NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000948

Metagenome / Metatranscriptome Family F000948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000948
Family Type Metagenome / Metatranscriptome
Number of Sequences 823
Average Sequence Length 114 residues
Representative Sequence HSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Number of Associated Samples 501
Number of Associated Scaffolds 823

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 15.65 %
% of genes near scaffold ends (potentially truncated) 59.54 %
% of genes from short scaffolds (< 2000 bps) 97.81 %
Associated GOLD sequencing projects 448
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.691 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.984 % of family members)
Environment Ontology (ENVO) Unclassified
(62.697 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.830 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.41%    β-sheet: 28.15%    Coil/Unstructured: 64.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 823 Family Scaffolds
PF00992Troponin 0.12
PF00115COX1 0.12
PF00227Proteasome 0.12
PF00168C2 0.12

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 823 Family Scaffolds
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.12
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.12
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.12


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.69 %
UnclassifiedrootN/A2.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876011|none_p141005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300000117|DelMOWin2010_c10178232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300000120|SA_S2_NOR13_50mDRAFT_c1019077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1037Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10176548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10064326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium895Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10091279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium975Open in IMG/M
3300000135|KGI_S1_ANT03_95mDRAFT_c1031646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10077678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium911Open in IMG/M
3300000243|SA_S2_NOR18_50mDRAFT_1042118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300000949|BBAY94_10077878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium913Open in IMG/M
3300001352|JGI20157J14317_10209229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300001354|JGI20155J14468_10198334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300001355|JGI20158J14315_10111488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium912Open in IMG/M
3300001355|JGI20158J14315_10114279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium893Open in IMG/M
3300001355|JGI20158J14315_10134528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300001824|ACM36_111272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300002153|JGI24540J26637_10211867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300002692|Ga0005226J37279_1032567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300002835|B570J40625_101744262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300003409|JGI26088J50261_1050792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300003427|JGI26084J50262_1121414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300003621|JGI26083J51738_10094738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300003621|JGI26083J51738_10100361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300003733|Ga0008273_1005485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300003787|Ga0007811_1022260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300003860|Ga0031658_1102817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300004642|Ga0066612_1308498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300004762|Ga0007749_1172886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300004764|Ga0007754_1394170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300004765|Ga0007745_1395761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300004767|Ga0007750_1011031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300004769|Ga0007748_10105887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300004789|Ga0007752_11134387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300004789|Ga0007752_11219029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300004793|Ga0007760_10018355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300004794|Ga0007751_11390447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300004806|Ga0007854_10283430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300004810|Ga0007757_10006083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300004810|Ga0007757_11441959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300005043|Ga0071100_1044843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1091Open in IMG/M
3300005043|Ga0071100_1115619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300005433|Ga0066830_10106272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300005516|Ga0066831_10096771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300005516|Ga0066831_10106342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium760Open in IMG/M
3300005516|Ga0066831_10128952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300005516|Ga0066831_10162529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300005838|Ga0008649_10224914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300005942|Ga0070742_10131266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300006355|Ga0075501_1223392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300006355|Ga0075501_1286541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300006382|Ga0075494_1006154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300006382|Ga0075494_1412410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300006383|Ga0075504_1373025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300006394|Ga0075492_1542986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300006397|Ga0075488_1575901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300006399|Ga0075495_1579273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300006400|Ga0075503_1548892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300006400|Ga0075503_1566899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300006403|Ga0075514_1759779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300006404|Ga0075515_10812802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300006415|Ga0099654_10162652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300006419|Ga0075496_1495055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300006419|Ga0075496_1496559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300006424|Ga0075497_1017085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300006571|Ga0075505_1496344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300006728|Ga0031676_1415418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300006803|Ga0075467_10275000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300006920|Ga0070748_1330635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300007231|Ga0075469_10191243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300007236|Ga0075463_10139443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium783Open in IMG/M
3300007236|Ga0075463_10264568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300007513|Ga0105019_1136698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1288Open in IMG/M
3300007513|Ga0105019_1222172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300007513|Ga0105019_1257771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium784Open in IMG/M
3300007516|Ga0105050_10372112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium860Open in IMG/M
3300007516|Ga0105050_10421640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium797Open in IMG/M
3300007551|Ga0102881_1101551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium797Open in IMG/M
3300007552|Ga0102818_1048281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium840Open in IMG/M
3300007558|Ga0102822_1128003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300007625|Ga0102870_1227077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300007655|Ga0102825_1119100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300007681|Ga0102824_1119859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300007716|Ga0102867_1158561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300007718|Ga0102852_1094826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300007862|Ga0105737_1115477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300007954|Ga0105739_1093797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300007972|Ga0105745_1133644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300007972|Ga0105745_1178541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300007981|Ga0102904_1055111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300007992|Ga0105748_10548527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300008108|Ga0114341_10313390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium809Open in IMG/M
3300008110|Ga0114343_1200888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300008261|Ga0114336_1230904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300008263|Ga0114349_1254179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300008264|Ga0114353_1301897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300008264|Ga0114353_1362081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300008832|Ga0103951_10558822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300008832|Ga0103951_10580136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300008832|Ga0103951_10603132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300008832|Ga0103951_10690209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300008832|Ga0103951_10785984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300008834|Ga0103882_10060870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300008834|Ga0103882_10097030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300008835|Ga0103883_1064774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300008929|Ga0103732_1042832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300008932|Ga0103735_1071158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300008934|Ga0103737_1040780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300008935|Ga0103738_1043373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300008935|Ga0103738_1056319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300008938|Ga0103741_1103459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300008952|Ga0115651_1373821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium809Open in IMG/M
3300008952|Ga0115651_1382762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300008993|Ga0104258_1067349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300008993|Ga0104258_1079239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300008993|Ga0104258_1101588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300008996|Ga0102831_1333280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300009003|Ga0102813_1210552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300009024|Ga0102811_1267073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300009025|Ga0103707_10166366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300009028|Ga0103708_100103646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300009054|Ga0102826_1062051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium903Open in IMG/M
3300009059|Ga0102830_1117710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium784Open in IMG/M
3300009079|Ga0102814_10581721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300009151|Ga0114962_10258536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium989Open in IMG/M
3300009154|Ga0114963_10450343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300009155|Ga0114968_10274153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium951Open in IMG/M
3300009172|Ga0114995_10314614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300009172|Ga0114995_10455299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300009172|Ga0114995_10569770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300009180|Ga0114979_10340612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300009195|Ga0103743_1065436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300009263|Ga0103872_1002702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1249Open in IMG/M
3300009263|Ga0103872_1025506All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi755Open in IMG/M
3300009263|Ga0103872_1064741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300009263|Ga0103872_1077122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300009268|Ga0103874_1030483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300009268|Ga0103874_1030677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300009269|Ga0103876_1000667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1672Open in IMG/M
3300009274|Ga0103878_1039772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300009422|Ga0114998_10295634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300009422|Ga0114998_10623264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300009432|Ga0115005_10641984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium851Open in IMG/M
3300009434|Ga0115562_1334534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300009436|Ga0115008_10424782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium944Open in IMG/M
3300009436|Ga0115008_10800518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300009436|Ga0115008_10833009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300009441|Ga0115007_10346006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium968Open in IMG/M
3300009441|Ga0115007_10427064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium869Open in IMG/M
3300009441|Ga0115007_10792162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300009441|Ga0115007_11317700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300009443|Ga0115557_1205362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium770Open in IMG/M
3300009472|Ga0115554_1259101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300009496|Ga0115570_10377572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300009497|Ga0115569_10378782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300009497|Ga0115569_10507546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300009507|Ga0115572_10773519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300009538|Ga0129287_10193854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium878Open in IMG/M
3300009543|Ga0115099_10030559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300009543|Ga0115099_10183681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300009543|Ga0115099_10519280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300009543|Ga0115099_10890750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300009544|Ga0115006_11806359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300009550|Ga0115013_10605338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300009550|Ga0115013_11483286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300009592|Ga0115101_1114322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium933Open in IMG/M
3300009592|Ga0115101_1124070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300009593|Ga0115011_11420283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300009599|Ga0115103_1328786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300009599|Ga0115103_1515620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300009599|Ga0115103_1767865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300009599|Ga0115103_1840222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300009599|Ga0115103_1840454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300009608|Ga0115100_10151607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300009608|Ga0115100_11126518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300009677|Ga0115104_10828685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300009677|Ga0115104_10829202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300009677|Ga0115104_10927210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300009677|Ga0115104_11236050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300009679|Ga0115105_10172141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300009679|Ga0115105_10289823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300009679|Ga0115105_10529718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300009679|Ga0115105_10712817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300009679|Ga0115105_11183238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300009679|Ga0115105_11201001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300009679|Ga0115105_11236700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300009679|Ga0115105_11237340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300009679|Ga0115105_11336509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300009679|Ga0115105_11358623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300009732|Ga0123373_173627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300009738|Ga0123379_1093609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300009741|Ga0123361_1060595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300009785|Ga0115001_10402973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium854Open in IMG/M
3300009785|Ga0115001_10494231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium756Open in IMG/M
3300009790|Ga0115012_11346531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300009790|Ga0115012_11532790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300009845|Ga0132158_116360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300010135|Ga0123382_1151952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300010297|Ga0129345_1251609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300010299|Ga0129342_1316038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300010404|Ga0129323_1104545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300010981|Ga0138316_10927151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300010981|Ga0138316_11012103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300010981|Ga0138316_11350015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300010981|Ga0138316_11366028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300010981|Ga0138316_11388602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300010987|Ga0138324_10320225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300010987|Ga0138324_10577923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300010987|Ga0138324_10584599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300011268|Ga0151620_1220763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300012408|Ga0138265_1057853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300012408|Ga0138265_1425430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300012412|Ga0138266_1531487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300012413|Ga0138258_1337006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300012414|Ga0138264_1591056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300012414|Ga0138264_1661840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300012414|Ga0138264_1813494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300012415|Ga0138263_1037371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300012417|Ga0138262_1626965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300012470|Ga0129329_1047202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300012471|Ga0129334_1060074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300012518|Ga0129349_1278247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300012518|Ga0129349_1298771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300012524|Ga0129331_1168086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300012524|Ga0129331_1407333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300012525|Ga0129353_1299925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300012722|Ga0157630_1026218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300012724|Ga0157611_1059256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300012756|Ga0138272_1124623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300012767|Ga0138267_1148422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300012781|Ga0138286_1362333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300012782|Ga0138268_1120372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300012782|Ga0138268_1345115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300012782|Ga0138268_1741108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300012920|Ga0160423_10879669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300012920|Ga0160423_11157684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300012928|Ga0163110_11533800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300012928|Ga0163110_11680158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300012953|Ga0163179_11246090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300012953|Ga0163179_11574088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300012953|Ga0163179_11899649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300012953|Ga0163179_12189658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300012953|Ga0163179_12192907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300012953|Ga0163179_12225784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300012954|Ga0163111_12001519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300012954|Ga0163111_12719474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300012967|Ga0129343_1159143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300012967|Ga0129343_1274640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300012969|Ga0129332_1187585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300013076|Ga0157551_1151418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300016723|Ga0182085_1116960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300016734|Ga0182092_1074223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300016735|Ga0182074_1038679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300016741|Ga0182079_1507851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300016741|Ga0182079_1650639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300016754|Ga0182072_1489725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300016766|Ga0182091_1541347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300017710|Ga0181403_1062079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300017710|Ga0181403_1064054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300017719|Ga0181390_1090697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium830Open in IMG/M
