Basic Information | |
---|---|
Taxon OID | 3300029659 Open in IMG/M |
Scaffold ID | Ga0206094_116177 Open in IMG/M |
Source Dataset Name | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 617 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 33.305 | Long. (o) | -116.2547 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001623 | Metagenome / Metatranscriptome | 661 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206094_1161771 | F001623 | N/A | YYNFSRKMSMDPFVRRMSMVAGIFAIIGVIVGVVALATNYWTMGNMMPMTNGNDTFISGWQWNGLFYMCSSRDNNVGCESHFWTTTFVLCLLGLIFMLVGGIFSIWEMFKLSDRRYFIPMLFFVAVVLMIAGLFDYASWARVNSHSSRAMLASICFAFVSLPISAYVAGRYSAYDRYTNNGHVHNGQKYVPASTNGN |
⦗Top⦘ |