NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255101_1017837

Scaffold Ga0255101_1017837


Overview

Basic Information
Taxon OID3300027588 Open in IMG/M
Scaffold IDGa0255101_1017837 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1081
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008489Metagenome / Metatranscriptome332Y
F021287Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0255101_10178371F021287GGAMANLTLITLTAPSLPYNYCPSNYQQLANDIIGGTQATFNSAIGNSFFNFGPTVPALNNQIYPWLDEDGNWWVFNQGRWTSKNRVAPNGFDRRIFVGTPTDLLSYDGGDGTATVTDVTGPMWMIDTAFEARFPVGVGSFAASGAVSVQGTTTTTSVVGEDKHTLTVPETAFNEHTHGVAQLIAPANDDYYLVN
Ga0255101_10178372F008489N/ADSNLSDPKKEIQWLVQTRAYNFELPFGLKKLDSGDIFIDSLDGNVGFNVEYRPDQYPSWLEWAEWSECAITTQCDNLCPISNFQPQYRPKMRLPTPTDIPCNSTISTPTRNLYEVQLNISISGYCRIKSIRVHAYDVQESPVGECRTFQGCKILEGCDINPLLYSSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.