 | Soil | MRKYVALAFAILAALSVASCAGKGKAPIGKGKAPVTAKG |
| Ga0075386_100054055 | 3300030916 | Soil | MRKLLVAACSIVLALGLAGCIGKAPVGKGKAPVVQTRG |
| Ga0075386_120527501 | 3300030916 | Soil | MKKFMIAVCSIVLAIGVTGCVGKAPVGKGKAPVVQTQ |
| Ga0075400_113399681 | 3300030972 | Soil | MKKLVVVICSLMLAFGLSGCIGKGPIGKGKAPAPVVTRG |
| Ga0308193_10122552 | 3300031096 | Soil | LGSVMKKFLVILCSAVLAFGLAGCVGKAPVGKGKAPAPVVTRG |
| Ga0308187_100583522 | 3300031114 | Soil | KFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0170823_123717233 | 3300031128 | Forest Soil | MKKFMIAVCSIVLAIGVTGCVGKAPVGKGKAPVVQTR |
| Ga0307498_100009753 | 3300031170 | Soil | MRKLLVVICSVALAFGLTACVGKAPVGKGKAPPPVVTRG |
| Ga0307497_103822533 | 3300031226 | Soil | LMKKFLVAICSIALAFGLAGCWAGSPVGKGKAPVVYTKG |
| Ga0265325_100464112 | 3300031241 | Rhizosphere | MRKYVMVALAIVAALSVAGCAGKGKAPILGKGKAPVVQTKG |
| Ga0265325_100491264 | 3300031241 | Rhizosphere | MKKILILFCSVVLAIGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0315556_10154706 | 3300031256 | Salt Marsh Sediment | MKKILVLVCSVILALGVASCAGKAPIGKGKAPVVHTKG |
| Ga0307428_100008131 | 3300031280 | Salt Marsh | MGGVIMKKILVLVCSAILALGVAGCAGKGKVPVGKGKAPVVHTKG |
| Ga0307440_10709923 | 3300031367 | Salt Marsh | MKKFLVIVCSLGLALGVVSCAGKGKAPIGKGKAPVVTKG |
| Ga0307429_10143701 | 3300031368 | Salt Marsh | MRKVMLLVITVLTAVSVAGCVGKGKAPIGKGKAPAP |
| Ga0307434_10786923 | 3300031379 | Salt Marsh | MRKVMLLVITVLTAVSVAGCVGKGKAPIGKGKAPAPVVTKG |
| Ga0170820_115010105 | 3300031446 | Forest Soil | MKKLVVVICSLMLALGLSGCVGKGPIGKGKAPAPVVQTRG |
| Ga0170819_110345122 | 3300031469 | Forest Soil | MRKYVMVALAIVAALSVAGCAGKGKAPILGKGKAPVVQTRG |
| Ga0170819_145776541 | 3300031469 | Forest Soil | MRKLLVIVCSMALAFGLTACVGKAPVGKGKAPPPVVTRG |
| Ga0170818_1050138973 | 3300031474 | Forest Soil | MVCRISNGAELMKKLLVTICSVILAFGLTACVGKAPVGKGKAPPPVVTRG |
| Ga0318541_1000134010 | 3300031545 | Soil | MRKLLVVICSMALAFGLTACVGKAPIGKGKAPAPVVTRG |
| Ga0310887_104965582 | 3300031547 | Soil | MRHRFTLNNPKGLSMRKFVLIAVAIISALSVAGCAGKGKSPIGKGKAPVVQTRG |
| Ga0318528_101366951 | 3300031561 | Soil | MKKFLVILCSAVLAFGFAGCVGKGPIGKGKAPPPVVT |
| Ga0310886_101337231 | 3300031562 | Soil | LIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0307436_10035714 | 3300031563 | Salt Marsh | MGGVIMKKILVLVCSAILALGVAGCAGKGKVPMGKGKAPVVHTKG |
| Ga0315534_11901971 | 3300031585 | Salt Marsh Sediment | MKTFLVIICSAILALGVAGCAGKGKVPIGKGKAPAPVVTKG |
| Ga0315550_10328072 | 3300031653 | Salt Marsh Sediment | MKKILVLVCSAILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0316579_100248912 | 3300031691 | Rhizosphere | MGGVIMKKILILFCSAILALGVAGCAGKGKVPVGKGKAPVVHTKG |
| Ga0310813_101061003 | 3300031716 | Soil | MGTRMRKFVLLAVAALAALSVAGCAGKGKAPILGKGKAPVVQTKG |
| Ga0306917_102662441 | 3300031719 | Soil | MKKLLVAICSVVLAFGLSGCIGKAPVGKGKAPVVQT |
