NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316609_051436

Scaffold Ga0316609_051436


Overview

Basic Information
Taxon OID3300034627 Open in IMG/M
Scaffold IDGa0316609_051436 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.108B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)749
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)45.1993Long. (o)-83.3279Alt. (m)Depth (m)185
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054064Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0316609_051436_6_341F054064N/AMIPQIKKENKVGIKDLVGKKMTKNVKFMGEDVKISKLSVSEVLRIQDSAKDLEKDEGKGFDILKTVITSAVEGGSDLTDQDFDNFPMDELSKLSNEIMKFSGIGGEDNKGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.