3300017720|Ga0181383_1076795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium897Open in IMG/M
3300017724|Ga0181388_1101216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300017740|Ga0181418_1053630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1001Open in IMG/M
3300017745|Ga0181427_1151538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300017746|Ga0181389_1119620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300017751|Ga0187219_1109357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium831Open in IMG/M
3300017756|Ga0181382_1145657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300017763|Ga0181410_1166070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300017763|Ga0181410_1215359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300017768|Ga0187220_1078909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium993Open in IMG/M
3300017769|Ga0187221_1153575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300017779|Ga0181395_1211327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300017782|Ga0181380_1264494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300017788|Ga0169931_10517015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium836Open in IMG/M
3300017949|Ga0181584_10808145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300017952|Ga0181583_10618799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300017952|Ga0181583_10645011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300017952|Ga0181583_10670947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300017958|Ga0181582_10737768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300017958|Ga0181582_10872695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300017962|Ga0181581_10649593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300017962|Ga0181581_10675376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300017964|Ga0181589_10822499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300017986|Ga0181569_10834975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300017986|Ga0181569_10974847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300018041|Ga0181601_10299051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium893Open in IMG/M
3300018049|Ga0181572_10587218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300018420|Ga0181563_10632169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300018421|Ga0181592_10624591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300018423|Ga0181593_10953573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018424|Ga0181591_10921906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018424|Ga0181591_11119198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018428|Ga0181568_10581165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300018515|Ga0192960_104116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300018532|Ga0193008_103165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018614|Ga0188846_1036517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300018617|Ga0193133_1027001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300018622|Ga0188862_1025517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300018622|Ga0188862_1031068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018625|Ga0192842_1032652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300018628|Ga0193355_1013654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300018628|Ga0193355_1015504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018628|Ga0193355_1015739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018628|Ga0193355_1021415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018628|Ga0193355_1022078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300018628|Ga0193355_1023335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300018628|Ga0193355_1029996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300018644|Ga0193352_1042253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018646|Ga0192895_1023648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018647|Ga0192913_1037622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018649|Ga0192969_1035984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300018658|Ga0192906_1039353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300018666|Ga0193159_1053234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018674|Ga0193166_1023412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300018681|Ga0193206_1026491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300018692|Ga0192944_1031326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300018692|Ga0192944_1034619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300018692|Ga0192944_1037360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018692|Ga0192944_1041541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018692|Ga0192944_1052867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018692|Ga0192944_1055827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300018701|Ga0193405_1042577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018724|Ga0193391_1030022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300018725|Ga0193517_1048939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300018725|Ga0193517_1052600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018725|Ga0193517_1061312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300018725|Ga0193517_1067754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300018725|Ga0193517_1076105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018730|Ga0192967_1051124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300018730|Ga0192967_1065889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018730|Ga0192967_1068077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300018730|Ga0192967_1069934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018733|Ga0193036_1076646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300018745|Ga0193000_1060521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300018745|Ga0193000_1069337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300018747|Ga0193147_1080319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300018763|Ga0192827_1051940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300018763|Ga0192827_1062592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300018765|Ga0193031_1042501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300018765|Ga0193031_1045045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300018765|Ga0193031_1046855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018765|Ga0193031_1061106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300018765|Ga0193031_1065680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300018765|Ga0193031_1084607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018779|Ga0193149_1063154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300018787|Ga0193124_1049659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300018787|Ga0193124_1057897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018787|Ga0193124_1068231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018791|Ga0192950_1071800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018800|Ga0193306_1074147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300018811|Ga0193183_1036240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium850Open in IMG/M
3300018823|Ga0193053_1060706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018823|Ga0193053_1070037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018831|Ga0192949_1076314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018832|Ga0194240_1016243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018832|Ga0194240_1035959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018836|Ga0192870_1084643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018842|Ga0193219_1067813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300018842|Ga0193219_1076366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300018844|Ga0193312_1051458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018855|Ga0193475_1046402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300018855|Ga0193475_1060082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018862|Ga0193308_1071630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300018871|Ga0192978_1036074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium929Open in IMG/M
3300018871|Ga0192978_1084694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018871|Ga0192978_1086703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300018874|Ga0192977_1056140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium800Open in IMG/M
3300018874|Ga0192977_1103810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300018880|Ga0193337_1052362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300018899|Ga0193090_1138989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300018903|Ga0193244_1101960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018913|Ga0192868_10032513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium750Open in IMG/M
3300018913|Ga0192868_10067437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300018926|Ga0192989_10062840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium954Open in IMG/M
3300018928|Ga0193260_10126037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300018948|Ga0192985_1236508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018967|Ga0193178_10040249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018967|Ga0193178_10074026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300018968|Ga0192894_10285056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300018968|Ga0192894_10319490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018974|Ga0192873_10345029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300018974|Ga0192873_10379391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018975|Ga0193006_10204570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018975|Ga0193006_10231015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300018977|Ga0193353_10193487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300018977|Ga0193353_10216218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300018977|Ga0193353_10217983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018980|Ga0192961_10175836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300018980|Ga0192961_10177197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300018980|Ga0192961_10187265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300018982|Ga0192947_10156699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300018982|Ga0192947_10179458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018982|Ga0192947_10192728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300018982|Ga0192947_10202784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018982|Ga0192947_10236275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018982|Ga0192947_10244358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018982|Ga0192947_10297761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018983|Ga0193017_10239218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018983|Ga0193017_10244743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300018983|Ga0193017_10269039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300018988|Ga0193275_10261851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300018989|Ga0193030_10138858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300018989|Ga0193030_10175797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018989|Ga0193030_10176290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018989|Ga0193030_10176877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018989|Ga0193030_10187535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018989|Ga0193030_10200147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300018989|Ga0193030_10202446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300018989|Ga0193030_10205539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300018989|Ga0193030_10216617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018989|Ga0193030_10217750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018989|Ga0193030_10250732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300018989|Ga0193030_10284085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300018989|Ga0193030_10287328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300018989|Ga0193030_10315162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300019001|Ga0193034_10099866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300019001|Ga0193034_10158928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019001|Ga0193034_10168817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019003|Ga0193033_10169676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300019009|Ga0192880_10161776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019010|Ga0193044_10227265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300019010|Ga0193044_10276062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300019017|Ga0193569_10416479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300019021|Ga0192982_10195832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300019021|Ga0192982_10199742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300019021|Ga0192982_10271096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300019021|Ga0192982_10288555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300019021|Ga0192982_10300567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300019021|Ga0192982_10375275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300019022|Ga0192951_10366697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300019025|Ga0193545_10073634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300019025|Ga0193545_10108073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300019027|Ga0192909_10106997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300019027|Ga0192909_10222987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300019027|Ga0192909_10234098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019027|Ga0192909_10303765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300019031|Ga0193516_10164912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300019031|Ga0193516_10164916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300019031|Ga0193516_10169805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300019031|Ga0193516_10176773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300019031|Ga0193516_10197390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300019031|Ga0193516_10239172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300019031|Ga0193516_10245089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019031|Ga0193516_10268893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300019031|Ga0193516_10285922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019031|Ga0193516_10294508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300019032|Ga0192869_10139474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium987Open in IMG/M
3300019032|Ga0192869_10225142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium805Open in IMG/M
3300019032|Ga0192869_10234607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium790Open in IMG/M
3300019032|Ga0192869_10260313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300019032|Ga0192869_10422619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019032|Ga0192869_10423706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300019032|Ga0192869_10448319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300019032|Ga0192869_10458816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300019032|Ga0192869_10462611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300019033|Ga0193037_10244696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300019033|Ga0193037_10264511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300019033|Ga0193037_10335015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019033|Ga0193037_10347828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019036|Ga0192945_10137991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium782Open in IMG/M
3300019036|Ga0192945_10177601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300019036|Ga0192945_10184314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300019036|Ga0192945_10234937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300019039|Ga0193123_10369861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300019040|Ga0192857_10365659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300019043|Ga0192998_10153114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300019045|Ga0193336_10383881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300019045|Ga0193336_10389884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300019045|Ga0193336_10402365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019045|Ga0193336_10443282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300019045|Ga0193336_10477746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300019045|Ga0193336_10504697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300019045|Ga0193336_10578101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300019045|Ga0193336_10604775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019045|Ga0193336_10630748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019045|Ga0193336_10631067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019048|Ga0192981_10261937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300019048|Ga0192981_10303671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300019048|Ga0192981_10305479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300019048|Ga0192981_10331097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300019050|Ga0192966_10224527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300019050|Ga0192966_10338906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300019051|Ga0192826_10267560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300019051|Ga0192826_10276205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300019051|Ga0192826_10309554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300019051|Ga0192826_10328429Not Available556Open in IMG/M
