NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209163_1083828

Scaffold Ga0209163_1083828


Overview

Basic Information
Taxon OID3300027536 Open in IMG/M
Scaffold IDGa0209163_1083828 Open in IMG/M
Source Dataset NameEnrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)830
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location
Location NameUSA: New Jersey, Arthur Kill intertidal strait
CoordinatesLat. (o)40.58Long. (o)-74.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046145Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0209163_10838281F046145N/AMLQVCLNFYWKLFKWITDRYEKTIPDLLECDHMALKPKPFSEAKTGFFITSRYLRVLSEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.