| Ga0306918_114824662 | 3300031744 | Soil | LSICWVDEGKTFVIAICSVVLAFSVAGCVGKAPIGKGKAP |
| Ga0307473_105291422 | 3300031820 | Hardwood Forest Soil | MKKFLFAVCSIVLAIGVSGCVGKAPVGKGKAPAPVV |
| Ga0307473_111607061 | 3300031820 | Hardwood Forest Soil | MKKFLVVLYSLILAFGVSGCVGKGKAPVGKGKAPVVQTKG |
| Ga0310907_104932352 | 3300031847 | Soil | MKKVLVTICSVILAFGLTACVGKGPVGKGKAPPPVVTRG |
| Ga0310904_100301901 | 3300031854 | Soil | MKKFLIVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG |
| Ga0318544_102921731 | 3300031880 | Soil | MKKFLIAVCSIVLAIGVSGCVGKAPFLGKGKAPPPVVT |
| Ga0306925_115318661 | 3300031890 | Soil | MKKFLVVICSAVLAFGLAGCVGKAPILGKGKAPVVQTR |
| Ga0310900_103184182 | 3300031908 | Soil | MRKFVLIAVAIISALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0306923_116545041 | 3300031910 | Soil | MKKFLVVMCSVVLALGLAGCLGKGKAPVGKGKAPVVQTRG |
| Ga0310901_101687542 | 3300031940 | Soil | MRHRFTLNNPKGLSMRKFVLIAVAIISALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0310884_103724341 | 3300031944 | Soil | IADGDLMRKVLVAVFSVILALGLSGCWGKGKAPVGKGKAPVVQTRG |
| Ga0310913_100180542 | 3300031945 | Soil | MKNFIVVICSVVLAFGLAGCWGKAPVGKGKAPVVQTRG |
| Ga0310903_106791082 | 3300032000 | Soil | MKKFVVVVCSVVLAFGLAGCWGKAPVGKGKAPVVQ |
| Ga0307411_106903011 | 3300032005 | Rhizosphere | LNNYQMGLSMRKFVLIAVAIVSALSVAGCAGKGKAPIGKGKAPVVQTRG |
| Ga0310902_101830743 | 3300032012 | Soil | TGDLMRKVLVAVFSVILALGLSGCWGKGKAPVGKGKAPVVQTRG |
| Ga0315540_101779931 | 3300032061 | Salt Marsh Sediment | VTIMQKAFMLAIAIVAALSVAGCAGKGKTPVGKGKTPAVVTKG |
| Ga0315540_102509902 | 3300032061 | Salt Marsh Sediment | MGGVIMKKILVLVCSAILALGVAGCAGKGKVPLGKGKAPVVHTKG |
| Ga0310895_100272854 | 3300032122 | Soil | MKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVT |
| Ga0307470_105221492 | 3300032174 | Hardwood Forest Soil | MRKLLLAMCSVILAFGLAGCIGKGKAPVGKGKAPVVQT |
| Ga0307470_117055862 | 3300032174 | Hardwood Forest Soil | MKKLVVVFCSLVLALGLSGCIGKGKAPVGKGKAPVVQTRG |
| Ga0307471_1002677651 | 3300032180 | Hardwood Forest Soil | LMKKLVVVFCSLVLALGLSGCIGKGKAPVGKGKAPVVQTKG |
| Ga0307472_1007159961 | 3300032205 | Hardwood Forest Soil | GGLLMKKFLVVLYSLILAFGVSGCVGKGKAPVGKGKAPVVQTKG |
| Ga0307472_1008525122 | 3300032205 | Hardwood Forest Soil | MRKLLVAICSVVLVFGLAGCVGKGKAPVGKGKAPVVQTKG |
| Ga0335085_110305611 | 3300032770 | Soil | MKKFLVIVCSLLLALGVASCAGKGKAPIGKGKAPVVTKG |
| Ga0335085_115516701 | 3300032770 | Soil | MGGVIMKKILVIVCSAILALGVAGCAGKAPMGKGKAPVV |
| Ga0335079_103730062 | 3300032783 | Soil | MKKILIVFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0335079_110971851 | 3300032783 | Soil | ILFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0335078_105664561 | 3300032805 | Soil | MKKILILFCSVVLALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0335078_121821052 | 3300032805 | Soil | MKKFLVVLCSVFLAFGLTGCGKGKAPVVGKGKAPVV |