3300019054|Ga0192992_10341980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300019095|Ga0188866_1020239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300019097|Ga0193153_1026267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300019097|Ga0193153_1027041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300019097|Ga0193153_1031350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300019097|Ga0193153_1032525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019100|Ga0193045_1045432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300019102|Ga0194243_1005600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300019116|Ga0193243_1048702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300019118|Ga0193157_1016797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300019118|Ga0193157_1018315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300019118|Ga0193157_1024479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300019118|Ga0193157_1024617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300019118|Ga0193157_1027059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300019118|Ga0193157_1029731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300019118|Ga0193157_1031707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300019118|Ga0193157_1033186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019120|Ga0193256_1080769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019123|Ga0192980_1073965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300019123|Ga0192980_1074512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300019123|Ga0192980_1075092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019125|Ga0193104_1041292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019129|Ga0193436_1075457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300019133|Ga0193089_1114306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019133|Ga0193089_1118239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019133|Ga0193089_1137933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300019139|Ga0193047_1119939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019149|Ga0188870_10114169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300019149|Ga0188870_10127007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300019150|Ga0194244_10107665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300019153|Ga0192975_10274808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300019214|Ga0180037_1263068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300019253|Ga0182064_1338917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019261|Ga0182097_1509665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019277|Ga0182081_1495516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300019283|Ga0182058_1292881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300019283|Ga0182058_1509864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300020014|Ga0182044_1414474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300020048|Ga0207193_1539338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300020083|Ga0194111_10307495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1088Open in IMG/M
3300020172|Ga0211729_10509327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium812Open in IMG/M
3300020175|Ga0206124_10169581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium872Open in IMG/M
3300020187|Ga0206130_10436263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300020205|Ga0211731_10346875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300020382|Ga0211686_10420235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300020436|Ga0211708_10333591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300020513|Ga0208090_1053989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300020566|Ga0208222_1051459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300020595|Ga0206126_10351495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300020732|Ga0214201_1050451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300021133|Ga0214175_1015997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300021169|Ga0206687_1053870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021169|Ga0206687_1245972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300021185|Ga0206682_10291833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300021303|Ga0210308_1070613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300021334|Ga0206696_1670370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300021342|Ga0206691_1021468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300021342|Ga0206691_1163894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300021342|Ga0206691_1305480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300021342|Ga0206691_1426083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300021342|Ga0206691_1521415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300021342|Ga0206691_1603820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300021345|Ga0206688_10419769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021345|Ga0206688_10607064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021345|Ga0206688_10697039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300021345|Ga0206688_10708549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021348|Ga0206695_1403253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300021350|Ga0206692_1013459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300021350|Ga0206692_1186283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021350|Ga0206692_1346377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300021350|Ga0206692_1791336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300021350|Ga0206692_1907972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300021353|Ga0206693_1028603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300021353|Ga0206693_1435493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300021353|Ga0206693_1464470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300021355|Ga0206690_10018020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300021355|Ga0206690_10274279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1092Open in IMG/M
3300021355|Ga0206690_10947164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300021359|Ga0206689_10008481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300021359|Ga0206689_10222184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300021359|Ga0206689_10339768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300021359|Ga0206689_10668667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300021359|Ga0206689_10739520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300021359|Ga0206689_10870730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300021359|Ga0206689_11184979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300021371|Ga0213863_10319275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300021371|Ga0213863_10320302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021373|Ga0213865_10470316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300021375|Ga0213869_10254198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium767Open in IMG/M
3300021378|Ga0213861_10426760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300021869|Ga0063107_114166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300021872|Ga0063132_105650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300021872|Ga0063132_134569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300021874|Ga0063147_122237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021876|Ga0063124_102566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300021887|Ga0063105_1003529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300021889|Ga0063089_1006649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300021896|Ga0063136_1004312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300021898|Ga0063097_1116799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300021899|Ga0063144_1010591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300021899|Ga0063144_1075532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300021902|Ga0063086_1021614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021905|Ga0063088_1006243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300021905|Ga0063088_1010485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300021911|Ga0063106_1012897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021911|Ga0063106_1038111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021912|Ga0063133_1050165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021921|Ga0063870_1011935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300021922|Ga0063869_1016127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300021925|Ga0063096_1000898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300021927|Ga0063103_1102241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300021933|Ga0063756_1049206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300021934|Ga0063139_1024772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300021934|Ga0063139_1143930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300021940|Ga0063108_1063140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300021941|Ga0063102_1004099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300021941|Ga0063102_1009159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300021942|Ga0063098_1000829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300021954|Ga0063755_1016179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300021957|Ga0222717_10567548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300021958|Ga0222718_10261842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium913Open in IMG/M
3300022367|Ga0210312_119288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300022369|Ga0210310_1030012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300022827|Ga0222647_1035328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300022926|Ga0255753_1247113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300022934|Ga0255781_10423759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300022937|Ga0255770_10459316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300023115|Ga0255760_10493698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300023116|Ga0255751_10422520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300023174|Ga0214921_10500586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300023175|Ga0255777_10508805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300023178|Ga0255759_10631284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300023555|Ga0232120_107552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300023565|Ga0228688_122273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300023695|Ga0228680_1033388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
(restricted) 3300024252|Ga0233435_1172135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300024297|Ga0228658_1068314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300024343|Ga0244777_10405538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300024343|Ga0244777_10833941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300024346|Ga0244775_10589109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium903Open in IMG/M
3300024346|Ga0244775_11464601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300025138|Ga0209634_1255068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300025455|Ga0208376_1072314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300025570|Ga0208660_1060975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300025570|Ga0208660_1116334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300025608|Ga0209654_1102916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300025620|Ga0209405_1112217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300025620|Ga0209405_1143917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300025626|Ga0209716_1094687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300025636|Ga0209136_1162464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300025645|Ga0208643_1153999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300025695|Ga0209653_1164190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300025732|Ga0208784_1104433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300025810|Ga0208543_1095835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300025838|Ga0208872_1189645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300025849|Ga0209603_1347185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300025872|Ga0208783_10400193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300025879|Ga0209555_10162925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium920Open in IMG/M
3300025880|Ga0209534_10362954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300025880|Ga0209534_10454420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300025890|Ga0209631_10511146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300026136|Ga0208763_1044789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300026182|Ga0208275_1031641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1095Open in IMG/M
3300026182|Ga0208275_1054042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300026420|Ga0247581_1072768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300026434|Ga0247591_1109744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300026447|Ga0247607_1055938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300026448|Ga0247594_1061567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300026458|Ga0247578_1059285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300026462|Ga0247568_1111400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300026465|Ga0247588_1062340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300026465|Ga0247588_1088258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300026465|Ga0247588_1102123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300026468|Ga0247603_1133669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300026470|Ga0247599_1117112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300026470|Ga0247599_1135115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300026471|Ga0247602_1159884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300026495|Ga0247571_1094583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300026495|Ga0247571_1104708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300026495|Ga0247571_1129455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300026495|Ga0247571_1144123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300026500|Ga0247592_1150021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300026513|Ga0247590_1108643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300027197|Ga0208922_1076573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300027198|Ga0208163_1048176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300027216|Ga0208677_1042008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300027222|Ga0208024_1092572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300027243|Ga0208174_1025420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300027308|Ga0208796_1078660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300027416|Ga0207994_1085789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300027679|Ga0209769_1253429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300027687|Ga0209710_1179599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300027714|Ga0209815_1148791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300027741|Ga0209085_1145564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1005Open in IMG/M
3300027741|Ga0209085_1264057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300027749|Ga0209084_1147308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium989Open in IMG/M
3300027760|Ga0209598_10330798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300027791|Ga0209830_10419204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300027791|Ga0209830_10432528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300027810|Ga0209302_10342044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300027810|Ga0209302_10562173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300027813|Ga0209090_10250908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300027833|Ga0209092_10596797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300027836|Ga0209230_10541793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300027849|Ga0209712_10294889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium918Open in IMG/M
3300027849|Ga0209712_10300054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium909Open in IMG/M
3300027849|Ga0209712_10599867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300027976|Ga0209702_10190346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium880Open in IMG/M
3300027976|Ga0209702_10210887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium822Open in IMG/M
(restricted) 3300027996|Ga0233413_10553342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300028102|Ga0247586_1086581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300028137|Ga0256412_1327473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300028137|Ga0256412_1373402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300028137|Ga0256412_1396120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300028233|Ga0256417_1194728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300028282|Ga0256413_1216153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300028290|Ga0247572_1100346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300028333|Ga0247595_1069634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300028333|Ga0247595_1072479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300028575|Ga0304731_10165695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300028575|Ga0304731_10900632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300028575|Ga0304731_11087886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300028575|Ga0304731_11327067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300030653|Ga0307402_10854786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300030671|Ga0307403_10590756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300030671|Ga0307403_10603194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300030699|Ga0307398_10445049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300030702|Ga0307399_10503704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300030702|Ga0307399_10562226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300030702|Ga0307399_10625706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300030709|Ga0307400_10604515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300030720|Ga0308139_1065060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300030721|Ga0308133_1061854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300030722|Ga0308137_1054960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300030749|Ga0073969_11155498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300030780|Ga0073988_10003087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300030781|Ga0073982_10004110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300030856|Ga0073990_10006553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300030857|Ga0073981_11718430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300030956|Ga0073944_10679368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300031004|Ga0073984_10003085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300031004|Ga0073984_11257900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300031037|Ga0073979_12313787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300031038|Ga0073986_12015810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300031121|Ga0138345_10822023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300031522|Ga0307388_10921388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300031522|Ga0307388_10962071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300031523|Ga0307492_10314857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300031523|Ga0307492_10468219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031540|Ga0308143_122084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300031550|Ga0307392_1051340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300031556|Ga0308142_1075229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300031558|Ga0308147_1056143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300031569|Ga0307489_10458609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium859Open in IMG/M
3300031569|Ga0307489_10822301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300031589|Ga0307996_1097559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300031589|Ga0307996_1109894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300031594|Ga0302131_1298909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300031621|Ga0302114_10395159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300031621|Ga0302114_10414766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031622|Ga0302126_10170164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium796Open in IMG/M
