NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000135

3300000135: Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 03_9.5m



Overview

Basic Information
IMG/M Taxon OID3300000135 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063447 | Gp0053469 | Ga0026117
Sample NameMarine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 03_9.5m
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size107809070
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → intertidal zone → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationS1 site, Potter Cove, King George Island, Antarctic Peninsula
CoordinatesLat. (o)-62.230512Long. (o)-58.656117Alt. (m)N/ADepth (m)9.5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000075Metagenome / Metatranscriptome2622Y
F000088Metagenome / Metatranscriptome2436Y
F000948Metagenome / Metatranscriptome823Y
F020013Metagenome / Metatranscriptome226Y
F036294Metagenome / Metatranscriptome170Y
F050639Metagenome / Metatranscriptome145Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
KGI_S1_ANT03_95mDRAFT_c1011527All Organisms → cellular organisms → Bacteria1154Open in IMG/M
KGI_S1_ANT03_95mDRAFT_c1015329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum979Open in IMG/M
KGI_S1_ANT03_95mDRAFT_c1031646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
KGI_S1_ANT03_95mDRAFT_c1037431Not Available585Open in IMG/M
KGI_S1_ANT03_95mDRAFT_c1037997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
KGI_S1_ANT03_95mDRAFT_c1011527KGI_S1_ANT03_95mDRAFT_10115271F050639MLRWMWRELETGLRNTLNGHEEGNLGYSQGYSLRVTAPVLDPTGE
KGI_S1_ANT03_95mDRAFT_c1015329KGI_S1_ANT03_95mDRAFT_10153291F000088MKYTGIIAIAALVTGSSAVELRQRSSFAPPALGPYASDTDHLSNECYGADDDDIIYDVFDRYRVEERNPVGAGTGIWKLPKASGPQWASDVIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFLRALLGPNNRYRLAPGALSDMDSASLHVQNEFSAGPDGRPYAHRYELKDQDYPDGRHNLQ*
KGI_S1_ANT03_95mDRAFT_c1015397KGI_S1_ANT03_95mDRAFT_10153971F000075IKLFKMKFVALTAFVAAAAANQYDFMGEDELLSQLSSTLVSAQRSEAMGDGDAAVAKTAAIKNIQKSLTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*
KGI_S1_ANT03_95mDRAFT_c1031646KGI_S1_ANT03_95mDRAFT_10316461F000948SQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRXPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
KGI_S1_ANT03_95mDRAFT_c1037431KGI_S1_ANT03_95mDRAFT_10374312F036294MDRGSTDEAVVGVKPIADEGVVTHLRIKLLESDKDVGAEGRNM*
KGI_S1_ANT03_95mDRAFT_c1037997KGI_S1_ANT03_95mDRAFT_10379971F020013REYSQHTLLRAFKVVNYFWMQIFHVYGTARPIGSKFFTAYGNGPLNYSALFCYFWCTAMVLARCRFENQRDAYTFNDQDGANFWFDKYNMMFPPSFLHNRLSAHYIEINNIFFCEMLKKYIVARKELLVERDTCSMEEHRTKYISNPNYIYEPFRNDTVVIKRLRQDGQF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.