| Ga0335080_101830002 | 3300032828 | Soil | MKKILILFCSVILAMGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0335080_111525532 | 3300032828 | Soil | VTMKKILIVFCSVILALGVAGCAGKGKVPIGKGKAPVVHTKG |
| Ga0335080_113876402 | 3300032828 | Soil | MRKLLVAMCSVILAFGLAGCIGKGKAPVGKGKAPVVQTR |
| Ga0335081_100127773 | 3300032892 | Soil | MKKILILFCSAILALSVANCAGKGKVPIGKGKAPVVHTKG |
| Ga0335077_112546882 | 3300033158 | Soil | LMKKFFVLICSVVLVFGLTGCGKGKAPVGKGKAPVVQTKG |
| Ga0326726_107981312 | 3300033433 | Peat Soil | MKKFLVVICSVVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0326726_113074672 | 3300033433 | Peat Soil | MRKFLVVICSMVLAFGLAGCVGKGKAPVGKGKAPVVQTKG |
| Ga0310811_100273519 | 3300033475 | Soil | MKTFLALVCTVVLGLCVTGCAGKAPIIGKGKAPVVQTKG |
| Ga0310811_101283171 | 3300033475 | Soil | MKKFLAVICTVLLGLCVAGCAGKAPIVGKGKAPVVQTKG |
| Ga0310811_110007642 | 3300033475 | Soil | MLIAGGCGMNKFLAMVCTVLLGLCVAGCAGKAPIVGKGKAPVVQTKG |
| Ga0316624_100497792 | 3300033486 | Soil | MKKFLVIVCSMLLALGVASCAGKGKAPIGKGKAPVVTKG |
| Ga0326723_0025026_1398_1520 | 3300034090 | Peat Soil | MKKFLVVICSMVLAFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0326723_0041306_420_542 | 3300034090 | Peat Soil | MKKFVVVICSMVLAFGLAGCVGKGKAPVGKGKAPVVQTKG |
| Ga0326723_0075636_417_545 | 3300034090 | Peat Soil | MKKFLVVLCSVFLAFSLTACVGKGKAPVGKGKAPAPVVQTKG |
| Ga0326723_0256262_294_416 | 3300034090 | Peat Soil | MRKLLVAMCSLILVFGLAGCIGKGKAPVGKGKAPVVQTKG |
| Ga0326723_0275622_481_603 | 3300034090 | Peat Soil | MKKFLVLLCSVFLAFGLTACVGKGKAPVGKGKAPVVQTKG |
| Ga0370501_0133999_518_646 | 3300034195 | Untreated Peat Soil | MKKIMVVFCTLVLAIGVAGCAGKGKAPIGKGKGKAPVVTTKG |
| Ga0314789_006256_769_900 | 3300034480 | Soil | LGSVMKKFLIVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG |
| Ga0314780_226097_2_136 | 3300034659 | Soil | NLGSVMKKFLIVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG |
| Ga0314784_091821_461_583 | 3300034663 | Soil | MRKFVLIAVAIISALSVAGCAGKGKSPIGKGKAPVVQTRG |
| Ga0314784_170861_375_503 | 3300034663 | Soil | SVMKKFLIVLCSAVLAFGFAGCVGKGPIGKGKAPPPPVVTRG |
| Ga0314786_106887_475_609 | 3300034664 | Soil | LGSVMKKFLVVLCSAVLAFGLAGCWGKGKAPVGKGKAPVVQTRG |
| Ga0314787_108228_395_523 | 3300034665 | Soil | GSVMKKFLIVLCSAVLAFGFAGCVGKAPVGKGKAPAPVVTRG |
| Ga0314788_037146_1_129 | 3300034666 | Soil | AEHMKKVLVTICSVILAFGLTACVGKGPIGKGKAPPPVVTRG |
| Ga0314794_054470_627_761 | 3300034669 | Soil | NGAEHMKKVLVTICSVILAFGLTACVGKGPIGKGKAPPPVVTRG |
| Ga0314803_100612_442_567 | 3300034678 | Soil | EHMKKVLVTICSVILAFGLTACVGKGPVGKGKAPPPVVTRG |
| Ga0373948_0128443_76_198 | 3300034817 | Rhizosphere Soil | MKRFLVVICSMVLAFGLAGCVGKGKAPVGKGKAPVVQTRG |
| ⦗Top⦘ |