3300031660|Ga0307994_1274873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300031674|Ga0307393_1134397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300031674|Ga0307393_1161617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300031674|Ga0307393_1165718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031688|Ga0308011_10183854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300031709|Ga0307385_10435608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031710|Ga0307386_10630999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300031710|Ga0307386_10645915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300031710|Ga0307386_10696557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300031717|Ga0307396_10601483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300031717|Ga0307396_10632350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300031725|Ga0307381_10228492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300031729|Ga0307391_10500869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300031729|Ga0307391_10567793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300031729|Ga0307391_10705981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300031729|Ga0307391_10741217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300031729|Ga0307391_10791030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300031729|Ga0307391_10874577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300031734|Ga0307397_10537033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300031737|Ga0307387_10936124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300031738|Ga0307384_10645154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300031739|Ga0307383_10423728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300031739|Ga0307383_10665826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300031743|Ga0307382_10514592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300031784|Ga0315899_11038420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300031857|Ga0315909_10736577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300032032|Ga0315327_10861922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032047|Ga0315330_10731260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300032047|Ga0315330_10766041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300032073|Ga0315315_11065415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300032092|Ga0315905_11243667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300032360|Ga0315334_11189611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300032492|Ga0314679_10476026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300032517|Ga0314688_10064272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1510Open in IMG/M
3300032517|Ga0314688_10645371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300032518|Ga0314689_10525795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300032521|Ga0314680_10795068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300032521|Ga0314680_10857934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300032540|Ga0314682_10603356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300032540|Ga0314682_10713980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300032650|Ga0314673_10611815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300032707|Ga0314687_10532586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300032708|Ga0314669_10500804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300032708|Ga0314669_10615998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300032708|Ga0314669_10756840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300032708|Ga0314669_10772100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300032711|Ga0314681_10661974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300032713|Ga0314690_10400725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300032730|Ga0314699_10510776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300032752|Ga0314700_10622822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300032820|Ga0310342_102839719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300033572|Ga0307390_10695758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300033572|Ga0307390_10821902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300033572|Ga0307390_10996002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300033572|Ga0307390_11099014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300033984|Ga0334989_0233247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1001Open in IMG/M
3300034021|Ga0335004_0438924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300034355|Ga0335039_0461163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300034355|Ga0335039_0604469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.98%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.35%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.86%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.86%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.74%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.28%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.19%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.58%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.58%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.46%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.09%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.09%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.97%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.61%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.61%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.36%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.36%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.12%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.12%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.12%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.12%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.12%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.12%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.12%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.12%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.12%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.12%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine0.12%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.12%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.12%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.12%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.12%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.12%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.12%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.73%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.73%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.73%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.49%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.49%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.24%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.24%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.24%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.24%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.24%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.24%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.24%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876011Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75mEnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000135Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 03_9.5mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000243Svalbard Archipelago station 2 sample NOR 18_50mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001824Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM36, ROCA_DNA073_0.2um_10gEnvironmentalOpen in IMG/M
3300002153Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M MetagenomeEnvironmentalOpen in IMG/M
3300002692Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003409Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNAEnvironmentalOpen in IMG/M
3300003427Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003733Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004642Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004762Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300009845Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 3m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011189Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #833EnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012781Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013076Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES042 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018532Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002420 (ERX1789576-ERR1719372)EnvironmentalOpen in IMG/M
3300018614Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018644Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782112-ERR1712144)EnvironmentalOpen in IMG/M
3300018646Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782189-ERR1712202)EnvironmentalOpen in IMG/M
3300018647Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000833 (ERX1782439-ERR1712057)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021133Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022827Saline water microbial communities from Ace Lake, Antarctica - #333EnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025455Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027222Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_14100522236876011Marine EstuarineGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLSTTLDKGFPYDD
DelMOWin2010_1017823213300000117MarineLALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD*
SA_S2_NOR13_50mDRAFT_101907713300000120MarineMHLENAMSAMTTTGFTDAEILSRNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*VLKVEE*
BS_KBA_SWE12_21mDRAFT_1017654813300000124MarinePTXDKPKALPQESQVLEKHSQLVNVPIDEKRALTLKVSPTFLLDEVNSVTLKSFRKIVGYDTFNSIRTQNRGELKDVSDYYNVTVSMMIRRKPAEVSAAPQRDPYSPDGAPSLAATLDKGFPYDEITN*
SA_S1_NOR05_45mDRAFT_1006432623300000127MarineMHLENAMSAMTTTGFTDAEILSRNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
SA_S1_NOR08_45mDRAFT_1009127913300000128MarineYKLDDIESVTLKSFRKIVGYDTFESIRKKERDERKDISDYYNVTVSMLVRRKPEDTAAPPKFDVYNPHGTQHLGQTLDKGFPYDDQNQYV*
KGI_S1_ANT03_95mDRAFT_103164613300000135MarineSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRXPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
KGI_S1_ANT02_95mDRAFT_1007767823300000136MarineMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
SA_S2_NOR18_50mDRAFT_104211813300000243MarineNAMSAMTTTGFTDAEILSRNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
BBAY94_1007787823300000949Macroalgal SurfaceMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
JGI20157J14317_1020922913300001352Pelagic MarineKRDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNXSKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
JGI20155J14468_1019833413300001354Pelagic MarineKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMVRRKPAEAAAAPARDPYSPDGAANLAATLDKGFPYDD*
JGI20158J14315_1011148813300001355Pelagic MarineMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDXSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
JGI20158J14315_1011427913300001355Pelagic MarineLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
JGI20158J14315_1013452823300001355Pelagic MarineMSLVQVGTQEHTYLHNALVTMTMKTDAELLESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPASLTPADVPTGAASLAAKLDKGFPYDD*
ACM36_11127213300001824Marine PlanktonDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
JGI24540J26637_1021186713300002153MarineVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0005226J37279_103256713300002692MarineAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
B570J40625_10174426213300002835FreshwaterVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
JGI26088J50261_105079213300003409MarineLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
JGI26084J50262_112141413300003427MarineSGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
JGI26083J51738_1009473813300003621MarineMQITKLVIAALMAVGVQSTEGPKFKSQQVSVPIDEKRALTLEVSPTFQLDEVQSVTLKSFRKIVGYDTFESIRKGNRGETKDTSDYYNVTVSMMVRRRPAEAAPAPKRDPYAPEGSASLASTLDKGFPYDD*
JGI26083J51738_1010036113300003621MarineMKFIKLAIAALVATAAAGDSKNRSQQVSVPIDEKRALTLQVSPTFALDDVQSVTLKSFRKIVGYDTFESIRKGDRSESKDTSDFYNVTVSMMIRRRPAEAAKSPKRDPYAPEGSASLASTLDKGFPYDD*
Ga0008273_100548513300003733MarineSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0007811_102226013300003787FreshwaterMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0031658_110281713300003860Freshwater Lake SedimentDYELDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLVRRRPADLAPAPPRDVYNPDGGASLASTLDKGFPYDD*
Ga0066612_130849813300004642MarineNAMQSMTSSKFTDAEILEQHSQKVNVPIDEKRALTLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAPTLASTLDKGFPYDD*
Ga0007749_117288613300004762Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007754_139417013300004764Freshwater LakeMGSRSQVVSVPIDEKRALSLKVSPTYALDKVESVTLKSFRKIVGYDTFESIRRKNRTEGKDTADYYNVTVSMLVKRDPVEAAAAPSRDPYAPNGAPSLAASLDKGFPYDD*
Ga0007745_139576113300004765Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007750_101103113300004767Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007748_1010588713300004769Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007752_1113438713300004789Freshwater LakeMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPNGAASLASTLDKGFPYDD*
Ga0007752_1121902913300004789Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPAALASTLDKGFPYDD*
Ga0007760_1001835523300004793Freshwater LakeLSMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007751_1139044713300004794Freshwater LakeMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPNGAASLASTLDKGFPYDD*ACLS*
Ga0007854_1028343023300004806FreshwaterKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0007757_1000608313300004810Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYD
Ga0007757_1144195913300004810Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPSALAATLDKGFPYDD*
Ga0071100_104484313300005043Marine Subseafloor AquiferVSVPIDEKRALTLKVSPTYTLDDVQSVTLKSFRKIVGYDTFESIRKKNRNEGKDTSDYYNVTVSMMVRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0071100_111561913300005043Marine Subseafloor AquiferAGSEASLHLENALSSMKGDAEILESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKAFRKIVGYDTFESIRRKNRNEQKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYNPDGAPALAASLDKGFPYDD*
Ga0066830_1010627223300005433MarineVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0066831_1009677113300005516MarineMTLQVAPTFGQDRVNSVTLKSFRKIVGYDTFESIRKKNRNEDKDTKDYYNVTVSMMVQRIPVASTAAAGKDPYNGASSLS*
Ga0066831_1010634213300005516MarineLSEEGTSVHAHLSNALHGANAAILEKNSQLVHVPIDEKRDLTLKVSPTYELDLVNSVTLKSFRKIVGYDTFDSIRKKSRSEGKDICDYYNVTVSMMIQRRPVEASPPPVRDPYNPEGAPTLAVTLDKGFPYDD*
Ga0066831_1012895213300005516MarineSQLVSVPIDEKRALTLKVSPTYDLDDVNSVTLKAFRKIVGYDTFESIRKKDRGETKDICDYYNVTVSMMIRRKPLELAPAPPIDPYNPSGASALASTLDKGFPYDD*
Ga0066831_1016252923300005516MarineATLEKNSQLVHVPIDEKRDLTLKVSPTYVLDLVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMIQRRPVEASPPPVRDPYNPEGAPTLASTLDKGFPYDD*
Ga0008649_1022491413300005838MarineMFISKLVALSMAAIAVSGKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0070742_1013126623300005942EstuarineMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0075501_122339213300006355AqueousVTLKAFRKIVGYDTFDSIRRKHRNEQKDTNDYYNVTVCTLVKRKPVAGTAPVIAPLASTLDKGFPYDD*
Ga0075501_128654113300006355AqueousLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075494_100615413300006382AqueousIIKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075494_141241013300006382AqueousMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075504_137302513300006383AqueousYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0075492_154298613300006394AqueousSMAAVHLNSALASMGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPVEAASAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0075488_157590113300006397AqueousVEVGSQAHAHLAAAANALEGANAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPGLASTLDKGFPYDD*
Ga0075495_157927323300006399AqueousIKMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075503_154889223300006400AqueousEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD*
Ga0075503_156689923300006400AqueousKMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0075514_175977913300006403AqueousSKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0075515_1081280213300006404AqueousKMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0099654_1016265223300006415LakeVTLKSFRKIVGYDTFESIRRKNRTEAKDTSDYYNITVSMLVKRDPVEASATPSRDPYAPDGAPSLSASLDKGFPYDD*KG*
Ga0075496_149505513300006419AqueousMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075496_149655913300006419AqueousIKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075497_101708513300006424AqueousINMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075505_149634413300006571AqueousKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0031676_141541813300006728Deep OceanLEGAAGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDSYNPDGAPSLASTLDKGFPYDD*
Ga0075467_1027500023300006803AqueousMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0070748_133063513300006920AqueousMVETGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0075469_1019124313300007231AqueousESLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD*
Ga0075463_1013944313300007236AqueousTAMKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075463_1026456813300007236AqueousLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0105019_113669813300007513MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0105019_122217223300007513MarineVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVEVSPAPPRDPYNPEGNPSLAATLDKGFPYDDSDR*
Ga0105019_125777123300007513MarineVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPARDPYNPDGAPALAATLDKGFPYDD*
Ga0105050_1037211213300007516FreshwaterVSPTFVLDEVNSVTLKSFRKIVGYDTFDSIRKKNRNESKDTSDYYNVTLSMMVRRKPAESASAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0105050_1042164013300007516FreshwaterMHLSNALSALTSKDNAADAKVIESHSQTVTVPIDEKRALTVKVLPTYILDEINSVTLKSFRKIVGYDTFNSIRKKNRNESKDTSDYYNVTVSMIVKRRPADAASAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102881_110155113300007551EstuarineLLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0102818_104828123300007552EstuarineMHLNNALSALKSDAEVMASHSQTVTVPIDEKRALTVKVQPTFVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPARDPYAPDGVPALAATLDKGFPYDD*
Ga0102822_112800313300007558EstuarineHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102870_122707713300007625EstuarineVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102825_111910023300007655EstuarineSALKSDAEVMASHSQTVTVPIDEKRALTVKVQPTFVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPARDPYAPDGVPALAATLDKGFPYDD*
Ga0102824_111985913300007681EstuarineSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0102867_115856123300007716EstuarineLDSVNSVTLKSFRKIVGYDTFESIRKKSRGEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0102852_109482613300007718EstuarineIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0105737_111547713300007862Estuary WaterSMTSKSDAEIMASHSQNVAVPIDEKRALTVRVSPTFVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTISMMVRRRPAEASAAPTRDPYAPDGAPALAATLDKGFPYDD
Ga0105739_109379723300007954Estuary WaterEAGSQAHAHLSAAANALEGSTAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0105745_113364413300007972Estuary WaterAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFASIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGYPYDD*
Ga0105745_117854113300007972Estuary WaterSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0102904_105511123300007981EstuarineMHFSKIVAIAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0105748_1054852713300007992Estuary WaterLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0114341_1031339013300008108Freshwater, PlanktonMVEQGSEAELHLNNALNAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114343_120088813300008110Freshwater, PlanktonELHLNNALNAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114336_123090413300008261Freshwater, PlanktonGSEAELHLNNALNAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114349_125417923300008263Freshwater, PlanktonLNAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114353_130189713300008264Freshwater, PlanktonPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114353_136208113300008264Freshwater, PlanktonPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0103951_1055882223300008832MarineRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIRRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0103951_1058013613300008832MarineMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0103951_1060313213300008832MarineLNSITTGGSASSGSKKVSGSCGAGEAVHVPIDEKRDLTLVVSPTYALDCVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRRPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0103951_1069020913300008832MarineEHLSNAAAAVTKNDAATLEGHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD*
Ga0103951_1078598413300008832MarineQLTTWLRLELSSTLTLVPLSMLWESKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD*
Ga0103882_1006087013300008834Surface Ocean WaterHLENAMQSMTEAKFTDAEILEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAPTLASTLDKGFPYDD*
Ga0103882_1009703013300008834Surface Ocean WaterEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0103883_106477413300008835Surface Ocean WaterDTFESIRKKDRAEVKDASDYYNVTVSMMVQRKPVALSPAPKRDPYAPDGAPSLAASLDKGFPYDD*
Ga0103732_104283213300008929Ice Edge, Mcmurdo Sound, AntarcticaMSKIEAGSGALVHLSHGLKALKTDGEINEAHSSLVSVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNITVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD*
Ga0103735_107115813300008932Ice Edge, Mcmurdo Sound, AntarcticaTAALGAIKTDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0103737_104078013300008934Ice Edge, Mcmurdo Sound, AntarcticaMKTDAEILESHSQIVQVPIDEKRALSFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTVSLMARRRPGESAAVAPTAAGAKSLASLLDKGFPYDD*
Ga0103738_104337313300008935Ice Edge, Mcmurdo Sound, AntarcticaMVGSEASVHLTAALGAMKTDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0103738_105631913300008935Ice Edge, Mcmurdo Sound, AntarcticaKCIFIIIYIIKMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD*
Ga0103741_110345913300008938Ice Edge, Mcmurdo Sound, AntarcticaMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD*
Ga0115651_137382113300008952MarineMISSKIVKLTLAALMVSASALRTHKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLASTLDKGFPYDD*
Ga0115651_138276213300008952MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPSPPRDPYNPEGGPSLAATLDKGFPYDD*
Ga0104258_106734923300008993Ocean WaterVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNITVSMMVQRKPVEAAAAPAAAHPASLAATLDKGFPYDD*
Ga0104258_107923913300008993Ocean WaterMSKIESGSEALVHLSHGLKAMQTDAQINEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD*
Ga0104258_110158813300008993Ocean WaterFSKIVMVAMAAVASAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102831_133328013300008996EstuarineAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102813_121055213300009003EstuarineYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102811_126707313300009024EstuarineSDAEQMAAHSQTVSVPIDEKRALTVKVAPTYVLDEISSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0103707_1016636613300009025Ocean WaterLVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0103708_10010364613300009028Ocean WaterVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASKLDKGFPYDD*
Ga0102826_106205113300009054EstuarineMHFSKIVALAMAAVAVSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102830_111771013300009059EstuarineLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0115566_1075496213300009071Pelagic MarineKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRHDRNETKDPSSYYNVTVSLMARRRPGESASAPPQAAGSKSLASLLDKGFPYDD*
Ga0102814_1058172113300009079EstuarineSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD*
Ga0114962_1025853613300009151Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114963_1045034313300009154Freshwater LakeFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKARDEAKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114963_1057533123300009154Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGP
Ga0114968_1027415323300009155Freshwater LakeMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0114995_1031461413300009172MarineMSKIESGSEALVHLSHGLKAMQTDAQINEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEEKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD*
Ga0114995_1045529913300009172MarineMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0114995_1056977013300009172MarineQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0114979_1034061213300009180Freshwater LakeMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0103743_106543613300009195Ice Edge, Mcmurdo Sound, AntarcticaDSRISEASVHLTAALGAMKTDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0103872_100270223300009263Surface Ocean WaterVEVGSAAHEHLSNAAAALTQNDAATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSPSLASTLDKGFPYDD*
Ga0103872_102550623300009263Surface Ocean WaterVGYDTFESIRKKSRGEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0103872_106474113300009263Surface Ocean WaterMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVDGAGAAGGATGTETLASKLDKGFPYDD*
Ga0103872_107712213300009263Surface Ocean WaterHLENALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0103874_103048313300009268Surface Ocean WaterNYELDTVQSVTLKAFRKIVGYDTFESIRRKDRNERKDSADYYNVTVSMMIQRVPLEVAPAPPRDPYAPDGAPSLAASLDKGFPYDD*
Ga0103874_103067713300009268Surface Ocean WaterAALTQNDAATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSPSLASTLDKGFPYDD
Ga0103876_100066713300009269Surface Ocean WaterMHLSNAAAALSGKSDAEINEAHSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD*
Ga0103878_103977213300009274Surface Ocean WaterRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0103879_1005390213300009276Surface Ocean WaterEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTTSMLIRRKPEETAAPPHVDIYNPQAGADTRLSSTLDKGFPYDDQDQSV*
Ga0114998_1029563413300009422MarineYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0114998_1062326413300009422MarineTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD*
Ga0115005_1064198413300009432MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115562_133453423300009434Pelagic MarineLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0115008_1042478223300009436MarineVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDFYNVTVSMMVQRKPLELAPAPLRDPYAPDGTSSLASTLDKGFPYDD*
Ga0115008_1080051823300009436MarineVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115008_1083300923300009436MarineVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNITVSMMVQRKPVEAAAAPAAAHPVSLAATLDKGFPYDD*
Ga0115007_1034600623300009441MarineVGYDTFESIRKKNRSESKDISDYYNVTVSMMVRRKPIEAASAPSRDPYNPDGNPSLASTLDKGFPYDD*
Ga0115007_1042706413300009441MarineMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115007_1079216213300009441MarineVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD*
Ga0115007_1131770013300009441MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDK
Ga0115557_120536223300009443Pelagic MarineMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115554_125910113300009472Pelagic MarineAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0115570_1037757213300009496Pelagic MarineLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115569_1037878213300009497Pelagic MarineNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPASDPYAPNGASSLASTLDKGFPYDD*
Ga0115569_1050754623300009497Pelagic MarineALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPAALTPAEVPSGAHSLASKLDKGFPYDD
Ga0115572_1077351913300009507Pelagic MarineMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGF
Ga0129287_1019385413300009538Beach Aquifer PorewaterLTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAPSLAATLDKGFPYDD*
Ga0115099_1003055913300009543MarineMLEKLVTVPIDEKRAMTLKVSPTFKLDDVESVTLKSFRKIVGYDTFESIRKAERDERKDISDYYNVTVSMLVRRKPEDTSPPPKFDIYNPHGTQHLGQTLDKGFPYDDQNQSS*
Ga0115099_1018368113300009543MarineIKMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0115099_1051928013300009543MarineAEAMSKVEAGSQAHAHLSAAANALEGSTAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD*
Ga0115099_1089075023300009543MarineQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD*
Ga0115006_1180635923300009544MarineTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYAPNGATSLASTLDKGFPYDD*
Ga0115013_1060533813300009550MarineFRKIVGYDTFESIRRKNRSERKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115013_1148328613300009550MarineSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDE*
Ga0115101_111432213300009592MarineALATFEGSHAHTHAGVRMMNDAATLEAHSQLVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD*
Ga0115101_112407013300009592MarineDVESVTLKSFRKIVGYDTFESIRKAERDERKDISDYYNVTVSMLVRRKPEDTAPPPKFDIYNPHGTQHLGQTLDKGFPYDDQNQSS*
Ga0115011_1142028313300009593MarineMYFTKLIALAMAATSVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLASTLDKGFPYDD*
Ga0115103_132878613300009599MarineMIEQLVTVPIDEKRALTLKVSPTYQLDDVESVTLKSFRKIVGYDTFESIRMKERDERKDISDYYNVTVSMLVRRKPEETAPPPKFDVYNPHGTQRLGQTLDKGFPYDDQNQSV*
Ga0115103_151562023300009599MarineMQAHLGAALNSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGSAALASTLDKGFPYDD*
Ga0115103_176786513300009599MarineMTMKTDAEILESHSQIVQVPIDEKRALSFKVSPTFTLDEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTVSLMARRRPVESAPAAATPAGAKSLSSLLDKGFPYDD*
Ga0115103_184022213300009599MarineIIKMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115103_184045413300009599MarineKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYYTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0115100_1015160713300009608MarineTVNSVTLKAFRKIVGYDTFESIRKQDRSEVKDSSDYYNVTVSMMIQRKPAAAAAPTASDPYNPNGSTNLAASLDKGFPYDD*
Ga0115100_1112651823300009608MarineVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD*
Ga0115104_1082868513300009677MarineKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115104_1082920213300009677MarineAKSDGEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0115104_1092721013300009677MarineAHEHLSNAAAALTQNDAATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTASLASTLDKGFPYDD*
Ga0115104_1123605013300009677MarineGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD*
Ga0115105_1017214113300009679MarineAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD*
Ga0115105_1028982313300009679MarineLVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115105_1052971813300009679MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD*
Ga0115105_1071281713300009679MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNITVSMMIKRKPAEVSPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0115105_1118323813300009679MarineNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115105_1120100113300009679MarineMHLDNALSAMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115105_1123670013300009679MarineHLNSALEALARNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0115105_1123734013300009679MarineAVAVSGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0115105_1133650913300009679MarineVEGRSTQIASVTLKAFRKIVGYDTFESIRMKDRSEVKDSSDYYDVTVSMMIQRKPQAVAAAPRADPYDPAGTSSLASSLDKGFPYDD*
Ga0115105_1135862313300009679MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDDAN*
Ga0123373_17362713300009732MarineSEVSAETKMHLESALDALSQKNDAAILEKNSQTVAVPIDEKRALTVKVSPTYTLDSINSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD*
Ga0123379_109360913300009738MarineEAMSKVEVGSAAHEHLTNAAAALSQNDAATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPIRDPYAPEGAPSLASQLDKGFPYDD*
Ga0123361_106059513300009741MarineLVSQALAMTHASSGAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115001_1040297323300009785MarineMGLEALKTDNEINEAHSALVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPQRDPYAPGGSASLASTIDKGFPYDD*
Ga0115001_1049423113300009785MarineMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115012_1134653113300009790MarineSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115012_1153279013300009790MarineRAHLRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0132158_11636013300009845Meromictic PondHSQTVAVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0123382_115195213300010135MarineSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0129345_125160923300010297Freshwater To Marine Saline GradientATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPIRDPYAPEGAPSLASQLDKGFPYDD*
Ga0129342_131603813300010299Freshwater To Marine Saline GradientPIDEKLAMTVKVSPTYALDDIQSVTLKAFRKIVGYDTFESIRVKERSEQKDTSDYYNVTVSMMVRRKPVEGAAAAGGAAAESLAAKLDKGFPYDD*
Ga0129323_110454513300010404AqueousHLSSAMESLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD*
Ga0138316_1092715113300010981MarineLVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLASTLDKGFPYDD*
Ga0138316_1101210313300010981MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVEVSPAPPRDPYNPEGSPSLAATLDKGFPYDD*
Ga0138316_1135001523300010981MarineVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGAPNLASTLDKGFPYDD*
Ga0138316_1136602823300010981MarineLATYAPDNAASLAAAIDKHSQLVDVPIDEKRALTLKVSPTFYLDEVNSVTLKAFRKIVGYDTFESIRKKSRGEAKDISDYYNVTVSMMIRRKPADVASAPPKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138316_1138860213300010981MarineIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLASTLDKGFPYDD*
Ga0138316_1163698013300010981MarineLENAAKALDATAAARSQTFSVPIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLASTLDKGFPYDD*
Ga0138326_1045319313300010985MarineQHLENAAKALDATAAARSQTFSVPIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLASTLDKGFPYDD*
Ga0138324_1032022523300010987MarineLTVSPNYELDTVQSVTLKAFRQIVGYDTFESIRRKDRNERKDSADYYNVTVSMMIQRVPLEVAPAPPRDPYAPDGSPSLAASLDKGFPYDD*
Ga0138324_1047489913300010987MarineNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD*
Ga0138324_1057792313300010987MarineMSGLEASTEAHAHLSSALEAMKTDAEINDSHSQLVTVPIDEKRALTLKVTPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNEVKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYDD*
Ga0138324_1058459913300010987MarineAVPIDEKLAMTVKVSPTYALDTINSVTLKAFRKIVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIRREPAAVAAAPKADPYDPAGSSSLSATLNKGFPYDD*
Ga0136558_116843913300011189Saline LakeGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0151620_122076313300011268FreshwaterMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYE*
Ga0138265_105785323300012408Polar MarineMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138265_142543013300012408Polar MarineSAMESLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLAATLDKGFPYDD*
Ga0138266_153148713300012412Polar MarineIIMKFSTIVACSMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138258_133700623300012413Polar MarineMESLTGTGFTDSEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLAATLDKGFPYDD*
Ga0138264_159105613300012414Polar MarineMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138264_166184013300012414Polar MarineLNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138264_181349423300012414Polar MarineIMHFSKIVACAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138263_103737113300012415Polar MarineVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD*
Ga0138262_162696523300012417Polar MarineDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129329_104720213300012470AqueousKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129334_106007413300012471AqueousMTLTVSPNYELDTVRSVTLKAFRKIVGYDTFESIRKKARDEVKDSSDYYNVTVSMLVQRKPADIATGPARDIYNPAGAPSLASTLDKGFPYDD*
Ga0129349_127824723300012518AqueousMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVEGASASTPAAGQSLSASLDKGFPYDD*
Ga0129349_129877113300012518AqueousKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0129331_116808613300012524AqueousVTLKAFRKIVGYDTFESIRKQDRSEVKDSSDYYNVTVSMMIQRKPAAAAAPTASDPYNPNGSTNLAASLDKGFPYDD*
Ga0129331_140733313300012524AqueousISPNYKLDTVNSVTLKAFRKIVGYDTFESIRRKDRTELKDSSDYYNVTVSLMVQRKPIELSPAPKRDIYAPDGTPGLASTLDKGFPYDD*
Ga0129353_129992513300012525AqueousMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD*
Ga0157630_102621813300012722FreshwaterELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0157611_105925613300012724FreshwaterKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDSDITVTARAPAWGDEKSDNRV*
Ga0138272_112462323300012756Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKARDEAKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0138267_114842213300012767Polar MarineKFSTIVACSMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD*
Ga0138286_136233313300012781Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD*
Ga0138268_112037213300012782Polar MarineMHFSKIVACAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138268_134511513300012782Polar MarineMAESGSEAKLHLESALNAMTSKSDAEVLEAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNKGKDTCDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138268_174110813300012782Polar MarineMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPASDPYAPDGAPSLAATLDKGFPYDD*
Ga0160423_1087966913300012920Surface SeawaterAALAGNDAATLDAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLASKLDKGFPYDD
Ga0160423_1115768413300012920Surface SeawaterRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD*
Ga0163110_1153380013300012928Surface SeawaterRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0163110_1168015813300012928Surface SeawaterMFKAIALAMAAVVSAKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0163179_1124609023300012953SeawaterKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0163179_1157408813300012953SeawaterEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD*
Ga0163179_1189964913300012953SeawaterLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDICDYYNVTVSMMIKRKPSEVSPAPPRDPYNPEGSPSLAATLDKGFPYDD*
Ga0163179_1218965813300012953SeawaterLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGAASLAATLDKGFPYDD*
Ga0163179_1219290713300012953SeawaterMYFTKLIALAMAATSVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLASTLDKGFP
Ga0163179_1222578413300012953SeawaterLAAAIDKHSMNVDVPIDEKRALTLRVSPTFYLDEVNSVTLKAFRKIVGYDTFESIRKKSRGEAKDISDYYNVTVSMMIRRKPADVAAAPPKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163111_1200151913300012954Surface SeawaterNALVTMTMKTDAEILESHSQIVQVPIDEKRALSFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTVSLMARRRPGESAAVPPQAAGAKSLASLLDKGFPYDD
Ga0163111_1271947423300012954Surface SeawaterSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLASTLDKGFPYDD*
Ga0129346_125232913300012965AqueousSIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGTPGLASTLDKGFPYDD*
Ga0129343_115914313300012967AqueousISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0129343_127464013300012967AqueousAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0129332_118758513300012969AqueousKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0157551_115141813300013076FreshwaterMLLVREVPTLFVPIDEKATMKIKVDPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPDGAPSLASTLDKGFPYDD*
Ga0182085_111696013300016723Salt MarshSVTLKAFRNIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0182092_107422313300016734Salt MarshKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0182074_103867923300016735Salt MarshVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182079_150785113300016741Salt MarshQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182079_165063913300016741Salt MarshPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSFDYYNVTVSMMVQRKPVELSLVFRRDPYAPDGTPSLASTLDKGFPYDD
Ga0182072_148972513300016754Salt MarshVHLENALEAMTSKSEAEILNSHSQTVAVPIDEKRALTIKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYNPDAAPSLAATLDKGFPYDD
Ga0182091_154134713300016766Salt MarshESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0181403_106207913300017710SeawaterHLSAAAAAMNGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0181403_106405413300017710SeawaterKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAASAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0181390_109069723300017719SeawaterVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0181383_107679523300017720SeawaterVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181388_110121623300017724SeawaterVQAGSQVHQHLQNAAAALNGDAAVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPSRDPYAPDGAPSLASTLDKGFPYDD
Ga0181418_105363013300017740SeawaterFEGSHAHTHAGVRMMNDAATLEAHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181427_115153813300017745SeawaterKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0181389_111962013300017746SeawaterRDNLDTVNSVTLKAFRKIVGYDTFESIRMKDRAEVKDSSDYYNVTVSMMIRREPAAVVAGPVADPYNPAGSNSLAASLDKGFPYDD
Ga0187219_110935713300017751SeawaterSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0181382_114565713300017756SeawaterAVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPSRDPYAPDGAPSLASTLDKGFPYDD
Ga0181410_116607023300017763SeawaterVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0181410_121535913300017763SeawaterIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0187220_107890913300017768SeawaterSGSAAHMHLAAASTALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0187221_115357523300017769SeawaterAAAISGNSDAATNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPSRDPYAPDGAPSLASTLDKGFPYDD
Ga0181395_121132713300017779SeawaterDLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD
Ga0181380_126449413300017782SeawaterGSEAHQHLSNAAAALSGNNDAAVNEAHSQLVSVPIDEKRALTLKVSPTYNLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAAPHDPYAPDGSATLASTLDKGFPYDD
Ga0169931_1051701523300017788FreshwaterMDKSQSFDNASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDXNERDLNYKIYNS
Ga0181584_1080814513300017949Salt MarshSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181583_1061879913300017952Salt MarshMQFTALAALLATVAAGPTHTQSVSVPIDEKQAMTLTVAPSYALDEVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIRRKPVEAAPAPQRDPYAPDGASSLASTLDKGFPYDD
Ga0181583_1064501113300017952Salt MarshKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0181583_1067094713300017952Salt MarshMQFAKLVLASLVATASAGAQHSQSVSVPIDEKQAMTLTVSPSYALDEVNSVTLKSFRKIVGYDTFDSIRKGDRNEAKDTSDYYNVTVSMMVKRKPAAASSSSKDPFNPNGAASLASTLDKGFPYDE
Ga0181582_1073776813300017958Salt MarshMQFTALAALLATVAAGPTHTQSVSVPIDEKQAMTLTVAPSYALDEVNSVTLKSFRKIVGYDTFDSIRKGDRNEAKDTSDYYNVTVSMMVRRKPAAASASSKDPFNPNGAASLASTLDKGFPYDE
Ga0181582_1083651213300017958Salt MarshYDTFESIRRKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPPVDPYNPNGAATLASTLDKGFPYDD
Ga0181582_1087269513300017958Salt MarshVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181581_1064959323300017962Salt MarshMKFAAIFAAVLATVAAKESVEARSQTVSVPIDEKRALTLKVSPTYDLDNVQSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIRRKPVEAAPAPQRDPYAPDGASSLASTLDKGFPYDD
Ga0181581_1067537613300017962Salt MarshSMTSGDEAILNQHSQTVAVPIDDKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181589_1082249913300017964Salt MarshSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181569_1083497513300017986Salt MarshTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0181569_1097484713300017986Salt MarshNYNLDTVNSVTLKAFRKIVGYDTFESIRKQDRSEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0181601_1029905113300018041Salt MarshMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0181572_1058721813300018049Salt MarshMYISKLVALVMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0181563_1063216923300018420Salt MarshNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0181592_1062459123300018421Salt MarshALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD
Ga0181593_1095357313300018423Salt MarshNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181591_1092190613300018424Salt MarshTLDTVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPPVDPYNPNGAATLASTLDKGFPYDD
Ga0181591_1111919813300018424Salt MarshNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181568_1058116513300018428Salt MarshMFKYAALAMAAVVSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192960_10411623300018515MarineMHLTSAAAALEGASGKDVEKGSQLVSVPIDEKRALTLKVSPTYSLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPTRDPYNPDGAPGLASTLDKGFPYDD
Ga0193008_10316513300018532MarineMHLSAASDALQGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0188846_103651713300018614Freshwater LakeMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0193133_102700123300018617MarineLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVAPAPPRDPYNPEGSPNLASTLDKGFPYDD
Ga0188862_102551713300018622Freshwater LakeKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0188862_103106813300018622Freshwater LakeFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192842_103265213300018625MarineQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193355_101365413300018628MarineMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAAAPNANGVASLAASLDKGFPYDD
Ga0193355_101550413300018628MarineMSGMKAGTEAHAHLSSALEAMGKTSTNDARSQLVTVPIDEKRALTLKVAPTYDLDTVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYDD
Ga0193355_101573913300018628MarineSPNYKLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0193355_102141513300018628MarineAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEAKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGTATLASTLDKGFPYDD
Ga0193355_102207823300018628MarineAGSQAQVHLENALTAMTSKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193355_102333523300018628MarineLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0193355_102999613300018628MarineESKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193352_104225313300018644MarineDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192895_102364813300018646MarineVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0192913_103762213300018647MarineSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192969_103598423300018649MarineMHLSSAAAALGGAAGKDVEKGSQLVSVPIDEKRALTLKVSPTYSLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPTRDPYNPDGAPGLASTLDKGFPYDD
Ga0192906_103935313300018658MarineLTVSPNYNLDTVNSVTLKAFRKIVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIQRKPVAAAAAPAADPYDPAGSSSLAATLDKGFPYDD
Ga0193159_105323413300018666MarinePIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193166_102341213300018674MarineMHFSKIVALAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIKSDLVRVXAQLLIHLVLMAIVDGTKEILLNENY
Ga0193206_102649113300018681MarineMFKAIALAMAAVVSAKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192944_103132613300018692MarineSHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0192944_103461923300018692MarineVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGATAGPNANGVASLAASLDKGFPYDD
Ga0192944_103736023300018692MarineLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPGLASTLDKGFPYDD
Ga0192944_104154113300018692MarineSETSAIKSLNQAAADLVIEAMSKIEAGSGALVHLSHGLKALKTDGEINEAHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPSGSASLASVIDHGFPYDD
Ga0192944_105286713300018692MarineMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLAATLDKGFPYDD
Ga0192944_105582713300018692MarineAQSMVGLEASAHLSAALGAMKTDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0193405_104257713300018701MarineLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0193391_103002223300018724MarineLTVSPNYELDTVQSVTLKAFRKIVGYDTFESIRRKDRNERKDSADYYNVTVSMMVQRVPLEVAPAPPRDPYAPDGAPSLAASLDKGFPYDD
Ga0193517_104893913300018725MarineLVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193517_105260023300018725MarineLVHVPIDEKRDLTLKVSPTYELDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0193517_106131213300018725MarineLDEVNSVTLKAFRKIVGYDTFESIRRKSRSESKDISDYYNITVSMMIRRKPVDVAAAPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0193517_106775423300018725MarineVNSITLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMVQRRPVEAASAPARDPYNPDGSPSLAETLDKGFPYDD
Ga0193517_107610513300018725MarineIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0192967_105112413300018730MarineMSKIEAGSGALVHLSHGLKALKSDAEINEAHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEAKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD
Ga0192967_106588913300018730MarineMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192967_106807713300018730MarineMSKIEAGSGALVHLSHGLKALKTDGEINEAHSSLVSVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNITVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD
Ga0192967_106993413300018730MarineMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD
Ga0193036_107664613300018733MarineTWDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193000_106052113300018745MarineAALSGKSDAEINESHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVAVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYD
Ga0193000_106933713300018745MarineAAAALSGDATLDAHSQLVSVPIDEKRALTLKVSPTYNLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLASKLDKGFPYDD
Ga0193147_108031913300018747MarineRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192827_105194023300018763MarineMTQVEAGSAAHQHLQNAAAALSGKTDAEVNDGHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD
Ga0192827_106259223300018763MarineLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0193031_104250113300018765MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVSPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193031_104504513300018765MarineLVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVDVSPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193031_104685513300018765MarineLVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_106110613300018765MarineLDSVNSITLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMIQRRPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_106568013300018765MarineMTQVEVGSAAHEHLSNAAAALAGKTDGEVNDAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0193031_108460713300018765MarineMQAHLGAALDSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD
Ga0193149_106315413300018779MarineNAEARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193124_104965913300018787MarineMAKVEVGSQAHQHLSNAAAALGGNDAATLEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD
Ga0193124_105789713300018787MarineCPPTTTSTPSTVTLKAFRKIVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIQRKPVAAAAAPAADPYDPAGSSSLAATLDKGFPYDD
Ga0193124_106823113300018787MarineLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYD
Ga0192950_107180013300018791MarineMTGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYD
Ga0193306_107414713300018800MarineGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193183_103624023300018811MarineMLWIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAPAHATSLAATLDKGFPYDD
Ga0193053_106070613300018823MarineAAELVAEAMSKVQVGSAAHEHLSNAAAALTHNDAATLESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD
Ga0193053_107003713300018823MarineLHSALETFEGAHSHTHAGVRMMNDASTFEAHSQLVSVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAGHGTSLAATLDKGFPYDD
Ga0192949_107631413300018831MarineLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAASLASTLDKGFPYDD
Ga0194240_101624313300018832MarineRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0194240_103595913300018832MarineTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192870_108464313300018836MarineHFSKIAALAMAAVVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193219_106781323300018842MarineAAADALEGASGKDALENGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193219_107636613300018842MarineSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193312_105145813300018844MarineAVHQHLSNAAASLAGKSDAEINEGHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPGLASTLDKGFPYDD
Ga0193475_104640213300018855MarineLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVEVSPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193475_106008213300018855MarineLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLASTLDKGFPYDD
Ga0193308_107163013300018862MarineKVESGSAAHMHLTAAADALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0192978_103607423300018871MarineMDVHVPIDEKRDLTLTVSPTFSLDKVSSVTLKSFRKIVGYDTFESIRKKNRSESKEISDYYNVTISMMIQRKPVEAASAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192978_108469413300018871MarineMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192978_108670313300018871MarineKMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192977_105614013300018874MarineMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192977_110381013300018874MarineIIKMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD
Ga0193337_105236213300018880MarineKGSQLVSVPIDEKRALTSKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193090_113898913300018899MarineSMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD
Ga0193244_110196013300018903MarineDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192868_1003251313300018913MarineLTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192868_1006743713300018913MarineAHMHLSNAAASLAGKTDAEVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSPSLASTLDKGFPYDD
Ga0192989_1006284013300018926MarineMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193260_1012603713300018928MarineKAFRKIVGYDTFESIRMKDRSEVKDSSDYYNVTVSMMIQRKAAAVAAAPSADPYDPAGSSSLAATLDKGFPYDD
Ga0192985_123650813300018948MarineAHMHLSSAAAALGGAAGKDVEKGSQLVSVPIDEKRALTLKVSPTYSLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPTRDPYNPDGAPGLASTLDKGFPYDD
Ga0193178_1004024923300018967MarineMSKVEVGSAAHEHLTNAAAALTKNDAATLEGHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0193178_1007402613300018967MarineHSHAHGRAHLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDTVQSVTLKAFRKIVGYDTFESIRQKERSEAKDTSDYYNVTVSMMVQRKPVESAAAPAATGGSLATTLDKGFPYDD
Ga0192894_1028505613300018968MarineMHLSNGLAALKTDAEINEGHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPQPMRDPYAPEGQPSLAAALDKGFPYDD
Ga0192894_1031949013300018968MarinePIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRNPLELAPAPQRDPYAPEGQPSLASSLDKGFPYDD
Ga0192873_1034502913300018974MarineEAHQHLSNAAAALSGNNDAAVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSASLASTLDKGFPYDD
Ga0192873_1037939123300018974MarineAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193006_1020457013300018975MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193006_1023101513300018975MarineMNMVDVNSDAYLHLSSALHAKAGTSQLVHVPIDEKRDLTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPSLAATLDKGFPYDD
Ga0193353_1019348713300018977MarineMYFTKLVAIAMASMAVSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193353_1021621813300018977MarineATHQHLSNAAASLSGKSDGEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLGSTLDKGFPYDD
Ga0193353_1021798313300018977MarineMGKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192961_1017583613300018980MarineMHFSKIVALAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDRIRVXTQSLIHLVLMADFEGNEDVIPNDN
Ga0192961_1017719713300018980MarineMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDRIRVXTQSLIHLVLMADFEGNEDVIPNDN
Ga0192961_1018726513300018980MarineMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLAATLDKGFPYDD
Ga0192947_1015669913300018982MarineMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGATAGPNANGVASLAASLDKGFPYDD
Ga0192947_1017945813300018982MarineTVSPNYNLDTVNSVTLKAFRKIVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIRREPAAVAAAPVADPYDPAGSTSLAATLDKGFPYDD
Ga0192947_1019272823300018982MarineMSKIEAGSGALVHLSHGLKALKTDGEINEAHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD
Ga0192947_1020278413300018982MarineTVSPNYRLDTVNSVTLKAFRKIVGYDTFDSIRKKDRNEVRDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLATTLDKGFPYDD
Ga0192947_1023627513300018982MarineLDHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0192947_1024435813300018982MarineMHFSKIVALAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192947_1029776113300018982MarineTYLHNALVTMTMKTDAEILESHSQIVQVPIDEKRALSFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTVSLMARRRPGESAAVAPTAAGAKSLASLLDKGFPYDD
Ga0193017_1023921813300018983MarineTQTHAHLTNALESLSRNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193017_1024474313300018983MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193017_1026903913300018983MarineLVHIPIDEKRDLTLKVSPTYALDTVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193275_1026185113300018988MarineLVHVPIDEKRDLTLKVSPTYALDTVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRQPSEVAPAPPRDPYNPEGAASLAATLDKGFPYDD
Ga0193030_1013885813300018989MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVDVSPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193030_1017579723300018989MarineVSPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNEVKDISDYYNVTLSMMIQRKPLELAARPNNMDPYSPTGAPTLASTLDKGFPYDD
Ga0193030_1017629013300018989MarineVAEAMSKVEAGSAAHQHLSNAAAALSGKSDGEINDAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0193030_1017687713300018989MarineVAEAMSKVEAGSAAHQHLSNAAAALSGKSDGEINDAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPSRDPYAPDGAPSLASTLDKGFPYDD
Ga0193030_1018753513300018989MarineMEFQRSHKTDAQILDAHSSTVSVPIDEKKALTLKVSPTYTLDEVNSVTLKAFRKIVGYDTFESIRKKDRNEEKDTSDYYNVTVSMMIKRKPVETATAAAAGASDTSTKKLSQLLDKGFPYDD
Ga0193030_1020014713300018989MarineMNVDVPIDEKRALTLRVSPTFYLDEVNSVTLKAFRKIVGYDTFESIRKKSRGEAKDISDYYNVTVSMMIRRKPADVAAAPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1020244623300018989MarineLVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKGRNESKDICDYYNVTVSMMIKRKPIEASAAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193030_1020553913300018989MarineLRNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDQIQSVTLKAFRKIVGYDTFESIRTKERNEKKDTNDYYNITVSMMVQRKPVEAAAAPAGSGVSLASSLDKGFPYDD
Ga0193030_1021661723300018989MarineMTMKTDAEILESHSQIVQVPIDEKRALSFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTVSLMARRRPGESAAVPPQAAGAKSLASLLDKGFPYDD
Ga0193030_1021775013300018989MarineMQAHLGAALDSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALAATLDKGFPYDD
Ga0193030_1025073213300018989MarineHAHLTNAAAALAGNDAATLEAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLASKLDKGFPYDD
Ga0193030_1028408513300018989MarineAEAMSKVESGSAAHEHLSNAAAALSGKSDAEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGPASLASTLDKGFPYDD
Ga0193030_1028732813300018989MarineNALYGLPAMGAPAAAATPTADAHSQLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRDESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0193030_1031516213300018989MarineVDIPIDEKRALTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPAPPRDPYNPEGSPNLASTLDKGFPYDD
Ga0193034_1009986623300019001MarineLVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLASTLDKGFPYDD
Ga0193034_1015892813300019001MarineGSAAHAHLQNAAASLAGKTDAEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGFDTFEAIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0193034_1016881713300019001MarineLDTVNSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMVQRRPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193033_1016967613300019003MarineLAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0192880_1016177613300019009MarineMQAHLGAALDSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0193044_1022726513300019010MarineMHFSKIVALTMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193044_1027606213300019010MarineMHFSKIVALTMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIIRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193569_1041647913300019017MarineEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPGLASTLDKGFPYDD
Ga0192982_1019583223300019021MarineMAESGSEAKLHLESALNAMTSKSDAEVLEAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEGKDTCDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192982_1019974223300019021MarineMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192982_1027109623300019021MarineMTSKSDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD
Ga0192982_1028855513300019021MarineMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0192982_1030056713300019021MarineQASAHLDAALTAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192982_1037527513300019021MarineMELIQTGTQEHTYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPAALTPAEVPSGVHS
Ga0192951_1036669713300019022MarineAFRKIVGYDTFESIRKQDRSEVKDSSDYYNVTVSMMIQRKPAAAAAPTASDPYNPNGSTNLAASLDKGFPYDD
Ga0193545_1007363413300019025MarineGTFEGAHTKTHTGVRMMNDAAALEAHSQLVSVPIDEKLALTVKVSPTHALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEPAAAPSGPAHATSLAATLDKGFPYDD
Ga0193545_1010807313300019025MarinePTLKAFRKIVGYDTFESIRMKDRSEVKDSSDYYNVTVSMMIQRKAAAVAAAPSADPYDPAGSSSLAATLDKGFPYDD
Ga0192909_1010699713300019027MarineMGVNAEAQAHLSNALSAMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLASTLDKGFPYDD
Ga0192909_1022298723300019027MarineLDSVNSITLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMVQRRPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0192909_1023409813300019027MarineLSNAAAALAGNDAATLEAHSQLVSVPIDEKRALTLKVSPTYTLDTVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLASKLDKGFPYDD
Ga0192909_1030376513300019027MarineMGGAPAAAATPTAEAHSQLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0193516_1016491213300019031MarineMTSQKSAARVHLENALSAMTTKTDAETLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAPHPDRDPYAPEGASTLAATLDKGFPYDD
Ga0193516_1016491613300019031MarineLTVSPTYYLDEVNSVTLKAFRKIVGYDTFESIRRKSRSESKDISDYYNITVSMMIRRKPADAAAAPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0193516_1016980513300019031MarineLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193516_1017677323300019031MarineLVHVPIDEKRDLTLKVSPTYELDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193516_1019739023300019031MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193516_1023917213300019031MarineMYFTKLIALAMAVAAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193516_1024508913300019031MarineHGNKTINKMFKLVAMAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193516_1026889313300019031MarineALSGNNDAAVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0193516_1028592213300019031MarineTETHSHLTNAIHALDGTLDKNSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMIQRKPVEASPAPQRDPYNPEGAPTLAATLDKGFPYDD
Ga0193516_1029450813300019031MarineNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0192869_1013947413300019032MarineMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192869_1022514213300019032MarineTWEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0192869_1023460713300019032MarineMGLDSHTQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192869_1026031313300019032MarineMHFSKIVALAMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDLQ
Ga0192869_1042261913300019032MarineMHFSKIVALAMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDLSRVXAQLLIHLVLMAVLEGNEEIILNDN
Ga0192869_1042370623300019032MarineVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKDRNESKDICDYYNVTVSMMIKRKPVDASPAPPRDPYNPEGSSSLAATLDKGFPYDD
Ga0192869_1044831933300019032MarineVSPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNQVKDISDYYNVTLSMMIQRKPLDLAARPNNMDPYSPAGVSTLASTLDKGFPYDD
Ga0192869_1045881613300019032MarineRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMIQRKPVALSPAPKRDPYNPSGAASLSATLDKGFPYDD
Ga0192869_1046261113300019032MarineHGLAMAATSVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLASTLDKGFPYDD
Ga0193037_1024469613300019033MarineLTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLASTLDKGFPYDD
Ga0193037_1026451113300019033MarineMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193037_1033501513300019033MarineALMLSSTEAVRTHKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLASTLDKGFPYDD
Ga0193037_1034782813300019033MarineTWGSLADNLDKHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPSLAATLDKGFPYDD
Ga0192945_1013799113300019036MarineVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGATAAPNANGVASLAASLDKGFPYDD
Ga0192945_1017760113300019036MarineAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192945_1018431423300019036MarineMSKIEAGSGALVHLSHGLKALKTDGEINEAHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPSGSASLASVIDHGFPYDD
Ga0192945_1023493713300019036MarineTMVDAKSAASQHLELALEAMTTNDAATMAANSKTVSIPIDEKRALTLKVSPTYVLDEVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDISDYYNVTVSMLIKRRPLALASAPPTDPYNPSGTGGLASTLEKGFPYDD
Ga0193123_1036986113300019039MarineNYNLDTVNSVTLKAFRKIVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIRREPAAVAAAPKADPYDPSGASSLSATLDKGFPYDD
Ga0192857_1036565913300019040MarineTLEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKYRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0192998_1015311423300019043MarineLVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEASPAPPRDPYNPEGHQALQLP
Ga0193336_1038388113300019045MarineDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193336_1038988413300019045MarineSADDRAASTSLGDHQMLEKLVTVPIDEKRAMTLKVSPTFKLDDVESVTLKSFRKIVGYDTFESIRKAERDERKDISDYYNVTVSMLIRRKPEDTAPPPKFDIYNPHGTQHLGQSLDKGFPYDDQNQYV
Ga0193336_1040236513300019045MarineMAKVEVGSTAHIHLANGLKALKTDAEINESHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPQRDPYAPEGAASLASQLDKGFPYDD
Ga0193336_1044328213300019045MarineMSKVEAGSTAHQHLSNAAAALSGDAATNEAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPARDPYAPEGAASLASSLDKGFPYDD
Ga0193336_1047774613300019045MarineMSKVEAGSAAHEHLSNAAAALSGKSDAEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPGLASTLDKGFPYDD
Ga0193336_1050469713300019045MarineVGSAVHSHLSNAAAALAGNDAATLDAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPMRDPYAPDGTPSLASKLDKGFPYDD
Ga0193336_1057810113300019045MarineLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPPRDPYNPDGNPSLAATLDKGFPYDD
Ga0193336_1060477513300019045MarineQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSASLASTLDKGFPYDD
Ga0193336_1063074813300019045MarineQILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193336_1063106713300019045MarineATSVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192981_1026193713300019048MarineMHLNSALEALKTDAEVMASHAQTVTVPIDEKRALTVKVAPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPARDPYAPDGIAALAATLDKGFPYDD
Ga0192981_1030367113300019048MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192981_1030547913300019048MarineMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALATTLDKGFPYDD
Ga0192981_1033109713300019048MarineLESALNAMTSKSDAEVLEAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEGKDTCDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192981_1035004513300019048MarineMRKNRSESKDIADYYNVTVSMMIKRVPVEANAAPAKDPYNPDGNPSLAATLDRGFPYDDXNCX
Ga0192966_1022452713300019050MarineVEAMQAKSAASLIAEAQAMVGSQASAHLDAALSAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192966_1033890613300019050MarineELALEAMTTNDAATMAANSKTVSIPIDEKRALTLKVSPTYVLDEVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDISDYYNVTVSMLIKRRPLALASAPPTDPYNPSGTGGLASTLEKGFPYDD
Ga0192826_1026756013300019051MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0192826_1027620513300019051MarineYNLDTVNSVTLKAFRKIVGYDTFESIRRKDRSEVKDSSDYYNVTVSMMIQRKPAAVAAAPRADPYDPAGSTSLAATLDKGFPYDD
Ga0192826_1030955413300019051MarineLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192826_1032842913300019051MarineMGTFESIRKKERDESKDISDYYNVTTSMLIRRKPEETAAPPHRDIYNPQGEGESLAATLDKGFPYDDQDQSV
Ga0192992_1034198013300019054MarineLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEASPAPARDPYNPEGAANLAKTLDKGFPYDD
Ga0188866_102023923300019095Freshwater LakeVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDFYNVTVSMMVQRKPLELAPAPLRDPYAPDGTSSLASTLDKGFPYDD
Ga0193153_102626723300019097MarineSELVAEAMAKVEAGSAAHMHLSAASDALQGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193153_102704113300019097MarineMLFSKIFAIAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193153_103135013300019097MarineALASLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193153_103252513300019097MarineSNAVASMSGKTDGEINDAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLADPYAPDGHPTLASTLDKGFPYDD
Ga0193045_104543213300019100MarineATAAARSQTFSVPIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFDSIRKKDRNEVRDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLATTLDKGFPYDD
Ga0194243_100560013300019102MarineLLHSALETFEGSHSRAHAGVRMMNDAATLEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPAAAHATSLAATLDKGFPYDD
Ga0193243_104870213300019116MarineMHFSKIVALAMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193054_107610213300019117MarineEAANALGPVLKAAGGNAARAQTFSVPIDEKRALSLTVSPNYALDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDASDYYNVTVSMMVQRKPVALSPAPKRDPYAPDGAPSLAASLDKGFPYDD
Ga0193157_101679713300019118MarineLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPAEVSPAPPRDPYNPEGSPNLGATLDKGFPYDD
Ga0193157_101831513300019118MarineVHIPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDICDYYNVTVSMMIKRKPVDVSPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0193157_102447923300019118MarineELVAEAMSKVQVGSAAHAHLQNAAASLAGKTDGEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSPNLASTLDKGFPYDD
Ga0193157_102461723300019118MarineMHLTNALSNADKAATLEKNSQLVHVPIDEKRDLTLKVSPTYELDLVNSVTLKSFRKIVGYDTFDSIRKKSRSEGKDICDYYNVTVSMMIQRRPVEASPPPVRDPYNPDGAPTLAVTLDKGFPYDD
Ga0193157_102705913300019118MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGSPNLGATLDKGFPYDD
Ga0193157_102973113300019118MarineHLSNAAAALSGKSDGEINDAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0193157_103170713300019118MarineAGSEAKVHLENALSAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193157_103318613300019118MarineGDNNKSIKKMYFTKLIALAMAVAAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193256_108076913300019120MarineEAMSKVEAGSQAHAHLSAAANALEGATAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0192980_107396513300019123MarineMHFSKIVAIAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0192980_107451213300019123MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0192980_107509213300019123MarineMKFSTIVACSMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0193104_104129213300019125MarineTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193436_107545713300019129MarineKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193089_111430613300019133MarineMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193089_111823913300019133MarineMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193089_113793313300019133MarineENAMSAMTTTGFTDAEILSRNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0193047_111993913300019139MarineAEAMAKVESGSAAHMHLAAASTALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0188870_1011416913300019149Freshwater LakeMNSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0188870_1012700713300019149Freshwater LakeIIKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0194244_1010766513300019150MarineKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192975_1027480813300019153MarineINMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0180037_126306813300019214EstuarineFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182064_133891713300019253Salt MarshVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182097_150966513300019261Salt MarshVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0182081_149551613300019277Salt MarshKFAAIFAAVLATVAAKESVEARSQTVSVPIDEKRALTLKVSPTYDLDNVQSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIRRKPVEAAPAPQRDPYAPDGASSLASTLDKGFPYDD
Ga0182058_129288113300019283Salt MarshAMSAMSSTKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182058_150986413300019283Salt MarshYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0182044_141447413300020014Salt MarshLENALSALTSKSDAEVLESHSQTVAVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRAEQKDVSDYYNVTVSMMVRRKPAEVAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0207193_153933813300020048Freshwater Lake SedimentLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDXDQN
Ga0194111_1030749513300020083Freshwater LakeTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPDGAPSLASTLDKGFPYDDXACLS
Ga0211729_1050932723300020172FreshwaterMVEQGSEAELHLNNALNAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDXD
Ga0206124_1016958113300020175SeawaterMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRREAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206130_1043626313300020187SeawaterEAMSKVEAGSQAHAHLSAAANALEGSTAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0211731_1034687513300020205FreshwaterTLKAFRKIVGYDTFESIRRKNRDENKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPSALAATLDKGFPYDDXKLMEINQXNKQKLIIKK
Ga0211686_1042023513300020382MarineASLIAEAQAMVGSQASAHLDAALSAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0211708_1033359113300020436MarineSGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0208090_105398913300020513FreshwaterIDEKAAMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPNGAASLASTLDKGFPYDD
Ga0208222_105145913300020566FreshwaterMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPDGAPSLASTLDKGFPYDDXACLS
Ga0206126_1035149513300020595SeawaterPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD
Ga0214201_105045113300020732FreshwaterMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLAST
Ga0214175_101599723300021133FreshwaterMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0206687_105387023300021169SeawaterMSYVQIGTKEHTYLNNALITMTAKTDAEILESHSQIVQVPIDEKRAISFKVSPTYTLDEVQSVTLKSFRKIVGYDTFDSIRRKDRNETKDPSSYYNITVSLMARRRPGESAAVAPAAAGAKSLASLLDKGFPYDDXENL
Ga0206687_124597223300021169SeawaterMQAHLGAALNSMGAAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGSAALASTLDKGFPYDD
Ga0206682_1029183313300021185SeawaterKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLSTTLDKGFPYDD
Ga0210308_107061313300021303EstuarineHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGQPSLAATLDKGFPYDD
Ga0206696_167037013300021334SeawaterMFKSIKLALAAVMVSQAEAIRTSKTDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNEAKDTSDYYNVTVCMMIRRRPAEAAAAPLADPYAPNGAPSLASTLDKGFPYDD
Ga0206691_102146813300021342SeawaterIHRNMNSSKIVKLTLAALMVSSVEAVHSSIFMMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPAGSASLASTLDKGFPYDD
Ga0206691_116389413300021342SeawaterTMSKIVKLTLAALMLSETSAVRTHKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLAASLDKGFPYDD
Ga0206691_130548013300021342SeawaterVNSVTLKAFRKIVGYDTFESIRKKDRNESKDISDYYNVTVSMMIKRKPIETAAASESPTDGTKKLAEILDKGFPYDD
Ga0206691_142608313300021342SeawaterVTPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNEVKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYDD
Ga0206691_152141513300021342SeawaterVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPSADPYAPNGAASLASTLDKGFPYDD
Ga0206691_160382023300021342SeawaterVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDDSDR
Ga0206691_169227023300021342SeawaterVPIDEKRALSMKVSPTFTLDEINSATLKSFRKVVGYDTFDSIRRHDRNETKDPTAHYNVTISLMVTRKPTEALVQASAPTGGSIAPHLDKGFPYDD
Ga0206688_1041976913300021345SeawaterGVEASAHLAAALGAMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0206688_1060706413300021345SeawaterKMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206688_1069703913300021345SeawaterMQAHLGAAPNPMGAAKGADARSRTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0206688_1070854913300021345SeawaterLKVSPTYYLDEVNSVTLKAFRKIVGYDTFESIRKKSRSESKDISDYYNITVSMMIRRKPADVASPPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0206695_140325313300021348SeawaterKIVKLTVAALMLSSAEALRTSKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLAATLDKGFPYDD
Ga0206692_101345923300021350SeawaterMQAHLGAALNSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0206692_118628313300021350SeawaterAAHEHLSNAAAALAGKTDGEVNDAHSQLVSVPIDEKRALTLKVSPTYTLDLVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPSLASTLDKGFPYDD
Ga0206692_134637713300021350SeawaterMLADASAIQSGSAVFAGKSDAEILESHSQIVNVPIDEKRALTLKVAPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLASTLDKGFPYDD
Ga0206692_155172113300021350SeawaterFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206692_179133613300021350SeawaterKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0206692_190797213300021350SeawaterMTMKTDAELLESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPASLTPADVPTGAASLAAKLDKGFPYDD
Ga0206693_102860313300021353SeawaterKMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0206693_143549313300021353SeawaterLKAFRKIVGYDTFESIRKKSRGEAKDISDYYNITVSMMIRRKPADVASAPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0206693_146447023300021353SeawaterLVHIPIDEKRDLTLKVSPTYELDTVNSVTLKSFRKIVGYDTFESIRKKNRNESKDICDYYNVTVSMMIQRVPVEAAAAPPRDPYNPEGSATLAATLDKGFPYD
Ga0206690_1001802013300021355SeawaterMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0206690_1027427923300021355SeawaterLDIVNSVTLKSFRKIVGYDTFESIRKKNRSENKDISDYYNVTVSMMIQRRPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206690_1094716413300021355SeawaterLGNPALFEKHSQLVHVPIDEKRDLTLKVSPTYALDKVNSVTLKSFRKVVGYDTFESIIKKARAEAKDTSDYYNVTVSMMIQRQPVEASPAPSRDPYNPEGAPTLAATLDKGFPYDD
Ga0206689_1000848113300021359SeawaterSKLVALTMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0206689_1022218423300021359SeawaterLKVTPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNEVKDISDYYNVTVSMMVQRKPLELAARPVQMDPYSPTGAPTLASTLDKGFPYDD
Ga0206689_1033976813300021359SeawaterMHLENALASMTSKSDADVMASHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPAKDPYAPDGVPSLAAQLDKGFPYDD
Ga0206689_1066866713300021359SeawaterNIKIKMYLTKLVAIAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0206689_1073952013300021359SeawaterMTASKSAARVHLENALSAMTTKTEAETLEAHSQLVSVPIDEKRALTLKVSPTYAYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEAKDISDYYNVTVSMMIKRRPLEVAPHPDRDPYAPEGASTLAATLDKGFPYDD
Ga0206689_1087073013300021359SeawaterVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPARDPYNPDGAPALAATLDKGFPYDD
Ga0206689_1118497913300021359SeawaterFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0213859_1038578513300021364SeawaterTDATAAARSQTFSVPIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPGLASTLDKGFPYDD
Ga0213863_1031927513300021371SeawaterQLDIVNSVTLKSFRTIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD
Ga0213863_1032030213300021371SeawaterLHNALVTMTMKTDAEILESHSQIVQVPIDEKRALAFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRRHDRNETKDPSSYYNVTVSLMARRRPGESASAPPQAAGSKSLASLLDKGFPYDD
Ga0213865_1047031613300021373SeawaterKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0213869_1025419813300021375SeawaterMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0213861_1042676023300021378SeawaterSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063107_11416613300021869MarineVNSVTLKAFRKIVGYDTFESIRKKDRTEIKDSSDYYNVTVSLMVQRKPVELSPAPKRDIYAPDGTPGLATTLDKGFPYDD
Ga0063132_10565023300021872MarineVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063132_13456913300021872MarineLTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0063147_12223713300021874MarineHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063124_10256613300021876MarineMISSKIVKLTLAALMVSQATAVRTSKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYAPNGAPSLAATLDKGFPYDD
Ga0063105_100352913300021887MarineIIKMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063089_100664913300021889MarineKMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063136_100431223300021896MarineLSPDLPPICILLLLLHALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0063097_111679913300021898MarineLENALESMTSKSDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD
Ga0063144_101059113300021899MarineIIKMHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063144_107553213300021899MarineSTAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0063086_102161413300021902MarineMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063088_100624313300021905MarineIKMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063088_101048513300021905MarineIKMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063106_101289713300021911MarineIIKMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063106_103811113300021911MarineINMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLXVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063133_105016513300021912MarineLTNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0063870_101193513300021921MarineVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063869_101612713300021922MarineKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063096_100089813300021925MarineKMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063103_110224113300021927MarineMTMKTDAEILESHAQIVQVPIDEKRALSFKVSPTFTLDEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDPSSYYNVTLSLMARRRPGESAPAAATPTGSKPLSALLDKGFPYDD
Ga0063756_104920613300021933MarineMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063139_102477213300021934MarineIKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063139_114393013300021934MarineTKLIALAMAATSVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAASLASTLDKGFPYDD
Ga0063108_106314013300021940MarineLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063102_100409913300021941MarineINMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063102_100915913300021941MarineIKMHFSKIVAIAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063102_107071213300021941MarineRKIVGYDTFESIRRKERNETKDTSDYYNITVSMMVQRKPVEAAAAPAAAHPVSLAATLDKGFPYDDXALXSTI
Ga0063098_100082913300021942MarineIIIKMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063755_101617913300021954MarineNMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0222717_1056754813300021957Estuarine WaterEKVLAQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0222718_1026184213300021958Estuarine WaterMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDRIRVXTQSFIHLVLMADFEGNEDVIPNDN
Ga0210312_11928813300022367EstuarineTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0210310_103001213300022369EstuarineIIIKMLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0222647_103532813300022827Saline WaterARVHLESALESLTSKSDAEVMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0255753_124711313300022926Salt MarshLESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0255781_1042375913300022934Salt MarshLSALTSKSDAEVLESHSQTVAVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRAEQKDVSDYYNVTVSMMVRRKPAEVAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0255770_1045931613300022937Salt MarshKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0255760_1049369813300023115Salt MarshLTVAPSYALDEVNSVTLKSFRKIVGYDTFDSIRKGDRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0255751_1042252013300023116Salt MarshNVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPPVDPYNPNGAATLASTLDKGFPYDD
Ga0214921_1050058623300023174FreshwaterMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPNGAASLASTLDKGFPYDDXACLS
Ga0255777_1050880513300023175Salt MarshTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0255759_1063128413300023178Salt MarshKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0232120_10755213300023555SeawaterKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0228688_12227313300023565SeawaterLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0228680_103338813300023695SeawaterKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
(restricted) Ga0233435_117213513300024252SeawaterMFISKLVALSMAAIAVSGKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0228658_106831413300024297SeawaterMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYYTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0244777_1040553823300024343EstuarineMHLNNALSALKSDAEVMASHSQTVTVPIDEKRALTVKVQPTFVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPARDPYAPDGVPALAATLDKGFPYDD
Ga0244777_1083394113300024343EstuarineMHFSKIVAIAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXSINSD
Ga0244775_1058910913300024346EstuarineMHFSKIVALAMAAVAVSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0244775_1146460113300024346EstuarineEQMAAHSQTVSVPIDEKRALTVKVAPTYVLDEISSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPALAATLDKGFPYDD
Ga0209634_125506813300025138MarineEAHSQLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPGLASTLDKGFPYDD
Ga0208376_107231423300025455FreshwaterVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0208660_106097523300025570AqueousMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0208660_111633413300025570AqueousESLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD
Ga0209654_110291613300025608MarineLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0209405_111221713300025620Pelagic MarineLKSFRKIVGYDTFESIRKKDRDERKDISDYYNVTTSMLIRRKPEETAPPPMRDVYNPEQSTNFAATLDKGFPYDDQDQSV
Ga0209405_114391713300025620Pelagic MarineMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209716_109468713300025626Pelagic MarineMSKIESGSEALVHLSHGLKAMQTDAQINEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0209136_116246413300025636MarineTDAEILEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAPTLASTLDKGFPYDE
Ga0208643_115399913300025645AqueousVHLNSALASMGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPVEAASAPARDPYAPDGAPALAATLDKGFPYDD
Ga0209095_118598813300025685Pelagic MarineVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0209653_116419013300025695MarineMQITKLVIAALMAVGVQSTEGPKFKSQQVSVPIDEKRALTLEVSPTFQLDEVQSVTLKSFRKIVGYDTFESIRKGNRGETKDTSDYYNVTVSMMVRRRPAEAAPAPKRDPYAPEGSASLASTLDKGFPYDD
Ga0208784_110443323300025732AqueousLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0208543_109583513300025810AqueousTAMKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0208872_118964513300025838FreshwaterKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0209603_134718513300025849Pelagic MarineMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAAT
Ga0208783_1040019313300025872AqueousAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209555_1016292513300025879MarineMKFIKLAIAALVATAAAGDSKNRSQQVSVPIDEKRALTLQVSPTFALDDVQSVTLKSFRKIVGYDTFESIRKGDRSESKDTSDFYNVTVSMMIRRRPAEAAKSPKRDPYAPEGSASLASTLDKGFPYDD
Ga0209534_1036295413300025880Pelagic MarineLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0209534_1045442013300025880Pelagic MarineGSEAHNYLHNAAVTMMMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPAALTPAEVPSGAHSLASKLDKGFPYDD
Ga0209631_1051114623300025890Pelagic MarineTHNYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPAALTPAEVPSGAHSLASKLDKGFPYDD
Ga0208763_104478913300026136MarineNALHSMNVNAEARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0208275_103164113300026182MarineLEKNSQLVHVPIDEKRDLTLKVSPTYVLDLVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMIQRRPVEASPPPVRDPYNPEGAPTLASTLDKGFPYDD
Ga0208275_105404213300026182MarineMTLQVAPTFGQDRVNSVTLKSFRKIVGYDTFESIRKKNRNEDKDTKDYYNVTVSMMVQRIPVASTAAAGKDPYNGASSLS
Ga0247581_107276823300026420SeawaterAAHMHLAAASTALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0247591_110974413300026434SeawaterAMHLENAMQSMTSSKFTDAEILEQHSQKVNVPIDEKRALTLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAPTLASTLDKGFPYDD
Ga0247607_105593813300026447SeawaterTFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNETKDTSDYYNVTVSMMVRRKPVEGAAPAPAAAGSVSLAASLDKGFPYDD
Ga0247594_106156713300026448SeawaterNDLHETCNDSIAVLRICTGEILTEREDTVIRFRVVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0247594_107161113300026448SeawaterKHSQLVSVPIDEKRALTLKVSPTYVLDEVQSVTLKSFREIVGYDTFESIRMKERDERKDISDYYNVTTSMLIRRKPEETAAPPHRDIYNPQAGSDTSLASTLDKGFPYDDQDQSVTA
Ga0247578_105928513300026458SeawaterLHSALETFEGSHSHAHGRARNDAATLEAHSQTVSVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0247568_111140013300026462SeawaterAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0247588_106234013300026465SeawaterIIIKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0247588_108825813300026465SeawaterMLEKLVTVPIDEKRAMTLKVSPTFKLDDVESVTLKSFRKIVGYDTFESIRKAERDERKDISDYYNVTVSMLVRRKPEDTSPPPKFDIYNPHGTQHLGQTLDKGFPYDDQNQSS
Ga0247588_110212313300026465SeawaterEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0247603_113366913300026468SeawaterEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0247599_111711213300026470SeawaterKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0247599_113511513300026470SeawaterGSHTKTHAGVRMMNDGAALEAHSQLVAVPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0247602_115988423300026471SeawaterALETFEGAHAHSHTRTHIRNDAATLEAHSQTVAVPIDEKLAMTVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRVKERNEAKDTSDYYNVTVSMMVRRKPVQGASAATPAAGQSLSASLDKGFPYDD
Ga0247571_109458313300026495SeawaterQIKILLKMHFSKIVALAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0247571_110470813300026495SeawaterPIDEKLALTVKVSPTYALDEIQSVTLKAFRKIVGYDTFDSIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0247571_112945513300026495SeawaterLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0247571_114412313300026495SeawaterATASADVAPPTGERAASTSLGDHQMLEKLVTVPIDEKRAMTLKVSPTFKLDDVESVTLKSFRKIVGYDTFESIRKAERDERKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247592_115002113300026500SeawaterSKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0247590_110864313300026513SeawaterRSQTFSVPIDEKRALSLTVSPNYKLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0208922_107657313300027197EstuarineGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0208163_104817613300027198EstuarineSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0208677_104200813300027216EstuarineQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0208024_109257213300027222EstuarineKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0208174_102542023300027243EstuarineVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYD
Ga0208796_107866013300027308EstuarineHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0207994_108578913300027416EstuarineLAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0209769_125342913300027679Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0209710_117959913300027687MarineRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDDXATCXGWLRKKVMYISPY
Ga0209815_114879113300027714MarineVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209617_1030402923300027720Freshwater And SedimentMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPA
Ga0209085_114556423300027741Freshwater LakeLDTVNSVTLKAFRKIVGYDTFESIRRKARDEAKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0209085_126405713300027741Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0209084_114730813300027749Freshwater LakeMVEQGSEAELHLNNALSAMDKSQSFDSASKLVAVPIDEKRALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRVKSRDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDXDQNQG
Ga0209598_1033079813300027760Freshwater LakeTLKAFRKIVGYDTFESIRRKARDEQKDISDYYNVTVSIMVKRRPADVSPIPKRDPYSPDGPAALASTLDKGFPYDDXDQYQR
Ga0209830_1041920423300027791MarineTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0209830_1043252813300027791MarineLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEEKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0209302_1034204423300027810MarineVGYDTFESIRKKNRSESKDISDYYNVTVSMMVRRKPIEAASAPSRDPYNPDGNPSLASTLDKGFPYDD
Ga0209302_1056217313300027810MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATL
Ga0209090_1025090813300027813MarineMYISKLVALAMATIAVSGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0209092_1059679713300027833MarineLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209230_1054179313300027836Freshwater And SedimentMGSRSQVVSVPIDEKRALSLKVSPTYALDKVESVTLKSFRKIVGYDTFESIRRKNRTEGKDTADYYNVTVSMLVKRDPVEAAAAPSRDPYAPNGAPSLAASLDKGFPYDD
Ga0209712_1029488913300027849MarineMLFSKIVAIAMAAVAVSAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209712_1030005413300027849MarineMHFSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIKSDRMRVXAQVHIHLVLMADFEGTEDVILNDN
Ga0209712_1059986713300027849MarineSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209702_1019034623300027976FreshwaterVSPTFVLDEVNSVTLKSFRKIVGYDTFDSIRKKNRNESKDTSDYYNVTLSMMVRRKPAESASAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209702_1021088713300027976FreshwaterMHLSNALSALTSKDNAADAKVIESHSQTVTVPIDEKRALTVKVLPTYILDEINSVTLKSFRKIVGYDTFNSIRKKNRNESKDTSDYYNVTVSMIVKRRPADAASAPARDPYAPDGAPSLAATLDKGFPYDD
(restricted) Ga0233413_1055334213300027996SeawaterEVQSVTLKSFRKIVGYDTFESIRRKDRDERKDISDYYNITVSMLVRRKPEVTSPPAKFDVYNPHGTQRLGQTLDKGFPYDDQNESV
Ga0247586_108658113300028102SeawaterNAMQSMTSSKFTDAEILEQHSQKVNVPIDEKRALTLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAPTLASTLDKGFPYDD
Ga0256412_132747313300028137SeawaterSKIVALAMAAVAVNAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETEDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0256412_137340213300028137SeawaterKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0256412_139612023300028137SeawaterKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0256417_119472813300028233SeawaterGSEAHAHLSSALEAFGKTKDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLDLAARPLQMDPYSPTGAPTLAATLDHGFPYDD
Ga0256413_121615313300028282SeawaterHSQLVSVPIYEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD
Ga0247572_110034613300028290SeawaterVSVPIDEKLALSVKVSPTYALDEIQSVTLKAFRKIVGYDTFESIRRKERNETKDTSDYYNVTVSMMVKRKPVEAAAAPAAAPPASLAATLDKGFPYDD
Ga0247595_106963413300028333SeawaterRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDIYAPDGTPGLASTLDKGFPYDD
Ga0247595_107247913300028333SeawaterMYISKLVALAMAAIAVQGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAXDPYAPDGAPSLASTLDKGFPYDDXAXLSDSLGSELIYSYTLC
Ga0304731_1016569523300028575MarineVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPSEVAPAPPRDPYNPEGAPNLASTLDKGFPYDD
Ga0304731_1090063213300028575MarineLVHVPIDEKRDLTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIKRKPVEVSPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0304731_1108788613300028575MarineMSGLEASTEAHAHLSSALEAMKTDAEINDSHSQLVTVPIDEKRALTLKVTPTYTLDIVNSVTLKAFRKIVGYDTFDSIRRKERNEVKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYD
Ga0304731_1132706713300028575MarineIDEKRALSLTVSPNYRLDTVNSVTLKAFRKIVGYDTFESIRKKDRNEVKDSSDYYNVTVSMMVQRKPVELSPAPKRDPYAPDGSPGLASTLDKGFPYDD
Ga0307402_1085478613300030653MarineIIMHFSKIVACAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307403_1059075613300030671MarineMAESGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLATTLDKGFPYDD
Ga0307403_1060319413300030671MarineLSLKVSPTYYLDEVASVTLKSFRKIVGYDTFESIRRKNRSESKEISDYYNVTVSMMVRRKPSEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0307398_1044504913300030699MarineLKISPTYYLDEVNSATLKAFRKIVGYDTFESIRKKSRSESKDISDYYNITISMMIRRQPADVASPPPKDPYNPDGNPSLAASLDKGFPYDD
Ga0307399_1050370423300030702MarineMVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0307399_1056222613300030702MarineSKIVAVAMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307399_1062570613300030702MarineMELIQTGTQEHTYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPAALTPAEVPSGAHSLAAKLDKGFPYDDXDS
Ga0307400_1060451513300030709MarineMELIQTGTQEHTYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0308139_106506013300030720MarineLFSKIVAMTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0308133_106185413300030721MarineGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0308137_105496023300030722MarineLDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0073969_1115549813300030749MarineVTLKAFRKIVGYDTFESIRKKDRNEVKDASDYYNVTVSMMVQRKPVALSPAPKRDPYAPDGAPSLAASLDKGFPYDD
Ga0073988_1000308713300030780MarineVGYDTFESIRKKDRSEVKDSSDYYNVTVSMMIRREPAAVAAAPKADPYDPSGASSLSATLDKGFPYDD
Ga0073982_1000411013300030781MarineVSPNYNLDTVNSVTLKAFRKIVGYDTFESIRRKDRSEVKDSSDYYNVTVSMMIQRKPAAVAAAPRADPYDPAGSSSLAATLDKGFPYDD
Ga0073990_1000655313300030856MarineMSKVEVGSAAHQHLSNAAASLSGKSDAEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGPASLASTLDKGFPYDD
Ga0073981_1171843013300030857MarineMHLMNAAASLAGKTDAEVNDGHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGAPGLASTLDKGFPYDD
Ga0073944_1067936813300030956MarineGYDTFESIRKKDRNEVKDSSDYYNVTVSMMIQRKPVALSPAPKRDPYNPSGAASLSATLDKGFPYDD
Ga0073984_1000308513300031004MarineTVSPNYNLDTVNSVTLKAFRKIVGYDTFDSIRKKDRNEVKDSSDYYNVTVSMMIQRKPAALAPPPATDPYNPAGTVSLANTLDKGFPYDD
Ga0073984_1125790013300031004MarineNSLTVSPNYNLDTVNSVTLKAFRKIVGYDTFDSIRKKDRSEVKDSSDYYNVTVSMMIQRKPAALAPPPATDPYNPAGTVSLANTLDKGFPYDD
Ga0073979_1231378723300031037MarinePSKLNQALPRSQTFSVPIDEKRAFSLTVSPNYELDTVQSVTLKAFRKIVGYDTFESIRRKDRNERKDSADYYNVTVSMMVQRVPLEVAPAPPRDPYAPDGAPSLAASLDKGFPYDD
Ga0073986_1201581013300031038MarineAKVHLENALNAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0138345_1082202313300031121MarineMHLSAASDALQGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASLSTRDSHTMTENG
Ga0307388_1092138813300031522MarineMTMKSDAEILESHSQIVQVPIDEKRALSFKVSPTFTADEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDSSSYYNVTVSLMARRRPGESAPAPATPAGAKSLASLLDKGFPYDD
Ga0307388_1096207113300031522MarineKMFKATIAAIAVYSANAIQSASFVGKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPSRDPYAPDGAPSLAATLDKGFPYDD
Ga0307492_1031485713300031523Sea-Ice BrineVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPSRDPYAPDGLPSLAATLDKGFPYDD
Ga0307492_1046821913300031523Sea-Ice BrineMTSKSDAETIASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGLPSLAATLDKGFPYDD
Ga0308143_12208413300031540MarineMDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEEKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0307392_105134013300031550MarineIVAFAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0308142_107522913300031556MarinePIDEKRDLTLKVAPTYNLDIVNSVTLKSFRMIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD
Ga0308147_105614313300031558MarineVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD
Ga0307489_1045860923300031569Sackhole BrineVTVPIDEKRALTVKVSPTFVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPTRDPYQPDGAASLSATLDKGFPYDD
Ga0307489_1082230113300031569Sackhole BrineAEIMTSHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307996_109755923300031589MarineMHFSKIVACAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDDXAIESDFCESDPNHTTCVNGIEGKEDDFLNEV
Ga0307996_110989413300031589MarineAAQVHLENALTAMTSKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0302131_129890913300031594MarineVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMIQRKPLELSPAPQRDPYSPGGSPSLASTIDKGFPYDD
Ga0302114_1039515913300031621MarineALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0302114_1041476613300031621MarineMLFSKIVAMTMAAVAVQAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAAT
Ga0302126_1017016413300031622MarineKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0307994_127487313300031660MarineSVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFVSIRKKDRNEAKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD
Ga0307393_113439713300031674MarineHFSKIVACAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307393_116161713300031674MarineMELIQTGTQEHTYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQKNRNETKDPSSYYIVTISLMAKRKVDPAALTPAEVPSGAHSLAAKLDKGFPY
Ga0307393_116571813300031674MarineAFAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0308011_1018385413300031688MarineAMVGSEASVHLQAALGAMKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0307385_1043560813300031709MarineHFSKIVLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307386_1063099913300031710MarineKMFIAKATLAALMVSDASAIQSGSALFAGKSDAEILESHSQIVNVPIDEKRALTLKVAPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPSRDPYAPDGAPSLAATLDKGFPYDD
Ga0307386_1064591513300031710MarineMFIAKATLAALMVADATAIQSGSALFVSKSDSEILESHSQIVNVPIDEKRALTLKVAPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTISMMIRRRPAEAAAAPSRDPYAPDGAASLAATLDKGFPYDD
Ga0307386_1069655713300031710MarineLLKSALHSLKSDAELLESHAQTVAVPIDEKRALTLKVSPTYALDEVNSVTLKSFRKIVGYDTFESIRKKSRNEAKDTSDYYNVTMSCLVRRKPTEAAAPAHDPYSKDDKSLSQKLDKGFPYDD
Ga0307396_1060148313300031717MarineMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0307396_1063235013300031717MarineMSYVQVGSEEHTYLHNALVTMTMKTDAEILESHSQLVQVPIDEKRALSFKVSPTFTLDEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDSSSYYNVTLSLMARRRPGESSAAPATAPGAKSLSSLLDKGFPYDD
Ga0307381_1022849223300031725MarineMSKIEAGSGALVHLSHGLKALKSDAEINEAHSSLVSVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMVQRKPLELAPAPQRDPYAPSGSASLASVIDHGFPYDD
Ga0307391_1050086913300031729MarineMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0307391_1056779323300031729MarineLVSVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNITVSMMVQRKPLELAPAPQRDPYAPGGSASLASVIDHGFPYDD
Ga0307391_1070598113300031729MarineMHFSKIVAFAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307391_1074121713300031729MarineMTMKTDAEILESHAQIVQVPIDEKRALSFKVSPTFTLDEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDSSSYYNVTLSLMARRRPGESAAAPATPAGSKSLSSLLDKGFPYDD
Ga0307391_1079103013300031729MarineIKMHFSKIVALTMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGSPSLAATLDKGFPYDD
Ga0307391_1087457713300031729MarineMAESGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307397_1053703313300031734MarineMELIQTGTQEHTYLHNALVTMTMKTDAEILESHSQIVNVPIDEKRAISFKVSPTYTLDEVNSVTLKSFRKVVGYDTFDSIRQHNRNETKDPSSYYNVTISLMAKRKVDPASLTPADVPSGAASLASKLDKGFPYDD
Ga0307387_1093612413300031737MarineMTMKSDAEILESHSQIVQVPIDEKRALSFKVSPTFTADEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDSSSYYNVTVSLMARRRPGESAPAPATPAGAKSLASLLDKGFPYDDXKQLEDKXFKS
Ga0307384_1064515413300031738MarineDARIHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDY
Ga0307383_1042372813300031739MarineLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPSRDPYNPDGNPSLAASLDKGFPYDD
Ga0307383_1066582613300031739MarineLAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307382_1051459213300031743MarineIAAIAVYSANAIQSSAFVGKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPSRDPYAPDGAPSLAATLDKGFPYDD
Ga0315899_1103842013300031784FreshwaterMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPDGAPSLASTLDKGFPYDD
Ga0315909_1073657713300031857FreshwaterKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDDXD
Ga0315327_1086192213300032032SeawaterMFISKLVALTMAAIAVSGKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0315330_1073126013300032047SeawaterDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0315330_1076604113300032047SeawaterPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDD
Ga0315315_1106541513300032073SeawaterLVSVPIDEKRALSLKISPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPGRDPYAPEGTPTLASTLDKGFPYDD
Ga0315905_1124366713300032092FreshwaterFRKIVGYDTFESIRRKNRDENKDISDYYNVTVSIMVRRRPADVSPIPKRDPYNPEGPNSLAATLDKGFPYDDXAFKVI
Ga0315334_1118961113300032360SeawaterSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPAADPYSPNGAPNLASTLDKGFPYDD
Ga0314679_1047602613300032492SeawaterINMHFSKIVMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314688_1006427223300032517SeawaterMTAAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314688_1064537113300032517SeawaterIIKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314689_1052579523300032518SeawaterVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0314680_1079506813300032521SeawaterVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDFYNVTVSMMVQRKPLELAPAPLRDPYPPDGTSSLASTLDKGFPYDD
Ga0314680_1085793413300032521SeawaterIKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314682_1060335623300032540SeawaterVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIFGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMIQRKPLELSPAPQRDPYSPGGSPSLASTIDKGFPYDD
Ga0314682_1071398013300032540SeawaterIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314673_1061181513300032650SeawaterINMHFSKIVMVSMAAVAQAKSDAEILESHSQIVNVPIDDKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314687_1053258623300032707SeawaterLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMLQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0314669_1050080413300032708SeawaterTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0314669_1061599823300032708SeawaterVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEMKDPSDFYNVTVSMMIQRKPLELSPAPQRDPYSPGGSPSLASTIDKRFPYDD
Ga0314669_1075684013300032708SeawaterMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314669_1077210023300032708SeawaterLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0314681_1066197413300032711SeawaterIIIKMHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314690_1040072513300032713SeawaterVPIDEKRALTLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0314699_1051077613300032730SeawaterHFSKIVAIAMAAVAVQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314700_1062282213300032752SeawaterMVAMAAVAQAKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0310342_10283971913300032820SeawaterDEKRALTLKVSPTYTLDIVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNITVSMMVQRKPLELAPAPLRDPYAPEGQPSLASALDKGFPYDD
Ga0307390_1069575813300033572MarineMAETGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307390_1082190223300033572MarineMAISSLNTNVDARSQNVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307390_1099600213300033572MarineAMAACVSAKTDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDDXAIESDQTVXAQFIIHLVLMVDYVEREVNIPNDN
Ga0307390_1109901413300033572MarineMSYVQVGSEEHTYLHNALVTMTMKTDAEILESHSQLVQVPIDEKRALSFKVSPTFTLDEVQSVTLKSFRKVVGYDTFDSIRRKDRNETKDSSSYYNVTLSLMARRRPGESSAAPATAPGAKSLSSLLDKGFP
Ga0334989_0233247_345_5963300033984FreshwaterLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0335004_0438924_246_5273300034021FreshwaterMKIKVNPDYALDTVQSVTLKAFRKIVGYDTFDSIRKKNRDEKRDSNDYYNVTVSMLIRRRPADLAPAPPRDVYNPNGAASLASTLDKGFPYDD
Ga0335039_0461163_361_6423300034355FreshwaterLTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKNRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD
Ga0335039_0604469_252_5363300034355FreshwaterALTLKVSPTYVLDTVNSVTLKAFRKIVGYDTFESIRRKSRDEQKDISDYYNVTVSIMVRRRPADVSPIPKRDPYSPDGPASLASTLDKGFPYDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.